SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= cesb0028
         (956 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_UPI0000D569F2 Cluster: PREDICTED: similar to CG5521-PA;...   183   7e-45
UniRef50_UPI0000DB7041 Cluster: PREDICTED: similar to CG5521-PA,...   177   3e-43
UniRef50_UPI00015B4D3E Cluster: PREDICTED: similar to tuberin-li...   177   3e-43
UniRef50_Q9VB98 Cluster: CG5521-PA; n=3; Sophophora|Rep: CG5521-...   144   4e-33
UniRef50_Q7QB78 Cluster: ENSANGP00000011273; n=2; Culicidae|Rep:...   142   1e-32
UniRef50_Q6GYQ0 Cluster: GTPase-activating Rap/Ran-GAP domain-li...   100   5e-20
UniRef50_Q4RP25 Cluster: Chromosome 10 SCAF15009, whole genome s...    97   8e-19
UniRef50_Q2PPJ7 Cluster: 250 kDa substrate of Akt; n=36; Euteleo...    85   3e-15
UniRef50_Q5U493 Cluster: LOC495705 protein; n=7; Eumetazoa|Rep: ...    83   1e-14
UniRef50_Q4RNY6 Cluster: Chromosome 10 SCAF15009, whole genome s...    78   3e-13
UniRef50_UPI0000E46FBC Cluster: PREDICTED: similar to akt substr...    70   1e-10
UniRef50_A7SSP3 Cluster: Predicted protein; n=1; Nematostella ve...    70   1e-10
UniRef50_UPI0000498F17 Cluster: beta-galactosidase; n=3; Eukaryo...    54   5e-06
UniRef50_Q8GEG0 Cluster: Putative uncharacterized protein; n=1; ...    46   0.001
UniRef50_Q47336 Cluster: LacZ-alpha peptide; n=2; cellular organ...    46   0.001
UniRef50_Q37953 Cluster: LacZ protein; n=1; Phage M13mp18|Rep: L...    46   0.001
UniRef50_P00722 Cluster: Beta-galactosidase; n=35; root|Rep: Bet...    46   0.001
UniRef50_Q01SN5 Cluster: Putative uncharacterized protein precur...    35   2.7  
UniRef50_Q0C8S9 Cluster: Predicted protein; n=1; Aspergillus ter...    35   2.7  
UniRef50_Q4FX62 Cluster: Proteophosphoglycan 5; n=5; Eukaryota|R...    35   3.5  
UniRef50_Q2GU14 Cluster: Putative uncharacterized protein; n=1; ...    34   4.7  
UniRef50_Q7MSK3 Cluster: Putative uncharacterized protein; n=1; ...    34   6.2  
UniRef50_Q6C1J0 Cluster: Yarrowia lipolytica chromosome F of str...    34   6.2  
UniRef50_UPI0000F1F42D Cluster: PREDICTED: similar to proteophos...    33   8.2  
UniRef50_Q5QLZ3 Cluster: Gastric mucin-like protein; n=4; Oryza ...    33   8.2  
UniRef50_Q01LA1 Cluster: OSIGBa0113L04.7 protein; n=5; Oryza sat...    33   8.2  
UniRef50_A4S341 Cluster: Predicted protein; n=1; Ostreococcus lu...    33   8.2  
UniRef50_Q2H1R2 Cluster: Predicted protein; n=1; Chaetomium glob...    33   8.2  

>UniRef50_UPI0000D569F2 Cluster: PREDICTED: similar to CG5521-PA; n=1;
            Tribolium castaneum|Rep: PREDICTED: similar to CG5521-PA
            - Tribolium castaneum
          Length = 1843

 Score =  183 bits (445), Expect = 7e-45
 Identities = 115/290 (39%), Positives = 171/290 (58%), Gaps = 18/290 (6%)
 Frame = +3

Query: 3    RTACPRLPSYVTCLLQMLMMKNKNIAKVVSDCILVLADYTDRIVEMYPGLAGKIIRWICA 182
            +T  P++   +  LL  L   NK IA++ S+ + +L D+   +   YP L   +IR +CA
Sbjct: 1009 QTFHPKVADAINVLLLALKFNNKIIAQLASNILFLLCDHASLLWTQYPRLGNAVIRTLCA 1068

Query: 183  CLAQLST--SCHRDTVKPLAGSLLLCLAEFAVRCGPQYLMEEKD-GEQT---LLLLIFKV 344
             L + +   S   ++ K L  +LLLCL E+ +R  P+ L+E  + GE+    LLL +F V
Sbjct: 1069 ALFRHAPLGSTAGESDKALGTALLLCLGEWCMRLEPRRLLEVSEYGEERGTCLLLQVFTV 1128

Query: 345  LYAVMKGANGSDIEG-LSLP-VDDDFDPTIQLDNLGPKTIPASTID--------VKLWAQ 494
            LY +  G   ++  G LS P +++DFDP I  D+L  K+ P+ +          + L A+
Sbjct: 1129 LYKIAVGKTSTEHSGGLSQPSLNEDFDPNILSDDLVDKSSPSLSPTKNHQCQKAITLCAK 1188

Query: 495  TICTQLVLYLGHWPLWSGC-QLSCRVSEQHDSPSLG-EELGPAVLTAPNIQLMRFSDSTL 668
            T+ + LV +LGH+P+  G  +LS  V E  D P+L  +EL   + +APNIQL   +++ +
Sbjct: 1189 TVLSHLVTHLGHFPMAIGAARLSSLVVEHDDVPNLSSDELSANIFSAPNIQLFMLTENVI 1248

