SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= cesb0026
         (744 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_P48610 Cluster: Arginine kinase; n=363; Eukaryota|Rep: ...   340   3e-92
UniRef50_A6QBA0 Cluster: Arginine kinase; n=12; cellular organis...   256   3e-67
UniRef50_O15992 Cluster: Arginine kinase; n=51; cellular organis...   237   2e-61
UniRef50_Q7PYN5 Cluster: ENSANGP00000011312; n=1; Anopheles gamb...   221   1e-56
UniRef50_P51544 Cluster: Arginine kinase; n=35; Eukaryota|Rep: A...   210   2e-53
UniRef50_P16641 Cluster: ATP:guanidino kinase SMC74; n=4; Schist...   210   3e-53
UniRef50_Q9VF23 Cluster: CG4546-PA; n=2; Sophophora|Rep: CG4546-...   191   1e-47
UniRef50_Q4AED1 Cluster: Arginine kinase 2; n=2; Sabellastarte i...   171   2e-41
UniRef50_P06732 Cluster: Creatine kinase M-type; n=176; root|Rep...   171   2e-41
UniRef50_Q1DA50 Cluster: Putative arginine kinase; n=1; Myxococc...   165   1e-39
UniRef50_P12532 Cluster: Creatine kinase, ubiquitous mitochondri...   163   5e-39
UniRef50_P17540 Cluster: Creatine kinase, sarcomeric mitochondri...   158   1e-37
UniRef50_Q6APG0 Cluster: Related to arginine kinase; n=1; Desulf...   154   2e-36
UniRef50_UPI00005A2F57 Cluster: PREDICTED: similar to creatine k...   147   3e-34
UniRef50_A7RER2 Cluster: Predicted protein; n=2; Nematostella ve...   146   4e-34
UniRef50_A6XH17 Cluster: Arginine kinase; n=2; Suberites|Rep: Ar...   142   1e-32
UniRef50_A6XH11 Cluster: Arginine kinase; n=1; Aphrocallistes be...   123   4e-27
UniRef50_A0CMM0 Cluster: Chromosome undetermined scaffold_21, wh...   112   1e-23
UniRef50_UPI00005A5D28 Cluster: PREDICTED: similar to Creatine k...   107   4e-22
UniRef50_A6TWL7 Cluster: ATP:guanido phosphotransferase; n=2; Cl...    99   1e-19
UniRef50_UPI00005A0AB9 Cluster: PREDICTED: similar to Creatine k...    96   7e-19
UniRef50_A0UZ11 Cluster: ATP:guanido phosphotransferase; n=2; Cl...    93   7e-18
UniRef50_A7CUC7 Cluster: ATP:guanido phosphotransferase; n=1; Op...    91   3e-17
UniRef50_P37570 Cluster: Putative ATP:guanido phosphotransferase...    91   3e-17
UniRef50_Q81VW0 Cluster: Putative ATP:guanido phosphotransferase...    90   5e-17
UniRef50_Q49V33 Cluster: Putative ATP:guanido phosphotransferase...    89   8e-17
UniRef50_A7GJA5 Cluster: ATP:guanido phosphotransferase domain p...    87   6e-16
UniRef50_Q18V69 Cluster: ATP:guanido phosphotransferase; n=2; De...    86   8e-16
UniRef50_Q0AUE7 Cluster: ATP:guanido phosphotransferase; n=1; Sy...    86   1e-15
UniRef50_A6C8T0 Cluster: ATP:guanido phosphotransferase; n=4; Pl...    86   1e-15
UniRef50_Q67JN4 Cluster: Putative ATP:guanido phosphotransferase...    85   1e-15
UniRef50_Q8R7S0 Cluster: Putative ATP:guanido phosphotransferase...    85   1e-15
UniRef50_Q890L4 Cluster: Putative ATP:guanido phosphotransferase...    85   2e-15
UniRef50_Q18CB0 Cluster: Putative ATP:guanido phosphotransferase...    84   4e-15
UniRef50_A1HTJ5 Cluster: ATP:guanido phosphotransferase; n=1; Th...    83   7e-15
UniRef50_Q41AF9 Cluster: ATP:guanido phosphotransferase; n=1; Ex...    77   3e-13
UniRef50_P91251 Cluster: Putative uncharacterized protein; n=1; ...    75   1e-12
UniRef50_UPI00015A66B5 Cluster: UPI00015A66B5 related cluster; n...    72   1e-11
UniRef50_A6LPN2 Cluster: ATP:guanido phosphotransferase; n=1; Cl...    72   1e-11
UniRef50_A6PV57 Cluster: ATP:guanido phosphotransferase; n=1; Vi...    71   4e-11
UniRef50_A7RG45 Cluster: Predicted protein; n=1; Nematostella ve...    68   2e-10
UniRef50_Q8XHP0 Cluster: Putative ATP:guanido phosphotransferase...    65   2e-09
UniRef50_Q1FFB3 Cluster: ATP:guanido phosphotransferase; n=1; Cl...    64   3e-09
UniRef50_UPI0000DB7740 Cluster: PREDICTED: similar to CG30274-PA...    63   8e-09
UniRef50_Q8MMD7 Cluster: CG30274-PA; n=4; Diptera|Rep: CG30274-P...    61   2e-08
UniRef50_A7S2W4 Cluster: Predicted protein; n=1; Nematostella ve...    53   6e-06
UniRef50_Q73L28 Cluster: ATP:guanido phosphotransferase domain p...    50   5e-05
UniRef50_Q6MA01 Cluster: Putative arginine kinase; n=1; Candidat...    50   8e-05
UniRef50_Q9Z7K4 Cluster: Putative ATP:guanido phosphotransferase...    48   3e-04
UniRef50_UPI0000F21069 Cluster: PREDICTED: similar to creatine k...    43   0.009
UniRef50_UPI00006CC371 Cluster: ATP:guanido phosphotransferase, ...    42   0.016
UniRef50_UPI00005A299A Cluster: PREDICTED: similar to low-densit...    41   0.037
UniRef50_A0DFG3 Cluster: Chromosome undetermined scaffold_49, wh...    38   0.34 
UniRef50_Q9D1Z4 Cluster: Adult retina cDNA, RIKEN full-length en...    37   0.46 
UniRef50_Q8F905 Cluster: Putative uncharacterized protein; n=4; ...    36   1.1  
UniRef50_UPI0000EBCDFC Cluster: PREDICTED: hypothetical protein;...    35   2.4  
UniRef50_Q99IE7 Cluster: Non-structural polyprotein p200 (p200) ...    34   3.2  
UniRef50_P26460 Cluster: Creatine kinase B-type; n=1; Squalus ac...    34   3.2  
UniRef50_A0C4M0 Cluster: Chromosome undetermined scaffold_15, wh...    33   5.6  
UniRef50_Q4TDL5 Cluster: Chromosome undetermined SCAF6178, whole...    33   7.4  

>UniRef50_P48610 Cluster: Arginine kinase; n=363; Eukaryota|Rep:
           Arginine kinase - Drosophila melanogaster (Fruit fly)
          Length = 356

 Score =  340 bits (835), Expect = 3e-92
 Identities = 156/188 (82%), Positives = 169/188 (89%)
 Frame = -3

Query: 742 PLTGMSKETQQQLIDDHFLFKEGDRFMQAANACRFWPTGRGIYHNENKTFLVWCNEEDHL 563
           PLTGM K  QQQLIDDHFLFKEGDRF+QAANACRFWP+GRGIYHN+ KTFLVWCNEEDHL
Sbjct: 169 PLTGMEKAVQQQLIDDHFLFKEGDRFLQAANACRFWPSGRGIYHNDAKTFLVWCNEEDHL 228

Query: 562 RIISMQMGGDLQQVYKRLVSAVNEIEKKIPFSHHDRLGFLTFCPTNLGTTVRASVHIXXX 383
           RIISMQ GGDL Q+YKRLV+AVNEIEK++PFSH DRLGFLTFCPTNLGTT+RASVHI   
Sbjct: 229 RIISMQQGGDLGQIYKRLVTAVNEIEKRVPFSHDDRLGFLTFCPTNLGTTIRASVHIKVP 288

Query: 382 XXXXXXXXLEEVASKYHLQVRGTRGEHTEAEGGVYDISNKRRMGLTEYDAVKEMYDGIAE 203
                   LEEVA+KY+LQVRGTRGEHTEAEGGVYDISNKRRMGLTE++AVKEMYDGI E
Sbjct: 289 KLASNKAKLEEVAAKYNLQVRGTRGEHTEAEGGVYDISNKRRMGLTEFEAVKEMYDGITE 348

Query: 202 LIKIEKSL 179
           LIK+EKSL
Sbjct: 349 LIKLEKSL 356


>UniRef50_A6QBA0 Cluster: Arginine kinase; n=12; cellular
           organisms|Rep: Arginine kinase - Sulfurovum sp. (strain
           NBC37-1)
          Length = 343

 Score =  256 bits (628), Expect = 3e-67
 Identities = 118/188 (62%), Positives = 140/188 (74%)
 Frame = -3

Query: 742 PLTGMSKETQQQLIDDHFLFKEGDRFMQAANACRFWPTGRGIYHNENKTFLVWCNEEDHL 563
           PL GMSKE Q  LI DHFLFKEGDRF+ AA   + WP GRGIYHN +KTFLVW NEED L
Sbjct: 155 PLLGMSKEVQDALIQDHFLFKEGDRFLDAAGLNQDWPEGRGIYHNNDKTFLVWVNEEDQL 214

Query: 562 RIISMQMGGDLQQVYKRLVSAVNEIEKKIPFSHHDRLGFLTFCPTNLGTTVRASVHIXXX 383
           RIISMQ GGD++ V+ RLV+AV  IE KIPFS+   LGF+T CPTNLGT +RASVHI   
Sbjct: 215 RIISMQKGGDIKAVFTRLVNAVKSIETKIPFSYSYHLGFITSCPTNLGTAMRASVHIALP 274

Query: 382 XXXXXXXXLEEVASKYHLQVRGTRGEHTEAEGGVYDISNKRRMGLTEYDAVKEMYDGIAE 203
                    + +  KYHLQ+RG  GEH+E+EGGVYDISN+RR+G+TE  AV++MYDG+  
Sbjct: 275 KLSQDMEAFKAITDKYHLQIRGIHGEHSESEGGVYDISNRRRLGITEVQAVQDMYDGVVA 334

Query: 202 LIKIEKSL 179
           LI  EK+L
Sbjct: 335 LIVAEKAL 342


>UniRef50_O15992 Cluster: Arginine kinase; n=51; cellular
           organisms|Rep: Arginine kinase - Anthopleura japonicus
           (Sea anemone)
          Length = 715

 Score =  237 bits (581), Expect = 2e-61
 Identities = 109/197 (55%), Positives = 144/197 (73%), Gaps = 3/197 (1%)
 Frame = -3

Query: 742 PLTGMSKETQQQLIDDHFLFKEGDRFMQAANACRFWPTGRGIYHNENKTFLVWCNEEDHL 563
           PL+GM ++T+QQL+DDHFLFK+GDRF++AA   + WP GRGIYHN +KTFLVW NEEDHL
Sbjct: 173 PLSGMDEKTRQQLVDDHFLFKKGDRFLEAAGINKEWPEGRGIYHNNDKTFLVWLNEEDHL 232

Query: 562 RIISMQMGGDLQQVYKRLVSAVNEIEKKIPFSHHDRLGFLTFCPTNLGTTVRASVHIXXX 383
           RIISM+ G D+  V+ RL  AVNEI+KK+ F H  + G+LT CP+NLGT +RASVH+   
Sbjct: 233 RIISMEKGSDIGSVFSRLCRAVNEIDKKLGFQHTKKHGYLTSCPSNLGTGMRASVHV-KI 291

Query: 382 XXXXXXXXLEEVASKYHLQVRGTRGEHTEAEG---GVYDISNKRRMGLTEYDAVKEMYDG 212
                    E + +KYH+Q RG  GEH+E+ G   GVYDISN+RR+GL+E   V++MYDG
Sbjct: 292 PHAKEHPDFENILTKYHIQARGIHGEHSESTGEDAGVYDISNRRRLGLSEVQCVQDMYDG 351

Query: 211 IAELIKIEKSL*APPRA 161
           +  L+++EK   A  R+
Sbjct: 352 VKALMELEKEAIAKKRS 368



 Score =  222 bits (543), Expect = 6e-57
 Identities = 100/190 (52%), Positives = 140/190 (73%), Gaps = 3/190 (1%)
 Frame = -3

Query: 742  PLTGMSKETQQQLIDDHFLFKEGDRFMQAANACRFWPTGRGIYHNENKTFLVWCNEEDHL 563
            PLTGM + T+Q+L++DHFLFK+GDRF++AA   + WP GRGI+HN +KTFLVW NEED L
Sbjct: 525  PLTGMDEATRQKLVNDHFLFKKGDRFLEAAGVNKLWPEGRGIFHNNDKTFLVWINEEDQL 584

Query: 562  RIISMQMGGDLQQVYKRLVSAVNEIEKKIPFSHHDRLGFLTFCPTNLGTTVRASVHIXXX 383
            RIISM+ G D+  V+ RL  AVNEI+K++ F H D  G+L+ CPTNLGT +RASVH+   
Sbjct: 585  RIISMEKGSDIGSVFGRLCRAVNEIDKQLGFQHTDAHGYLSGCPTNLGTGMRASVHV-KI 643

Query: 382  XXXXXXXXLEEVASKYHLQVRGTRGEHTEAEG---GVYDISNKRRMGLTEYDAVKEMYDG 212
                     +++  ++H+Q RG  GEH+ + G   GV+DISN+RR+GL+E   V++MY+G
Sbjct: 644  PKASAHPDFQKICDEFHIQARGIHGEHSVSTGEDAGVFDISNRRRLGLSEVQCVQDMYNG 703