Query: 669  ASLIELPALDLPARAGTTPGLTTSERQVRVLLRDIGGKACWDASALYFDP 818
            ASLIELP LDLP   G T GL+T+++QVRVLLRD+ GKA WDAS LY  P
Sbjct: 1249 ASLIELPVLDLPG-GGVTAGLSTADKQVRVLLRDLSGKASWDASILYRTP 1297


>UniRef50_UPI0000DB7041 Cluster: PREDICTED: similar to CG5521-PA,
            partial; n=1; Apis mellifera|Rep: PREDICTED: similar to
            CG5521-PA, partial - Apis mellifera
          Length = 1594

 Score =  177 bits (432), Expect = 3e-43
 Identities = 111/275 (40%), Positives = 156/275 (56%), Gaps = 8/275 (2%)
 Frame = +3

Query: 18   RLPSYVTCLLQMLMMKNKNIAKVVSDCILVLADYTDRIVEMYPGLAGKIIRWICACLAQL 197
            R+P  VT LL  L   +  +A+V  D +L+L D  D ++E+YP +  KII+ +   L  +
Sbjct: 1108 RIPEAVTVLLLALKASHATVAQVACDSLLLLCDKADILLELYPNVPCKIIQILSETLGYM 1167

Query: 198  STSCHRDTVKPLAGSLLLCLAEFAVRCGPQYLMEEKDGEQTLLLLIFKVLYAVMKGANGS 377
            ST   R+   PL  S+L CL E+A+  GP  L+     E+ LL+ +F VL  +++     
Sbjct: 1168 ST---RERRGPLTISMLFCLGEWAMHLGPSVLLRVFQ-EKPLLMTLFTVLDNIVQDKIDK 1223

Query: 378  DIEGLSLPVD-DDFDPTIQLDNLGPKTIPASTI-----DVKLWAQTICTQLVLYLGHWPL 539
            D   ++   D DDFDP I LDNL  +    S        V+L A+ +   L+ +LGH+P+
Sbjct: 1224 DAPQINKNEDEDDFDPDITLDNLADEVCAKSPRRGNIQSVQLAAKMVMMHLINHLGHFPM 1283

Query: 540  WSGC-QLSCRVSEQHDSPSL-GEELGPAVLTAPNIQLMRFSDSTLASLIELPALDLPARA 713
              G  +LS  V E  D P + G+EL  A+  APNIQL+  S+S + SL+EL ALD P   
Sbjct: 1284 GIGAARLSSLVVELDDVPGIDGDELSSAIFHAPNIQLLMLSNSVIMSLVELAALDAPG-G 1342

Query: 714  GTTPGLTTSERQVRVLLRDIGGKACWDASALYFDP 818
            G T GLTT+   VRVLLRD+ GKA WD+S LY  P
Sbjct: 1343 GVTAGLTTAPSLVRVLLRDLAGKASWDSSILYSQP 1377


>UniRef50_UPI00015B4D3E Cluster: PREDICTED: similar to tuberin-like
            protein 1; n=1; Nasonia vitripennis|Rep: PREDICTED:
            similar to tuberin-like protein 1 - Nasonia vitripennis
          Length = 1878

 Score =  177 bits (431), Expect = 3e-43
 Identities = 112/281 (39%), Positives = 159/281 (56%), Gaps = 9/281 (3%)
 Frame = +3

Query: 21   LPSYVTCLLQMLMMKNKNIAKVVSDCILVLADYTDRIVEMYPGLAGKIIRWICACLAQLS 200
            +P  V  LL  L   +  +A+V  DC+L+L D  D ++E YP +  KII+ +   L +  
Sbjct: 1093 IPEAVNVLLLSLKTNHATVAQVACDCLLLLCDKADVLLEQYPNVPAKIIQSLSETLER-- 1150

Query: 201  TSCHRDTVKPLAGSLLLCLAEFAVRCGPQYLMEEKDGEQTLLLLIFKVLYAVMKGANGSD 380
             S  R+    L  S+L CL E+A+  GP  L+    G+  LLL +F VL  +++  +  D
Sbjct: 1151 -SMIRERKSALTISMLFCLGEWAMHLGPSMLLRVFQGKP-LLLTLFSVLDNIVQNKSSKD 1208

Query: 381  IEGLSL--PVDDDFDPTIQLDNL----GPKTIPASTID-VKLWAQTICTQLVLYLGHWPL 539
             + +S   P  +DFDP+I LDNL      K++    I  V+L A+ +   LV +LGH+P+
Sbjct: 1209 SQEVSKAQPEKEDFDPSIALDNLFDESSSKSLWRGNIQSVQLAAKMVMMHLVNHLGHFPM 1268

Query: 540  WSGC-QLSCRVSEQHDSPSL-GEELGPAVLTAPNIQLMRFSDSTLASLIELPALDLPARA 713
              G  +LS  V E  D P +  +EL  A+  APNIQL+  S+S + SLIEL  LD P   
Sbjct: 1269 GIGAARLSSLVVELDDVPGIESDELSSAMFHAPNIQLLMLSNSIIMSLIELDTLDAPG-G 1327

Query: 714  GTTPGLTTSERQVRVLLRDIGGKACWDASALYFDPSGGQLE 836
            G T GLTT+   VRVLLRD+ GKA WD+S LY  PS  ++E
Sbjct: 1328 GVTAGLTTAPSMVRVLLRDLAGKASWDSSILYNQPSNDEVE 1368


>UniRef50_Q9VB98 Cluster: CG5521-PA; n=3; Sophophora|Rep: CG5521-PA -
            Drosophila melanogaster (Fruit fly)
          Length = 1958

 Score =  144 bits (348), Expect = 4e-33
 Identities = 107/298 (35%), Positives = 155/298 (52%), Gaps = 26/298 (8%)
 Frame = +3