Query: 211  IAELIKIEKS 182
            + +L++IEKS
Sbjct: 704  VKKLLEIEKS 713


>UniRef50_Q7PYN5 Cluster: ENSANGP00000011312; n=1; Anopheles gambiae
           str. PEST|Rep: ENSANGP00000011312 - Anopheles gambiae
           str. PEST
          Length = 450

 Score =  221 bits (540), Expect = 1e-56
 Identities = 100/187 (53%), Positives = 134/187 (71%)
 Frame = -3

Query: 739 LTGMSKETQQQLIDDHFLFKEGDRFMQAANACRFWPTGRGIYHNENKTFLVWCNEEDHLR 560
           L  +    +++L + H+LFKE DRF+  A A RF+P GR I+ NE+KTF++W NEEDHLR
Sbjct: 258 LAALDAGQKEELTEGHYLFKECDRFLDEAQANRFFPAGRAIFLNESKTFVLWVNEEDHLR 317

Query: 559 IISMQMGGDLQQVYKRLVSAVNEIEKKIPFSHHDRLGFLTFCPTNLGTTVRASVHIXXXX 380
           IISMQ G D+ + Y+R ++A+  + +KIPF   +RLGFLTFCPTNLGT +RASVHI    
Sbjct: 318 IISMQEGADVGKFYQRFITALETLGQKIPFQRDERLGFLTFCPTNLGTAIRASVHIRLPK 377

Query: 379 XXXXXXXLEEVASKYHLQVRGTRGEHTEAEGGVYDISNKRRMGLTEYDAVKEMYDGIAEL 200
                  +EE A+ + LQ+RG  GEHT+   GV D+SNKRR+GLTE++AVKEM DG+  L
Sbjct: 378 LSADKARMEEAAATHKLQIRGVHGEHTDTGDGVLDVSNKRRLGLTEFEAVKEMVDGVKAL 437

Query: 199 IKIEKSL 179
           I++EK L
Sbjct: 438 IELEKEL 444


>UniRef50_P51544 Cluster: Arginine kinase; n=35; Eukaryota|Rep:
           Arginine kinase - Nordotis madaka (Giant abalone)
          Length = 358

 Score =  210 bits (514), Expect = 2e-53
 Identities = 102/189 (53%), Positives = 128/189 (67%), Gaps = 1/189 (0%)
 Frame = -3

Query: 742 PLTGMSKETQQQLIDDHFLFKEGDRFMQAANACRFWPTGRGIYHNENKTFLVWCNEEDHL 563
           PL GMSKE Q+Q+ +DHFLFK+ DRF++ A     W +GRGI+ N  K FLVW NEEDHL
Sbjct: 166 PLEGMSKEDQKQMTEDHFLFKDDDRFLRDAGGYNDWCSGRGIFFNTAKNFLVWVNEEDHL 225

Query: 562 RIISMQMGGDLQQVYKRLVSAVNEIEKK-IPFSHHDRLGFLTFCPTNLGTTVRASVHIXX 386
           R+ISMQ GGDL  VYKRLV A+N +    + F+  D LG+LTFCP+NLGT +RASVH+  
Sbjct: 226 RLISMQKGGDLAAVYKRLVVAINTMTASGLSFAKRDGLGYLTFCPSNLGTALRASVHM-K 284

Query: 385 XXXXXXXXXLEEVASKYHLQVRGTRGEHTEAEGGVYDISNKRRMGLTEYDAVKEMYDGIA 206
                     +      ++Q RG  GEHTE+ GGVYD+SNKRR+GLTEY AV+EM  G+ 
Sbjct: 285 IPNLAASPEFKSFCDNLNIQARGIHGEHTESVGGVYDLSNKRRLGLTEYQAVEEMRVGVE 344

Query: 205 ELIKIEKSL 179
             +  EK L
Sbjct: 345 ACLAKEKEL 353


>UniRef50_P16641 Cluster: ATP:guanidino kinase SMC74; n=4;
           Schistosoma|Rep: ATP:guanidino kinase SMC74 -
           Schistosoma mansoni (Blood fluke)
          Length = 675

 Score =  210 bits (513), Expect = 3e-53
 Identities = 98/188 (52%), Positives = 127/188 (67%)
 Frame = -3

Query: 742 PLTGMSKETQQQLIDDHFLFKEGDRFMQAANACRFWPTGRGIYHNENKTFLVWCNEEDHL 563
           PLTG  +   Q     HFLF+  D  ++ A     WPTGRGI+ N+ K FLVW NEEDH+
Sbjct: 166 PLTGCQRGQNQTSKRHHFLFRNDDNVLRDAGGYIDWPTGRGIFINKQKKFLVWINEEDHI 225

Query: 562 RIISMQMGGDLQQVYKRLVSAVNEIEKKIPFSHHDRLGFLTFCPTNLGTTVRASVHIXXX 383
           R+ISMQ G DL  VYKRL  A+ E+ K + F+ +DRLGF+TFCP+NLGTT+RASVH    
Sbjct: 226 RVISMQKGRDLIAVYKRLADAIQELSKSLKFAFNDRLGFITFCPSNLGTTLRASVH-AKI 284

Query: 382 XXXXXXXXLEEVASKYHLQVRGTRGEHTEAEGGVYDISNKRRMGLTEYDAVKEMYDGIAE 203
                    +E+  K+ +Q RGT GEHTE+ GG+YD+SNKRR+GLTE DAV EM+ G+  
Sbjct: 285 PMLASLPNFKEICEKHGIQPRGTHGEHTESVGGIYDLSNKRRLGLTELDAVTEMHSGVRA 344

Query: 202 LIKIEKSL 179
           L+++E  L
Sbjct: 345 LLELEVML 352



 Score =  155 bits (375), Expect = 1e-36
 Identities = 67/117 (57%), Positives = 88/117 (75%)
 Frame = -3

Query: 742 PLTGMSKETQQQLIDDHFLFKEGDRFMQAANACRFWPTGRGIYHNENKTFLVWCNEEDHL 563
           PLT M +E ++QL++DHFLFK  D  ++ A   R WP GRGI+HN +KTFLVW  EEDH+
Sbjct: 529 PLTDMKEEDRKQLVEDHFLFKNDDPVLRDAGGYRDWPVGRGIFHNNSKTFLVWVCEEDHM 588

Query: 562 RIISMQMGGDLQQVYKRLVSAVNEIEKKIPFSHHDRLGFLTFCPTNLGTTVRASVHI 392
           RIISMQ GG+L  VYKRL+  +N I K + F+H D+ G++T CP+NLGT++RASV I
Sbjct: 589 RIISMQQGGNLAAVYKRLIEGINAIGKSMKFAHSDKYGYITCCPSNLGTSMRASVII 645


>UniRef50_Q9VF23 Cluster: CG4546-PA; n=2; Sophophora|Rep: CG4546-PA
           - Drosophila melanogaster (Fruit fly)
          Length = 457