Query: 15   PRLPSYVTCLLQMLMMKNKNIAKVVSDCILVLADYTDRI--VEMYPGLAGKIIRWICACL 188
            PR+   +  LLQ L  K+  IA V  D + + A+   ++  +E  P L   II  IC  L
Sbjct: 1134 PRIKEVLQVLLQALQFKHHTIAIVAVDSLKLCAERGRQLAAIERVPQL---IITAICKAL 1190

Query: 189  AQLSTSCHRDTVKPLAGSLLLCLAEFAVRC-GPQYLMEEKDGEQTLLLLIFKVLYAVMKG 365
               S +  +D+ K +  SL+LCL EF +    P  L    +   TL+L + +VL  V  G
Sbjct: 1191 EIQSVTKPKDSDKVVLTSLMLCLGEFCMAIPAPIMLTPFNEQGDTLVLQVLRVLLQVASG 1250

Query: 366  ANGSDIEGLSLPVDDDFDPTIQLDNL-GPKTIPASTID-----------VKLWAQTICTQ 509
            A     E + L  DDDFD  I  D+L G   +P +T             +KL A+ +   
Sbjct: 1251 APRH--ERVKLTADDDFDMHIAHDDLQGDGRLPEATYQTSETIQKCITAIKLCAKAVSMH 1308

Query: 510  LVLYLGHWPLWSGC-QLSCRVSEQHD--SPSLGEELG--------PAVLTAPNIQLMRFS 656
            LV ++GH+P+  G  +LS  V EQ D  + + G ++         P+V++A N+QL   +
Sbjct: 1309 LVTHIGHFPMGIGASRLSSMVEEQDDIGNAAYGGQVETRRDSVELPSVVSAQNMQLFMLN 1368

Query: 657  DSTLASLIELPALDLPARAGTTPGLTTSERQVRVLLRDIGGKACWDASALYFDPSGGQ 830
               +AS IELP L LP   G T GL T+++QVRVL+RD+ GKACWDAS LY +P   +
Sbjct: 1369 SGLVASFIELPTLKLPG-GGITAGLVTADKQVRVLMRDLNGKACWDASILYSEPRNAE 1425


>UniRef50_Q7QB78 Cluster: ENSANGP00000011273; n=2; Culicidae|Rep:
            ENSANGP00000011273 - Anopheles gambiae str. PEST
          Length = 1972

 Score =  142 bits (344), Expect = 1e-32
 Identities = 105/297 (35%), Positives = 154/297 (51%), Gaps = 30/297 (10%)
 Frame = +3

Query: 6    TACPRLPSYVTCLLQMLMMKNKNIAKVVSDCILVLADYTDRIVEMYPGLAGKIIRWICAC 185
            T  PR+      +LQ L  K+  IA++ S+ + + A+   RI E    L   II  +C  
Sbjct: 1151 TVNPRIREAFQVILQALQFKHHTIARLASETLKLCAEQGARI-EQIERLPQLIIDTVCLS 1209

Query: 186  LAQLSTSCHRDTVKPLAGSLLLCLAEFAVRCGPQYLMEEK--DGEQTLLLLIFKVLYAVM 359
            L   +    +++ K +  SLLL L E  +    + L + K  D  + L+L++F++LY + 
Sbjct: 1210 LDIHNVPHPKESDKTVLTSLLLTLGELCMSFSVRTLQQPKHHDSTEPLILIVFRILYKIA 1269

Query: 360  KGA-NGSDIEGLSLPVDDDFDPTIQLDNL---GP------------KTIPASTIDVKLWA 491
             G  NG  I+  +   D+DFD TI +D++   GP            +TI +    ++L A
Sbjct: 1270 TGLQNGERIKLFT--TDEDFDSTIVVDDVRESGPGGIGEAGGYQTAETIASCQSAIRLCA 1327

Query: 492  QTICTQLVLYLGHWPLWSGC-QLSCRVSEQHD-----------SPSLGEELGPAVLTAPN 635
            +T+   L+  LGH+P+  G  +LS  V EQ D            P +G      VL +PN
Sbjct: 1328 KTVAMHLITNLGHFPMGIGATRLSSLVDEQDDLMSATGAAAPVHPGVGGAAPSHVLASPN 1387

Query: 636  IQLMRFSDSTLASLIELPALDLPARAGTTPGLTTSERQVRVLLRDIGGKACWDASAL 806
            +QL+  S   +AS IELPAL LP   G T GL T+ RQVR+LLRD+ GKACWDAS L
Sbjct: 1388 LQLLMLSPELVASFIELPALKLPG-GGATAGLLTANRQVRLLLRDLNGKACWDASIL 1443


>UniRef50_Q6GYQ0 Cluster: GTPase-activating Rap/Ran-GAP domain-like 1;
            n=48; Euteleostomi|Rep: GTPase-activating Rap/Ran-GAP
            domain-like 1 - Homo sapiens (Human)
          Length = 2036

 Score =  100 bits (240), Expect = 5e-20
 Identities = 85/306 (27%), Positives = 147/306 (48%), Gaps = 38/306 (12%)
 Frame = +3

Query: 15   PRLPSYVTCLLQMLMMKNKNIAKVVSDCILVLADYTDRIVEMYPGLAGKIIRWICACLAQ 194
            P++   +  +   L   NK +A V  + + +L  Y  R+    P    KII+ + A +  
Sbjct: 1312 PQIKEALNVICVSLKFTNKTVAHVACNMLHMLVHYVPRLQIYQPDSPLKIIQILIATITH 1371

Query: 195  LSTSCHRDTV---KPLAGSLLLCLAEFAVRCGPQYLME-------EKDG-EQTLLLLIFK 341
            L  S    +    K L  SLLLCL ++ +    + L++       E D  E+++L  I+K
Sbjct: 1372 LLPSTEASSYEMDKRLVVSLLLCLLDWIMALPLKTLLQPFHATGAESDKTEKSVLNCIYK 1431

Query: 342  VLYAVMKGANG-SDIEGLSLPVDD----DFDPTIQLDNL-------------GPKTIPAS 467
            VL+  + GA   S+     + + D    D+DP + L++L               K  P +
Sbjct: 1432 VLHGCVYGAQCFSNPRYFPMSLSDLASVDYDPFMHLESLKEPEPLHSPDSERSSKLQPVT 1491

Query: 468  TID-------VKLWAQTICTQLVLYLGHWPLWSG-CQLSCRVSEQHDSP-SLGEELGPAV 620
             +        + + A+T+ T LV +LGH+P+  G   L+ +V E HD+  S   EL P +
Sbjct: 1492 EVKTQMQHGLISIAARTVITHLVNHLGHYPMSGGPAMLTSQVCENHDNHYSESTELSPEL 1551

Query: 621  LTAPNIQLMRFSDSTLASLIELPALDLPARAGTTPGLTTSERQVRVLLRDIGGKACWDAS 800
              +PNIQ    +++TL S I++ + +     G + GL ++   VR+++RD+ GK  WD++
Sbjct: 1552 FESPNIQFFVLNNTTLVSCIQIRSEENMPGGGLSAGLASANSNVRIIVRDLSGKYSWDSA 1611

Query: 801  ALYFDP 818
             LY  P
Sbjct: 1612 ILYGPP 1617


>UniRef50_Q4RP25 Cluster: Chromosome 10 SCAF15009, whole genome
            shotgun sequence; n=1; Tetraodon nigroviridis|Rep:
            Chromosome 10 SCAF15009, whole genome shotgun sequence -
            Tetraodon nigroviridis (Green puffer)
          Length = 1075

 Score = 96.7 bits (230), Expect = 8e-19
 Identities = 78/255 (30%), Positives = 127/255 (49%), Gaps = 36/255 (14%)
 Frame = +3

Query: 162  IIRWICACLAQLSTSCHRDTVKPLAGSLLLCLAEFAVRCGPQYLM---------EEKDGE 314
            +I  I   L    +S H+   K L  SLLLCL ++ +   PQ L+         E++   
Sbjct: 261  LIATITYLLPSTESSPHQQD-KRLVVSLLLCLLDWVMALPPQTLLQPVQTRSLPEKEQPT 319

Query: 315  QTLLLLIFKVLYAVMKGANGSDIEG-----LSLPVDDDFDPTIQLDNL------------ 443
            +TLL  I+KVL+  + GA   + +      LS  +  D+DP + L++L            
Sbjct: 320  KTLLSCIYKVLHGCVYGAQSFNSQKYFPMQLSDLLSPDYDPFLPLESLREPEPLHSPDSE 379

Query: 444  -GPKTIPASTID-------VKLWAQTICTQLVLYLGHWPLWSG-CQLSCRVSEQHDSPSL 596
               K  P + +        V + A+T+ T LV +LGH+P+  G   LS +V+E  D+P  
Sbjct: 380  RSSKVQPVTEVHSRIQQGLVSIAARTVITHLVNHLGHYPMSGGPATLSSQVAENQDNPFC 439

Query: 597  -GEELGPAVLTAPNIQLMRFSDSTLASLIELPALDLPARAGTTPGLTTSERQVRVLLRDI 773
               +LGP +  +PN+Q +  + STL S+ ++ +       G T GL+++   VRV++RD+
Sbjct: 440  ESADLGPELFHSPNLQFLVLNGSTLLSVYQIRSESGVPGGGMTAGLSSAPACVRVIIRDV 499

Query: 774  GGKACWDASALYFDP 818
             GK  WD++ LY  P
Sbjct: 500  AGKHSWDSAVLYGPP 514


>UniRef50_Q2PPJ7 Cluster: 250 kDa substrate of Akt; n=36;
            Euteleostomi|Rep: 250 kDa substrate of Akt - Homo sapiens
            (Human)
          Length = 1873

 Score = 85.0 bits (201), Expect = 3e-15
 Identities = 91/325 (28%), Positives = 144/325 (44%), Gaps = 39/325 (12%)
 Frame = +3

Query: 6    TACPRLPSYVTCLLQMLMMKNKNIAKVVSDCILVLADYTDRIVEMYPGLAGKIIRWICAC 185
            T+ P++   +  +   L   NK +A+V  D + +L  Y +++      L  K+   + A 
Sbjct: 1177 TSHPQVKEAINVIGVTLKFPNKIVAQVACDVLQLLVSYWEKLQMFETSLPRKMAEILVAT 1236

Query: 186  LAQLSTSCHRDTV---KPLAGSLLLCLAEFAVRCGPQYLM---------EEKDGEQTLLL 329
            +A L  S    +V   K    SLLLCL ++ +      L+         E+      LL 
Sbjct: 1237 VAFLLPSAEYSSVETDKKFIVSLLLCLLDWCMALPVSVLLHPVSTAVLEEQHSARAPLLD 1296

Query: 330  LIFKVLYAVMKGANGSDIEG---LSLP--VDDDFDPTIQLDNLG---PKTIPAS------ 467
             I++VL+  + G++    +    L+L      D+DP + L N+    P    +S      
Sbjct: 1297 YIYRVLHCCVCGSSTYTQQSHYILTLADLSSTDYDPFLPLANVKSSEPVQYHSSAELGNL 1356

Query: 468  -TID----------VKLWAQTICTQLVLYLGHWPLWSG-CQLSCRVSEQHDSPSL-GEEL 608
             T++          + L A+ +   LV +LGH+PL  G   L   VSE HD+  + G EL
Sbjct: 1357 LTVEEEKKRRSLELIPLTARMVMAHLVNHLGHYPLSGGPAILHSLVSENHDNAHVEGSEL 1416