 Score =  191 bits (466), Expect = 1e-47
 Identities = 91/188 (48%), Positives = 120/188 (63%), Gaps = 1/188 (0%)
 Frame = -3

Query: 739 LTGMSKETQQQLIDDHFLFKEGDRFMQAANACRFWPTGRGIYHNENKTFLVWCNEEDHLR 560
           +  +  ETQ +++  H LF+ GD  +  A   RFWPTGRG+YHN  +TFL+W N +DH+ 
Sbjct: 263 MADIDAETQAEMVKRHILFQRGDEKLTTAGCYRFWPTGRGVYHNPAETFLIWVNRQDHVH 322

Query: 559 IISMQMGGDLQQVYKRLVSAVNEIEKKIPFSHHDRLGFLTFCPTNLGTTVRASVHIXXXX 380
           I+SM   GDL  VY RLV+ + E+EK + F+ H R G LT CPTNLGTT+RASVHI    
Sbjct: 323 IMSMAQCGDLGDVYNRLVNGLTELEKTLAFARHPRYGNLTACPTNLGTTLRASVHIRLPL 382

Query: 379 XXXXXXXLEEVASKYHLQVRGT-RGEHTEAEGGVYDISNKRRMGLTEYDAVKEMYDGIAE 203
                  L  +A +  LQVRGT  GE +  E GV DISNKR++G TE++ VK + DG+  
Sbjct: 383 LSKDPDRLLALAEEQQLQVRGTDGGELSTVEDGVMDISNKRKLGFTEFELVKTLQDGVVT 442

Query: 202 LIKIEKSL 179
           LI  E+ L
Sbjct: 443 LINAEEEL 450


>UniRef50_Q4AED1 Cluster: Arginine kinase 2; n=2; Sabellastarte
           indica|Rep: Arginine kinase 2 - Sabellastarte indica
          Length = 377

 Score =  171 bits (415), Expect = 2e-41
 Identities = 82/194 (42%), Positives = 121/194 (62%), Gaps = 6/194 (3%)
 Frame = -3

Query: 742 PLTGMSKETQQQLIDDHFLFKEG-DRFMQAANACRFWPTGRGIYHNENKTFLVWCNEEDH 566
           PLT ++KE ++ L +DHFLF++     +  + ACR WPT RGI+HN+ K FL W NEEDH
Sbjct: 168 PLTKLTKEQEESLRNDHFLFQKPISHILNNSGACRDWPTNRGIWHNDKKNFLAWLNEEDH 227

Query: 565 LRIISMQMGGDLQQVYKRLVSAVNEIEKKIPFSHHD-----RLGFLTFCPTNLGTTVRAS 401
            RI++M+ GGD++ V++R    + E+E  +    H      RLG+L+ CP+N+GT +R S
Sbjct: 228 CRIMAMEKGGDMKGVFERFARGLLEVEAMMKKEGHKFQWSPRLGYLSACPSNIGTGLRCS 287

Query: 400 VHIXXXXXXXXXXXLEEVASKYHLQVRGTRGEHTEAEGGVYDISNKRRMGLTEYDAVKEM 221
           VH+            + +    HL  RGT GE+TE     YDISN++R+  TE + V+E+
Sbjct: 288 VHMRLENLGKREDLFKGICKSMHLDKRGTGGENTETVDFTYDISNEKRVKHTEVEFVQEV 347

Query: 220 YDGIAELIKIEKSL 179
            DG+ +LI+IEK L
Sbjct: 348 IDGVNKLIEIEKKL 361


>UniRef50_P06732 Cluster: Creatine kinase M-type; n=176; root|Rep:
           Creatine kinase M-type - Homo sapiens (Human)
          Length = 381

 Score =  171 bits (415), Expect = 2e-41
 Identities = 85/194 (43%), Positives = 124/194 (63%), Gaps = 6/194 (3%)
 Frame = -3

Query: 742 PLTGMSKETQQQLIDDHFLF-KEGDRFMQAANACRFWPTGRGIYHNENKTFLVWCNEEDH 566
           PL  M+++ QQQLIDDHFLF K     + A+   R WP  RGI+HN+NK+FLVW NEEDH
Sbjct: 175 PLKSMTEKEQQQLIDDHFLFDKPVSPLLLASGMARDWPDARGIWHNDNKSFLVWVNEEDH 234

Query: 565 LRIISMQMGGDLQQVYKRL---VSAVNEIEKKI--PFSHHDRLGFLTFCPTNLGTTVRAS 401
           LR+ISM+ GG++++V++R    +  + EI KK   PF  +  LG++  CP+NLGT +R  
Sbjct: 235 LRVISMEKGGNMKEVFRRFCVGLQKIEEIFKKAGHPFMWNQHLGYVLTCPSNLGTGLRGG 294

Query: 400 VHIXXXXXXXXXXXLEEVASKYHLQVRGTRGEHTEAEGGVYDISNKRRMGLTEYDAVKEM 221
           VH+            EE+ ++  LQ RGT G  T A G V+D+SN  R+G +E + V+ +
Sbjct: 295 VHV-KLAHLSKHPKFEEILTRLRLQKRGTGGVDTAAVGSVFDVSNADRLGSSEVEQVQLV 353

Query: 220 YDGIAELIKIEKSL 179
            DG+  ++++EK L
Sbjct: 354 VDGVKLMVEMEKKL 367


>UniRef50_Q1DA50 Cluster: Putative arginine kinase; n=1; Myxococcus
           xanthus DK 1622|Rep: Putative arginine kinase -
           Myxococcus xanthus (strain DK 1622)
          Length = 341

 Score =  165 bits (401), Expect = 1e-39
 Identities = 80/187 (42%), Positives = 115/187 (61%)
 Frame = -3

Query: 742 PLTGMSKETQQQLIDDHFLFKEGDRFMQAANACRFWPTGRGIYHNENKTFLVWCNEEDHL 563
           PL  +S+  + +L+  H LF++ DRF+ +A   R WP  RGI+H+ +  F+VW  EED L
Sbjct: 143 PLASLSEAERLELVHHHVLFQQSDRFLDSAGVNRDWPRNRGIFHSADMRFIVWVGEEDAL 202

Query: 562 RIISMQMGGDLQQVYKRLVSAVNEIEKKIPFSHHDRLGFLTFCPTNLGTTVRASVHIXXX 383
           RIISMQ G  L Q Y RL +A+ + + ++ F+   RLGFLT CPTNLGT +RASV I   
Sbjct: 203 RIISMQPGSGLAQTYLRLQTALEQFDGQLDFAQDSRLGFLTACPTNLGTAMRASVLIRLP 262

Query: 382 XXXXXXXXLEEVASKYHLQVRGTRGEHTEAEGGVYDISNKRRMGLTEYDAVKEMYDGIAE 203
                       A +  L VRG  GEH+EA  G++D+SN  R+G+TE D  +++  GI  
Sbjct: 263 HLSRRPDFRARCA-RLGLAVRGLHGEHSEARDGIHDVSNATRLGVTERDIYEQLRTGIHA 321