Query: 609  GPAVLTAPNIQLMRFSDSTLASLIELPALDLPARAGTTPGLTTSERQVRVLLRDIGGKAC 788
               V  +PN+QL  F+DSTL S ++ P        G +P  + S+  VRV++RDI GK  
Sbjct: 1417 SFEVFRSPNLQLFVFNDSTLISYLQTPT---EGPVGGSPVGSLSD--VRVIVRDISGKYS 1471

Query: 789  WDASALYFDPSGGQLEGGPGTQFAL 863
            WD   LY    G     G    F +
Sbjct: 1472 WDGKVLYGPLEGCLAPNGRNPSFLI 1496


>UniRef50_Q5U493 Cluster: LOC495705 protein; n=7; Eumetazoa|Rep:
            LOC495705 protein - Xenopus laevis (African clawed frog)
          Length = 896

 Score = 82.6 bits (195), Expect = 1e-14
 Identities = 82/308 (26%), Positives = 146/308 (47%), Gaps = 39/308 (12%)
 Frame = +3

Query: 3    RTACPRLPSYVTCLLQMLMMKNKNIAKVVSDCILVLADYTDRIVEMYPGLAGKIIRWICA 182
            +T  P++   +  +   L   NK +A+V    + VL +Y  ++   +     KII  + A
Sbjct: 172  QTNHPQIKEALNVICVSLKFPNKVVAQVACSVLNVLLNYVQQLQIYHSDYPLKIIEILLA 231

Query: 183  CLAQLSTSCHRDTV---KPLAGSLLLCLAEFAVRCGPQYLME-------EKDG-EQTLLL 329
             +  L  S    +    K L  SLLL L ++ +      L++       E DG E ++L 
Sbjct: 232  TVTYLLPSAETSSYEQDKRLVVSLLLSLLDWMMALPLPLLLKPLHHAESESDGRENSVLN 291

Query: 330  LIFKVLYAVMKGANG-SDIEGLSLPVDD----DFDPTIQLD-----------------NL 443
              +KVL+  + G+   S+ +   + + D    D+DP +QL+                  L
Sbjct: 292  CAYKVLHDCVYGSQHYSNPKYFPMSLSDLASEDYDPFMQLECLKEPEPLHSPDSERSTKL 351

Query: 444  GPKT---IPASTIDVKLWAQTICTQLVLYLGHWPLWSG--CQLSCRVSEQHDSPSL-GEE 605
             P T   IP     + + A+T+ T LV +LGH+P+ SG    L+ ++ E HD+P     +
Sbjct: 352  QPVTEVKIPKQQGLIPVAARTVITHLVNHLGHYPM-SGDPAMLTSQICENHDNPYCESSD 410

Query: 606  LGPAVLTAPNIQLMRFSDSTLASLIELPALDLPARAGTTPGLTTSERQVRVLLRDIGGKA 785
            L P +  +PN+Q    +++TL S +++ + +   +      L+++   VRV++RD+ GK 
Sbjct: 411  LSPQLFHSPNLQFFALNNTTLVSCLQIQSEE---KLPPGEDLSSARSTVRVIMRDLSGKY 467

Query: 786  CWDASALY 809
             WD+S LY
Sbjct: 468  SWDSSILY 475


>UniRef50_Q4RNY6 Cluster: Chromosome 10 SCAF15009, whole genome
            shotgun sequence; n=2; Tetraodontidae|Rep: Chromosome 10
            SCAF15009, whole genome shotgun sequence - Tetraodon
            nigroviridis (Green puffer)
          Length = 2142

 Score = 78.2 bits (184), Expect = 3e-13
 Identities = 46/113 (40%), Positives = 62/113 (54%), Gaps = 2/113 (1%)
 Frame = +3

Query: 477  VKLWAQTICTQLVLYLGHWPLWSG-CQLSCRVSEQHDSPSL-GEELGPAVLTAPNIQLMR 650
            + L A+ + T LV +LGH PL  G   L   +SE HD+P +   EL   V  +PN+QL  
Sbjct: 1496 IPLTARMVMTHLVNHLGHHPLRGGPALLHSLLSENHDNPYVESSELSSEVFKSPNLQLFV 1555

Query: 651  FSDSTLASLIELPALDLPARAGTTPGLTTSERQVRVLLRDIGGKACWDASALY 809
            F+DSTL S +++PA          P       QVRV++RDI GK  WD + LY
Sbjct: 1556 FNDSTLVSYLQIPAESHTVEQPPQPSY-----QVRVIVRDISGKYSWDGTILY 1603


>UniRef50_UPI0000E46FBC Cluster: PREDICTED: similar to akt substrate
            AS250; n=2; Strongylocentrotus purpuratus|Rep: PREDICTED:
            similar to akt substrate AS250 - Strongylocentrotus
            purpuratus
          Length = 1961

 Score = 69.7 bits (163), Expect = 1e-10
 Identities = 37/115 (32%), Positives = 66/115 (57%), Gaps = 2/115 (1%)
 Frame = +3

Query: 480  KLWAQTICTQLVLYLGHWPLWSG-CQLSCRVSEQHDSPSLG-EELGPAVLTAPNIQLMRF 653
            +L A+T+ TQL+  L H+PL  G   ++  V+E  D P+   +++ P +  A N+Q   +
Sbjct: 1352 RLTARTVLTQLIDKLNHFPLGGGPACVTSLVNEVDDLPNFDTDDITPRLFEAENVQFFIY 1411

Query: 654  SDSTLASLIELPALDLPARAGTTPGLTTSERQVRVLLRDIGGKACWDASALYFDP 818
            +D++L SL ++P LD     G+  GL+ +   +R ++R++ GK  WD   +Y  P
Sbjct: 1412 NDASLVSLTQIPPLD----DGSESGLSVATSDLRAVVRNVSGKFAWDGRIIYGPP 1462



 Score = 65.3 bits (152), Expect = 2e-09
 Identities = 45/153 (29%), Positives = 73/153 (47%), Gaps = 10/153 (6%)
 Frame = +3

Query: 15   PRLPSYVTCLLQMLMMKNKNIAKVVSDCILVLADYTDRIVEMYPGLAGKIIRWICACLAQ 194
            PR+   +  LL  L  +NK + +V  D +LV+ D+ +R+    P    KII  I   +A 
Sbjct: 1155 PRIKEAINVLLASLKFQNKLVGQVACDMLLVICDHAERLRRHLPEAPKKIIEVIAMTIAS 1214

Query: 195  LSTS---CHRDTVKPLAGSLLLCLAEFAVRCGPQYLME-----EKDGEQTLLLLIFKVLY 350
            L +S     ++  K L  SL+ CL+E+ +      L+E      K   + LL  +FKVL 
Sbjct: 1215 LLSSTEMTEQEEDKKLIVSLMFCLSEWCISIPLSSLLEGTESKSKKEAKPLLHTVFKVLQ 1274

Query: 351  AVMKGANGSDIEGLSLP--VDDDFDPTIQLDNL 443
              ++G     +  ++       D+DP I LD+L
Sbjct: 1275 TAVEGVAAESLYTINFSELASPDYDPHINLDSL 1307


>UniRef50_A7SSP3 Cluster: Predicted protein; n=1; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 1054

 Score = 69.7 bits (163), Expect = 1e-10
 Identities = 38/102 (37%), Positives = 59/102 (57%), Gaps = 2/102 (1%)
 Frame = +3

Query: 510 LVLYLGHWPLWSG-CQLSCRVSEQHDSPSLG-EELGPAVLTAPNIQLMRFSDSTLASLIE 683
           +V +LGH+PL +G  +L   +SE  D  S   +E+ P +  +PNIQ    +DS L S +E
Sbjct: 444 IVNHLGHFPLGAGPSRLDSLISEHEDHLSTDCDEMQPTIFNSPNIQFFVLNDSVLVSAVE 503

Query: 684 LPALDLPARAGTTPGLTTSERQVRVLLRDIGGKACWDASALY 809
           LP  D P        +TT++ QVR++ RD+ G+  WD + +Y
Sbjct: 504 LPKED-PKCHPLLQDMTTAKTQVRLITRDMTGRFSWDHTMMY 544



 Score = 35.9 bits (79), Expect = 1.5
 Identities = 27/115 (23%), Positives = 53/115 (46%), Gaps = 4/115 (3%)
 Frame = +3

Query: 15  PRLPSYVTCLLQMLMMKNKNIAKVVSDCILVLADYTDRIVEMYPGLAGKIIRWICACLAQ 194
           PR+   +  LLQ     +K ++ +  D + +L+ YT  +      L  K++  +C  +  
Sbjct: 246 PRVHDCICVLLQSTTFHHKTVSTLAIDLLHMLSQYTQELCAFDSELPIKVVEVMCHTVTS 305

Query: 195 LSTSCHRDTVK---PLAGSLLLCLAEFAVRCGPQYLMEEKDGE-QTLLLLIFKVL 347
           L       +V+    +  S++LCL ++ +      LM  K  E ++ L  +F+VL
Sbjct: 306 LLPGGEFASVQEENSILVSVILCLLDWVMVIPSAKLMARKGEENRSTLSRVFQVL 360


>UniRef50_UPI0000498F17 Cluster: beta-galactosidase; n=3;
           Eukaryota|Rep: beta-galactosidase - Entamoeba
           histolytica HM-1:IMSS
          Length = 86

 Score = 54.0 bits (124), Expect = 5e-06
 Identities = 23/24 (95%), Positives = 23/24 (95%)
 Frame = +2

Query: 884 HWPSFYNVVTWKTLALPNLIALQH 955
           HWPSFYNVVT KTLALPNLIALQH
Sbjct: 5   HWPSFYNVVTGKTLALPNLIALQH 28


>UniRef50_Q8GEG0 Cluster: Putative uncharacterized protein; n=1;
           Erwinia amylovora|Rep: Putative uncharacterized protein
           - Erwinia amylovora (Fire blight bacteria)
          Length = 123

 Score = 46.0 bits (104), Expect = 0.001
 Identities = 22/23 (95%), Positives = 22/23 (95%)
 Frame = +1

Query: 886 LAVVLQRRDLENPGVTQLNRLAA 954
           LAVVLQRRD ENPGVTQLNRLAA
Sbjct: 68  LAVVLQRRDWENPGVTQLNRLAA 90


>UniRef50_Q47336 Cluster: LacZ-alpha peptide; n=2; cellular
           organisms|Rep: LacZ-alpha peptide - Escherichia coli
          Length = 90

 Score = 46.0 bits (104), Expect = 0.001
 Identities = 22/23 (95%), Positives = 22/23 (95%)
 Frame = +1

Query: 886 LAVVLQRRDLENPGVTQLNRLAA 954
           LAVVLQRRD ENPGVTQLNRLAA
Sbjct: 22  LAVVLQRRDWENPGVTQLNRLAA 44


>UniRef50_Q37953 Cluster: LacZ protein; n=1; Phage M13mp18|Rep: LacZ
           protein - Phage M13mp18
          Length = 102

 Score = 46.0 bits (104), Expect = 0.001
 Identities = 22/23 (95%), Positives = 22/23 (95%)
 Frame = +1