Query: 202 LIKIEKS 182
           L+++E +
Sbjct: 322 LMEMESA 328


>UniRef50_P12532 Cluster: Creatine kinase, ubiquitous mitochondrial
           precursor; n=19; Euteleostomi|Rep: Creatine kinase,
           ubiquitous mitochondrial precursor - Homo sapiens
           (Human)
          Length = 417

 Score =  163 bits (395), Expect = 5e-39
 Identities = 84/193 (43%), Positives = 118/193 (61%), Gaps = 6/193 (3%)
 Frame = -3

Query: 739 LTGMSKETQQQLIDDHFLF-KEGDRFMQAANACRFWPTGRGIYHNENKTFLVWCNEEDHL 563
           L+ M++  QQQLIDDHFLF K     + AA   R WP  RGI+HN  K+FL+W NEEDH 
Sbjct: 209 LSEMTEAEQQQLIDDHFLFDKPVSPLLTAAGMARDWPDARGIWHNNEKSFLIWVNEEDHT 268

Query: 562 RIISMQMGGDLQQVYKRLVSAVNEIEKKI-----PFSHHDRLGFLTFCPTNLGTTVRASV 398
           R+ISM+ GG++++V++R    + E+E+ I      F  ++RLG++  CP+NLGT +RA V
Sbjct: 269 RVISMEKGGNMKRVFERFCRGLKEVERLIQERGWEFMWNERLGYILTCPSNLGTGLRAGV 328

Query: 397 HIXXXXXXXXXXXLEEVASKYHLQVRGTRGEHTEAEGGVYDISNKRRMGLTEYDAVKEMY 218
           HI             ++     LQ RGT G  T A GGV+DISN  R+G +E + V+ + 
Sbjct: 329 HI-KLPLLSKDSRFPKILENLRLQKRGTGGVDTAATGGVFDISNLDRLGKSEVELVQLVI 387

Query: 217 DGIAELIKIEKSL 179
           DG+  LI  E+ L
Sbjct: 388 DGVNYLIDCERRL 400


>UniRef50_P17540 Cluster: Creatine kinase, sarcomeric mitochondrial
           precursor; n=120; Coelomata|Rep: Creatine kinase,
           sarcomeric mitochondrial precursor - Homo sapiens
           (Human)
          Length = 419

 Score =  158 bits (384), Expect = 1e-37
 Identities = 81/193 (41%), Positives = 117/193 (60%), Gaps = 6/193 (3%)
 Frame = -3

Query: 739 LTGMSKETQQQLIDDHFLF-KEGDRFMQAANACRFWPTGRGIYHNENKTFLVWCNEEDHL 563
           L+ M+++ QQ+LIDDHFLF K     +  A   R WP  RGI+HN +KTFL+W NEEDH 
Sbjct: 210 LSEMTEQDQQRLIDDHFLFDKPVSPLLTCAGMARDWPDARGIWHNYDKTFLIWINEEDHT 269

Query: 562 RIISMQMGGDLQQVYKRLVSAVNEIEKKI-----PFSHHDRLGFLTFCPTNLGTTVRASV 398
           R+ISM+ GG++++V++R    + E+E+ I      F  ++RLG++  CP+NLGT +RA V
Sbjct: 270 RVISMEKGGNMKRVFERFCRGLKEVERLIQERGWEFMWNERLGYILTCPSNLGTGLRAGV 329

Query: 397 HIXXXXXXXXXXXLEEVASKYHLQVRGTRGEHTEAEGGVYDISNKRRMGLTEYDAVKEMY 218
           H+             ++     LQ RGT G  T A   VYDISN  R+G +E + V+ + 
Sbjct: 330 HV-RIPKLSKDPRFSKILENLRLQKRGTGGVDTAAVADVYDISNIDRIGRSEVELVQIVI 388

Query: 217 DGIAELIKIEKSL 179
           DG+  L+  EK L
Sbjct: 389 DGVNYLVDCEKKL 401


>UniRef50_Q6APG0 Cluster: Related to arginine kinase; n=1;
           Desulfotalea psychrophila|Rep: Related to arginine
           kinase - Desulfotalea psychrophila
          Length = 375

 Score =  154 bits (374), Expect = 2e-36
 Identities = 73/184 (39%), Positives = 110/184 (59%)
 Frame = -3

Query: 730 MSKETQQQLIDDHFLFKEGDRFMQAANACRFWPTGRGIYHNENKTFLVWCNEEDHLRIIS 551
           +  E    L  +  +F +GDRF +AA     +P  RGI+ + +K   +W  EEDH+RIIS
Sbjct: 192 LGAEKMAALRAEKLIFSKGDRFQEAAGFNADFPKSRGIFFSADKGLRIWLGEEDHMRIIS 251

Query: 550 MQMGGDLQQVYKRLVSAVNEIEKKIPFSHHDRLGFLTFCPTNLGTTVRASVHIXXXXXXX 371
            +   DL  V+ RL  A+  +E  + F   +  G+L+ CPTN+GTT+RA VHI       
Sbjct: 252 QEGSADLAAVFNRLGRALTTLEASLDFVRDESYGYLSSCPTNIGTTMRAGVHIYLEKLNC 311

Query: 370 XXXXLEEVASKYHLQVRGTRGEHTEAEGGVYDISNKRRMGLTEYDAVKEMYDGIAELIKI 191
               L+ +  K+ LQ+RGT GE TE +G V+DISN+RR+G++E   +  ++ G+ E+I+ 
Sbjct: 312 NRQLLDALTEKHDLQIRGTGGEKTEVDGAVFDISNRRRLGISERQIITGLHAGLQEIIEA 371

Query: 190 EKSL 179
           EKSL
Sbjct: 372 EKSL 375


>UniRef50_UPI00005A2F57 Cluster: PREDICTED: similar to creatine
           kinase, brain; n=3; Eutheria|Rep: PREDICTED: similar to
           creatine kinase, brain - Canis familiaris
          Length = 414

 Score =  147 bits (356), Expect = 3e-34
 Identities = 79/193 (40%), Positives = 113/193 (58%), Gaps = 6/193 (3%)
 Frame = -3

Query: 739 LTGMSKETQQQLIDDHFLF-KEGDRFMQAANACRFWPTGRGIYHNENKTFLVWCNEEDHL 563
           L  M++  QQQLI  HFLF K     + A+   R WP  RGI+ ++NKTFLVW  EEDHL
Sbjct: 211 LKSMTEAEQQQLIHHHFLFDKPLSPLLLASGMARDWPDARGIWRDDNKTFLVWIKEEDHL 270

Query: 562 RIISMQMGGDLQQVYKRLVSAVNEIE-----KKIPFSHHDRLGFLTFCPTNLGTTVRASV 398
           R+IS+Q+GG+ ++V+ R  + + +IE     K   F  +  LG++  CP+NLGT +RA V
Sbjct: 271 RVISIQIGGNTKEVFTRFCNGLTQIETLLKSKNYQFMWNPHLGYVLTCPSNLGTGLRAGV 330

Query: 397 HIXXXXXXXXXXXLEEVASKYHLQVRGTRGEHTEAEGGVYDISNKRRMGLTEYDAVKEMY 218
           HI             EV     LQ  GT G  T A GG++D+SN   +G +E + V+ + 
Sbjct: 331 HI-KLPHLGKHEKFPEVLKPLRLQKLGTGGVDTAAVGGIFDVSNADCLGFSEVELVQMVV 389

Query: 217 DGIAELIKIEKSL 179
           DG+  LI++E+ L
Sbjct: 390 DGVKLLIEMEQRL 402


>UniRef50_A7RER2 Cluster: Predicted protein; n=2; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 396

 Score =  146 bits (355), Expect = 4e-34
 Identities = 81/196 (41%), Positives = 111/196 (56%), Gaps = 10/196 (5%)
 Frame = -3

Query: 736 TGMSKETQQQLIDDHFLFKEGDRFMQAANACRFWPTGRGIYHNENKTFLVWCNEEDHLRI 557
           T M+ E +Q+L+DDHFLF+  D+   A+    FWP GRGI+ N+ KTFL W NE DHLRI
Sbjct: 195 TTMTDEERQKLVDDHFLFRGKDKMQAASGYHEFWPEGRGIFINKAKTFLNWINEGDHLRI 254

Query: 556 ISMQMGGDLQQVYKRLVSAVNEIE--------KKIPFSHHDRLGFLTFCPTNLGTTVRAS 401
           ISM+MGGD++ V+ RL      IE         K  F  H   G +T CPTN+GT +R S
Sbjct: 255 ISMEMGGDVKGVFTRLSRGAKAIEDGVKEATGAKDAFMMHPTFGSVTCCPTNIGTGMRGS 314

Query: 400 VHI--XXXXXXXXXXXLEEVASKYHLQVRGTRGEHTEAEGGVYDISNKRRMGLTEYDAVK 227
           VHI             ++++  + + Q RG+ GEH+E    + D+SN RR+G  EY  V 
Sbjct: 315 VHILVPKLIAKIGFDAIDKICRERNCQARGSTGEHSEVIDRI-DVSNWRRIGFPEYQLVD 373

Query: 226 EMYDGIAELIKIEKSL 179
           +M   +  L + E  L
Sbjct: 374 DMIQCVNFLAEEEDKL 389


>UniRef50_A6XH17 Cluster: Arginine kinase; n=2; Suberites|Rep:
           Arginine kinase - Suberites fuscus
          Length = 382

 Score =  142 bits (343), Expect = 1e-32
 Identities = 77/182 (42%), Positives = 108/182 (59%), Gaps = 10/182 (5%)
 Frame = -3

Query: 736 TGMSKETQQQLIDDHFLFKEGDRFMQAANACRFWPTGRGIYHNENKTFLVWCNEEDHLRI 557
           T MS + +QQLIDDHFLF+  D+   A+   + WP GRGI+ +++KTF+VW NE DHL I
Sbjct: 187 TTMSDQQRQQLIDDHFLFRGKDKMQAASGYHQEWPHGRGIFVSKDKTFIVWVNEGDHLHI 246

Query: 556 ISMQMGGDLQQVYKRLVSAVNEIEKKIP--------FSHHDRLGFLTFCPTNLGTTVRAS 401
           ISM+ GGD++ V+ RL   +  IEK +         F     LG +T CP+NLGT +R S
Sbjct: 247 ISMEQGGDVRSVFSRLSRGIEAIEKGLKRVTGRAEVFMTDPILGVITCCPSNLGTAMRGS 306

Query: 400 VHI--XXXXXXXXXXXLEEVASKYHLQVRGTRGEHTEAEGGVYDISNKRRMGLTEYDAVK 227
           VHI             L+ +A     Q RG+ GEH+E +  + D+SN RR+G +E   V+
Sbjct: 307 VHIRVPKLIASWGFEKLDTLARSKDCQARGSSGEHSEVKDRI-DVSNWRRLGFSESSLVQ 365

Query: 226 EM 221
           +M
Sbjct: 366 DM 367


>UniRef50_A6XH11 Cluster: Arginine kinase; n=1; Aphrocallistes
           beatrix|Rep: Arginine kinase - Aphrocallistes beatrix
          Length = 367

 Score =  123 bits (297), Expect = 4e-27
 Identities = 65/179 (36%), Positives = 97/179 (54%), Gaps = 5/179 (2%)
 Frame = -3

Query: 709 QLIDDHFLFKE--GDRFMQAANACRFWPTGRGIYHNENKTFLVWCNEEDHLRIISMQMGG 536
           +L++DH +FK+   D ++ +A   + WP GRG Y +E+++ ++W  EEDHLRIISM+ G 
Sbjct: 184 KLVEDHLMFKDMSSDTYLVSAGISQDWPFGRGCYVSEDRSTIIWVGEEDHLRIISMKKGT 243

Query: 535 DLQQVYKRLVSAVNEIEKKI--PFSHHDRLGFLTFCPTNLGTTVRASVHIXXXXXXXXXX 362
            L   Y  L  A++  E  I   F+H    G +T CPTN+GT +RAS+H+          
Sbjct: 244 LLNNAYNNLKEALDITEPLINGGFAHSKEFGVVTSCPTNIGTALRASIHLKIPKLMENEK 303

Query: 361 XLEEVASKYHLQVRGTRGEHTE-AEGGVYDISNKRRMGLTEYDAVKEMYDGIAELIKIE 188
             +       + VRG  GEHT     G+ DIS   R  +TE   V  +Y GI  +++ E
Sbjct: 304 DAKAFIKSLGMSVRGKGGEHTAMGADGLVDISPSSRFCITEARIVATLYKGIKTILEKE 362


>UniRef50_A0CMM0 Cluster: Chromosome undetermined scaffold_21, whole
           genome shotgun sequence; n=8; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_21,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 395

 Score =  112 bits (269), Expect = 1e-23
 Identities = 67/190 (35%), Positives = 102/190 (53%), Gaps = 7/190 (3%)
 Frame = -3

Query: 730 MSKETQQQLIDDHFLFKE--GDRFMQAANACRFWPTGRGIYHNENKTFLVWCNEEDHLRI 557
           +S +   +L   HFLF +   D ++ +      WP GRGI+ ++++T +VW  EED LRI
Sbjct: 192 ISDQEADELRKKHFLFIDMTSDNYLMSNGVASDWPFGRGIWVSQDETKMVWVGEEDQLRI 251

Query: 556 ISMQMGGDLQQVYKRLVSAVNEIEKK-IPFSHHDRLGFLTFCPTNLGTTVRASV---HIX 389
           IS+  G DL +V + L   +  IEK  + F+ H   G +T CPTN+ T  R S+      
Sbjct: 252 ISIVQGNDLGKVDQSLHELLTAIEKSGLKFAEHPVFGIITTCPTNMRTGKRQSILGKFPN 311