Query: 886 LAVVLQRRDLENPGVTQLNRLAA 954
           LAVVLQRRD ENPGVTQLNRLAA
Sbjct: 26  LAVVLQRRDWENPGVTQLNRLAA 48


>UniRef50_P00722 Cluster: Beta-galactosidase; n=35; root|Rep:
           Beta-galactosidase - Escherichia coli (strain K12)
          Length = 1024

 Score = 46.0 bits (104), Expect = 0.001
 Identities = 22/23 (95%), Positives = 22/23 (95%)
 Frame = +1

Query: 886 LAVVLQRRDLENPGVTQLNRLAA 954
           LAVVLQRRD ENPGVTQLNRLAA
Sbjct: 8   LAVVLQRRDWENPGVTQLNRLAA 30


>UniRef50_Q01SN5 Cluster: Putative uncharacterized protein
           precursor; n=1; Solibacter usitatus Ellin6076|Rep:
           Putative uncharacterized protein precursor - Solibacter
           usitatus (strain Ellin6076)
          Length = 560

 Score = 35.1 bits (77), Expect = 2.7
 Identities = 24/74 (32%), Positives = 36/74 (48%), Gaps = 3/74 (4%)
 Frame = +3

Query: 507 QLVLYLGHWPLWSGCQLSCRVSEQHDSPSLGEELGPAVLTAPNIQLM---RFSDSTLASL 677
           +L+LY G   L  GC  SC +SEQH +  L    G + +  PN ++    R+  S  +  
Sbjct: 96  RLLLYTG--TLNCGCCSSCFLSEQHSTTLLDTTTGQSAVAGPNARMSRNGRYLASYSSRN 153

Query: 678 IELPALDLPARAGT 719
           +  P  DL  RA +
Sbjct: 154 VTRPVFDLLDRASS 167


>UniRef50_Q0C8S9 Cluster: Predicted protein; n=1; Aspergillus
           terreus NIH2624|Rep: Predicted protein - Aspergillus
           terreus (strain NIH 2624)
          Length = 295

 Score = 35.1 bits (77), Expect = 2.7
 Identities = 17/46 (36%), Positives = 25/46 (54%)
 Frame = +3

Query: 669 ASLIELPALDLPARAGTTPGLTTSERQVRVLLRDIGGKACWDASAL 806
           AS +   A+ L  +AG TP LTT+  +    LR +G   C+D + L
Sbjct: 100 ASAVGTAAIQLAVKAGCTPILTTASSRNNAALRQLGATECFDYADL 145


>UniRef50_Q4FX62 Cluster: Proteophosphoglycan 5; n=5; Eukaryota|Rep:
            Proteophosphoglycan 5 - Leishmania major strain Friedlin
          Length = 17392

 Score = 34.7 bits (76), Expect = 3.5
 Identities = 45/167 (26%), Positives = 64/167 (38%)
 Frame = -2

Query: 715  PALAGRSRAGSSMSEARVESLNRISCMLGAVSTAGPSSSPRDGLSCCSETRQDSWHPLHR 536
            P+ +  S   SS S     S +  S    +  +A  SS+P    S        S  P   
Sbjct: 6964 PSASSSSAPSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSSAPSASSSS-APSSS 7022

Query: 535  GQCPRYSTS*VHIV*AQSLTSIVDAGIVLGPRLSSCIVGSKSSSTGRLRPSMSDPFAPFI 356
               P  S+S      + S +S   A     P  SS    S SSS+     S S P A   
Sbjct: 7023 SSAPSASSSSAP---SSSSSSAPSASSSSAPSSSSSSAPSASSSSAP-SSSSSAPSASSS 7078

Query: 355  TAYNTLKINSKSVCSPSFSSIKY*GPQRTANSAKHSSSDPASGLTVS 215
            +A ++   ++ S CS S  S     P  +++SA  SSS  A   + S
Sbjct: 7079 SAPSSSS-SAPSACSSSAPSSSSSAPSASSSSAPSSSSSSAPSASSS 7124


>UniRef50_Q2GU14 Cluster: Putative uncharacterized protein; n=1;
            Chaetomium globosum|Rep: Putative uncharacterized protein
            - Chaetomium globosum (Soil fungus)
          Length = 7461

 Score = 34.3 bits (75), Expect = 4.7
 Identities = 37/128 (28%), Positives = 59/128 (46%), Gaps = 1/128 (0%)
 Frame = -2

Query: 472  IVDAGIVLGPRLSSCIVGSKSSSTGRLRPSMSDPFAPFITAYNTLKINSKSVCSPSFSSI 293
            +V + +V  PR+   +   + ++ G   PS     AP+ TAY     NS    S S +S 
Sbjct: 7301 MVSSPLVASPRIMGTLPPRRKNTMGFAPPSRRTT-APYPTAYTPTTANSNYSLSSSTASS 7359

Query: 292  KY*GPQRTANSAKHSSSDPASGLTVSRWQLVESWAKHAQIHLIIF-PASPGYISTIRSV* 116
               GP    ++ KH+   P +G  V    + ++WA   + +  I  P +PG  S+  SV 
Sbjct: 7360 TAGGP---VSTQKHAQG-PGAGQGV----MGQTWADRNKSYASISPPPTPG--SSAGSVG 7409

Query: 115  SASTNMQS 92
            SAS+   S
Sbjct: 7410 SASSPRSS 7417


>UniRef50_Q7MSK3 Cluster: Putative uncharacterized protein; n=1;
           Wolinella succinogenes|Rep: Putative uncharacterized
           protein - Wolinella succinogenes
          Length = 239

 Score = 33.9 bits (74), Expect = 6.2
 Identities = 22/65 (33%), Positives = 30/65 (46%)
 Frame = +3