Query: 388 XXXXXXXXXXLEEVASKYHLQVRGTRGEHTEA-EGGVYDISNKRRMGLTEYDAVKEMYDG 212
                     L+E A    LQVRGT GEH+   + G  DIS   R G+TE +  K +++G
Sbjct: 312 LSKSGTDEANLKEKAKSIGLQVRGTSGEHSSMDQEGTADISPFARFGVTEANVTKGLFEG 371

Query: 211 IAELIKIEKS 182
           +  L ++E++
Sbjct: 372 LIVLYQLERT 381


>UniRef50_UPI00005A5D28 Cluster: PREDICTED: similar to Creatine
           kinase B-type (Creatine kinase, B chain) (B-CK); n=2;
           Canis lupus familiaris|Rep: PREDICTED: similar to
           Creatine kinase B-type (Creatine kinase, B chain) (B-CK)
           - Canis familiaris
          Length = 304

 Score =  107 bits (256), Expect = 4e-22
 Identities = 67/189 (35%), Positives = 98/189 (51%), Gaps = 1/189 (0%)
 Frame = -3

Query: 742 PLTGMSKETQQQLIDDHFLF-KEGDRFMQAANACRFWPTGRGIYHNENKTFLVWCNEEDH 566
           P   M++  QQQLI DH LF K     + A+     WP  RGI+HN+NKTF +W +EED 
Sbjct: 125 PTPTMTEAEQQQLIADHVLFDKPVSPLLLASTPVHDWPDARGIWHNDNKTFPMWVDEED- 183

Query: 565 LRIISMQMGGDLQQVYKRLVSAVNEIEKKIPFSHHDRLGFLTFCPTNLGTTVRASVHIXX 386
                         ++K          K   F+ +  LG++  CP+NLGT +RA VHI  
Sbjct: 184 ------------TSLFK---------SKNYEFTWNPHLGYILTCPSNLGTGLRAGVHIKL 222

Query: 385 XXXXXXXXXLEEVASKYHLQVRGTRGEHTEAEGGVYDISNKRRMGLTEYDAVKEMYDGIA 206
                     E +  +  LQ RGT G  T A GGV+++S+  R+G +E + V+ + DG+ 
Sbjct: 223 PHLGKHEKFPEAL-KRLRLQKRGTGGVDTAAVGGVFEVSDADRLGFSEVELVQVVVDGVK 281

Query: 205 ELIKIEKSL 179
            LI++E+ L
Sbjct: 282 LLIEMEQRL 290


>UniRef50_A6TWL7 Cluster: ATP:guanido phosphotransferase; n=2;
           Clostridiaceae|Rep: ATP:guanido phosphotransferase -
           Alkaliphilus metalliredigens QYMF
          Length = 341

 Score = 99.1 bits (236), Expect = 1e-19
 Identities = 53/150 (35%), Positives = 87/150 (58%), Gaps = 2/150 (1%)
 Frame = -3

Query: 628 GRGIYHNENKTFLVWCNEEDHLRIISMQMGGDLQQVYKRLVSAVNEIEKKIPFSHHDRLG 449
           G  ++ N+ +T  +  NEEDH+RI  +  G  L+ +++      N +E+KI F+ ++ LG
Sbjct: 94  GGSVFINQEETISIMMNEEDHIRIQCLLPGLQLETLWELGDEIDNLLEEKIEFAFNEDLG 153

Query: 448 FLTFCPTNLGTTVRASV--HIXXXXXXXXXXXLEEVASKYHLQVRGTRGEHTEAEGGVYD 275
           +LT CPTNLGT +RASV  H+           + + AS+  L +RG  GE +E  G +Y 
Sbjct: 154 YLTSCPTNLGTGIRASVMMHLPALTLSRSIQRVLQAASQIGLAIRGIYGEGSEFAGNLYQ 213

Query: 274 ISNKRRMGLTEYDAVKEMYDGIAELIKIEK 185
           ISN+  +G TE + V+ + D + ++I  E+
Sbjct: 214 ISNQVTLGRTEEEIVQHLKDVVMQIIHKER 243


>UniRef50_UPI00005A0AB9 Cluster: PREDICTED: similar to Creatine
           kinase B-type (Creatine kinase, B chain) (B-CK); n=1;
           Canis lupus familiaris|Rep: PREDICTED: similar to
           Creatine kinase B-type (Creatine kinase, B chain) (B-CK)
           - Canis familiaris
          Length = 257

 Score = 96.3 bits (229), Expect = 7e-19
 Identities = 43/86 (50%), Positives = 58/86 (67%), Gaps = 1/86 (1%)
 Frame = -3

Query: 739 LTGMSKETQQQLIDDHFLFKE-GDRFMQAANACRFWPTGRGIYHNENKTFLVWCNEEDHL 563
           L  M++  QQQLI DHFLF E     + A+   R WP  RGI+H++NKTFLVW NEEDHL
Sbjct: 169 LKSMTEAEQQQLIHDHFLFDEPASPLLLASGMARDWPDARGIWHSDNKTFLVWINEEDHL 228

Query: 562 RIISMQMGGDLQQVYKRLVSAVNEIE 485
           R+ISMQ GG+ ++ + R  +   ++E
Sbjct: 229 RVISMQKGGNTKEAFTRFCNGPTQME 254


>UniRef50_A0UZ11 Cluster: ATP:guanido phosphotransferase; n=2;
           Clostridium|Rep: ATP:guanido phosphotransferase -
           Clostridium cellulolyticum H10
          Length = 340

 Score = 93.1 bits (221), Expect = 7e-18
 Identities = 55/151 (36%), Positives = 86/151 (56%), Gaps = 3/151 (1%)
 Frame = -3

Query: 622 GIYHNENKTFLVWCNEEDHLRIISMQMGGDLQQVYKRLVSAVNEIEKKIPFSHHDRLGFL 443
           G + NEN+   +  NEEDHLR+ S+  G  L++ YK      + I +K  ++  D+ G+L
Sbjct: 94  GAFINENENVSIMVNEEDHLRVQSIFPGIQLEKGYKVCDEIDSLIAEKADYAFDDKYGYL 153

Query: 442 TFCPTNLGTTVRASV--HIXXXXXXXXXXXLEEVASKYHLQVRGTRGEHTEAEGGVYDIS 269
           T CPTNLGT +RASV  H+           + E  +K  + VRG  GE++EA G ++ +S
Sbjct: 154 TSCPTNLGTGMRASVMLHLPALVMTGYMKSILESCNKVGVAVRGIYGENSEAVGDMFQVS 213

Query: 268 NKRRMGLTEYDAVKEMYDGIA-ELIKIEKSL 179
           N+  +G  E + +  + DGI  ++I  EK+L
Sbjct: 214 NQITLGRKEEETISSI-DGICKQIIDREKAL 243