Query: 513 VLYLGHWPLWSGCQLSCRVSEQHDSPSLGEELGPAVLTAPNIQLMRFSDSTLASLIELPA 692
           VL  G   L    +L  R+    +  SLG  L    + AP+  + RFS S  A  IE+  
Sbjct: 15  VLLAGETSLLQVVKLEARLESGENQKSLGVWLKGGYILAPSAAVHRFSPSVYAERIEVMI 74

Query: 693 LDLPA 707
           +D PA
Sbjct: 75  VDDPA 79


>UniRef50_Q6C1J0 Cluster: Yarrowia lipolytica chromosome F of strain
           CLIB122 of Yarrowia lipolytica; n=1; Yarrowia
           lipolytica|Rep: Yarrowia lipolytica chromosome F of
           strain CLIB122 of Yarrowia lipolytica - Yarrowia
           lipolytica (Candida lipolytica)
          Length = 519

 Score = 33.9 bits (74), Expect = 6.2
 Identities = 21/71 (29%), Positives = 32/71 (45%), Gaps = 1/71 (1%)
 Frame = +1

Query: 376 PTLKA*VCRWMTTSTQLYSWIISGLKRFRHQRSTSSFGL-KRYALSWYCTSGTGLYGADA 552
           PT  + +C   + STQLY+ I+      +   +   F L K+    W   SG      D+
Sbjct: 272 PTSISIICSMYSWSTQLYAPIVPSESSVQIYGTKVDFTLMKKTPAKWPTVSGNASLNDDS 331

Query: 553 NCPVVFPSNTT 585
             P+  PS+TT
Sbjct: 332 ETPIKSPSSTT 342


>UniRef50_UPI0000F1F42D Cluster: PREDICTED: similar to
            proteophosphoglycan 5; n=1; Danio rerio|Rep: PREDICTED:
            similar to proteophosphoglycan 5 - Danio rerio
          Length = 1389

 Score = 33.5 bits (73), Expect = 8.2
 Identities = 21/71 (29%), Positives = 31/71 (43%)
 Frame = -2

Query: 448  GPRLSSCIVGSKSSSTGRLRPSMSDPFAPFITAYNTLKINSKSVCSPSFSSIKY*GPQRT 269
            GP LS  I    + ++ +     SDP     T   + + N + VC PS SS+   G  + 
Sbjct: 788  GPSLSQPIGPQSAQASYQCACQPSDPSVSQPTGQQSAQTNYQCVCQPSSSSVSQPGILQP 847

Query: 268  ANSAKHSSSDP 236
            A +   S S P
Sbjct: 848  AQALNQSPSQP 858


>UniRef50_Q5QLZ3 Cluster: Gastric mucin-like protein; n=4; Oryza
           sativa|Rep: Gastric mucin-like protein - Oryza sativa
           subsp. japonica (Rice)
          Length = 579

 Score = 33.5 bits (73), Expect = 8.2
 Identities = 21/41 (51%), Positives = 24/41 (58%)
 Frame = -3

Query: 354 PRTTP*KSTAKVFVLHPSLPLSTEVRNVPQTRPSTAAVTRP 232
           P TTP K T+ +    PS+P S   R VP TRPST   TRP
Sbjct: 108 PPTTPSKRTSTLSSSKPSVPAS---RQVP-TRPSTPTKTRP 144


>UniRef50_Q01LA1 Cluster: OSIGBa0113L04.7 protein; n=5; Oryza
           sativa|Rep: OSIGBa0113L04.7 protein - Oryza sativa
           (Rice)
          Length = 258

 Score = 33.5 bits (73), Expect = 8.2
 Identities = 14/34 (41%), Positives = 16/34 (47%)
 Frame = +1

Query: 613 PPC*PRPTYS*CGSAIRLWPRSLSCRPSTCPPEP 714
           PPC     +  CG  IR WP  +   P  CPP P
Sbjct: 211 PPCGCSGGHGNCGCGIRPWPPQVWPPPPVCPPPP 244


>UniRef50_A4S341 Cluster: Predicted protein; n=1; Ostreococcus
           lucimarinus CCE9901|Rep: Predicted protein -
           Ostreococcus lucimarinus CCE9901
          Length = 316

 Score = 33.5 bits (73), Expect = 8.2
 Identities = 18/48 (37%), Positives = 25/48 (52%)
 Frame = -2

Query: 724 GVVPALAGRSRAGSSMSEARVESLNRISCMLGAVSTAGPSSSPRDGLS 581
           G  PA A  S + SS S ARV +L R + ++ AVS   P  +  D  +
Sbjct: 10  GPTPARASTSTSTSSSSRARVVALTRRAALVAAVSLVAPGRARADAFA 57


>UniRef50_Q2H1R2 Cluster: Predicted protein; n=1; Chaetomium
           globosum|Rep: Predicted protein - Chaetomium globosum
           (Soil fungus)
          Length = 194

 Score = 33.5 bits (73), Expect = 8.2
 Identities = 18/41 (43%), Positives = 20/41 (48%)
 Frame = +1

Query: 592 PWARSWAPPC*PRPTYS*CGSAIRLWPRSLSCRPSTCPPEP 714
           PW    APP  PRPT S  G     WP S +  P+  PP P
Sbjct: 52  PWPSGSAPPFPPRPTGS--GLPFPPWPPSGTGGPAPWPPRP 90


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 964,432,326
Number of Sequences: 1657284
Number of extensions: 20462477
Number of successful extensions: 61563
Number of sequences better than 10.0: 28
Number of HSP's better than 10.0 without gapping: 57863
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 61452
length of database: 575,637,011
effective HSP length: 101
effective length of database: 408,251,327
effective search space used: 88590537959
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).