>UniRef50_A7CUC7 Cluster: ATP:guanido phosphotransferase; n=1;
           Opitutaceae bacterium TAV2|Rep: ATP:guanido
           phosphotransferase - Opitutaceae bacterium TAV2
          Length = 575

 Score = 90.6 bits (215), Expect = 3e-17
 Identities = 48/149 (32%), Positives = 85/149 (57%), Gaps = 2/149 (1%)
 Frame = -3

Query: 622 GIYHNENKTFLVWCNEEDHLRIISMQMGGDLQQVYKRLVSAVNEIEKKIPFSHHDRLGFL 443
           G+  N+++TF V  NEEDHLRI  ++ G  L++ +  + +   E+E K+ ++    LG+L
Sbjct: 304 GVVINKDQTFSVMINEEDHLRIQILRSGFQLKKAWAAIDALDTELEGKLDYAFDPALGYL 363

Query: 442 TFCPTNLGTTVRAS--VHIXXXXXXXXXXXLEEVASKYHLQVRGTRGEHTEAEGGVYDIS 269
           T CPTNLGT +RAS  +H+           +    ++  + VRG  GE ++A G ++ IS
Sbjct: 364 TACPTNLGTGMRASAMMHLPALVISGQMEKVVRAVNQLGMVVRGLFGEGSDASGSIFQIS 423

Query: 268 NKRRMGLTEYDAVKEMYDGIAELIKIEKS 182
           N+  +G +E   +K +   +  +I+ E++
Sbjct: 424 NQTTLGESEDAIIKRLNTVLHSIIEHEEN 452


>UniRef50_P37570 Cluster: Putative ATP:guanido phosphotransferase
           yacI; n=10; Bacillaceae|Rep: Putative ATP:guanido
           phosphotransferase yacI - Bacillus subtilis
          Length = 363

 Score = 90.6 bits (215), Expect = 3e-17
 Identities = 52/149 (34%), Positives = 84/149 (56%), Gaps = 2/149 (1%)
 Frame = -3

Query: 622 GIYHNENKTFLVWCNEEDHLRIISMQMGGDLQQVYKRLVSAVNEIEKKIPFSHHDRLGFL 443
           G   +EN+   V  NEEDH+RI  +  G  L +  K      + IE+K+ ++ +++ G+L
Sbjct: 105 GCLLSENEEVSVMLNEEDHIRIQCLFPGFQLLEAMKAANQVDDWIEEKVDYAFNEQRGYL 164

Query: 442 TFCPTNLGTTVRASV--HIXXXXXXXXXXXLEEVASKYHLQVRGTRGEHTEAEGGVYDIS 269
           T CPTN+GT +RASV  H+           +    ++  L VRG  GE +EA G ++ IS
Sbjct: 165 TSCPTNVGTGLRASVMMHLPALVLTRQINRIIPAINQLGLVVRGIYGEGSEAVGNIFQIS 224

Query: 268 NKRRMGLTEYDAVKEMYDGIAELIKIEKS 182
           N+  +G +E D V+++    A+LI+ E+S
Sbjct: 225 NQITLGKSEQDIVEDLNSVAAQLIEQERS 253


>UniRef50_Q81VW0 Cluster: Putative ATP:guanido phosphotransferase
           BA_0079/GBAA0079/BAS0080; n=26; Bacillales|Rep: Putative
           ATP:guanido phosphotransferase BA_0079/GBAA0079/BAS0080
           - Bacillus anthracis
          Length = 354

 Score = 90.2 bits (214), Expect = 5e-17
 Identities = 49/144 (34%), Positives = 81/144 (56%), Gaps = 2/144 (1%)
 Frame = -3

Query: 610 NENKTFLVWCNEEDHLRIISMQMGGDLQQVYKRLVSAVNEIEKKIPFSHHDRLGFLTFCP 431
           +E++   V  NEEDH+RI  +  G  L +  +      N IEK++ ++  + LG++T CP
Sbjct: 109 SESEHISVMLNEEDHIRIQCLFSGLQLSEALQSANQIDNWIEKEVEYAFDESLGYITSCP 168

Query: 430 TNLGTTVRASV--HIXXXXXXXXXXXLEEVASKYHLQVRGTRGEHTEAEGGVYDISNKRR 257
           TN+GT +RASV  H+           + +V  K  L VRG  GE +EA G ++ +SN+  
Sbjct: 169 TNVGTGLRASVMIHLPGLVLTKRISRIIQVIQKLGLVVRGIYGEGSEALGNIFQVSNQMT 228

Query: 256 MGLTEYDAVKEMYDGIAELIKIEK 185
           +G +E D + ++   I ++I+ EK
Sbjct: 229 LGKSEEDIIADLKSVIQQIIQQEK 252


>UniRef50_Q49V33 Cluster: Putative ATP:guanido phosphotransferase
           SSP2232; n=16; Staphylococcus|Rep: Putative ATP:guanido
           phosphotransferase SSP2232 - Staphylococcus
           saprophyticus subsp. saprophyticus (strain ATCC 15305
           /DSM 20229)
          Length = 336

 Score = 89.4 bits (212), Expect = 8e-17
 Identities = 44/146 (30%), Positives = 81/146 (55%), Gaps = 2/146 (1%)
 Frame = -3

Query: 610 NENKTFLVWCNEEDHLRIISMQMGGDLQQVYKRLVSAVNEIEKKIPFSHHDRLGFLTFCP 431
           NE+++  +  NEEDHLRI +M     L  +Y++     ++++ ++  S  + LG+LT CP
Sbjct: 100 NEDESLSIMVNEEDHLRIQAMGNDLSLSSLYEKASEIDDKLDSELDVSFDETLGYLTTCP 159

Query: 430 TNLGTTVRASV--HIXXXXXXXXXXXLEEVASKYHLQVRGTRGEHTEAEGGVYDISNKRR 257
           TN+GT +RASV  H+           + +  +++   +RG  GE +   G +Y ISN+  
Sbjct: 160 TNIGTGMRASVMLHLPGLTIMKRMNRIAQTINRFGFTIRGIYGEGSHVYGHIYQISNQLT 219

Query: 256 MGLTEYDAVKEMYDGIAELIKIEKSL 179
           +G TE D ++ + + + ++I  E  +
Sbjct: 220 LGKTEEDIIESLSEVVQQIINEEMQI 245


>UniRef50_A7GJA5 Cluster: ATP:guanido phosphotransferase domain
           protein; n=5; Clostridium|Rep: ATP:guanido
           phosphotransferase domain protein - Clostridium
           botulinum (strain Langeland / NCTC 10281 / Type F)
          Length = 347

 Score = 86.6 bits (205), Expect = 6e-16
 Identities = 49/136 (36%), Positives = 75/136 (55%), Gaps = 2/136 (1%)
 Frame = -3

Query: 589 VWCNEEDHLRIISMQMGGDLQQVYKRLVSAVNEIEKKIPFSHHDRLGFLTFCPTNLGTTV 410
           +  NEEDH+RI S+  G +LQ+ +++     N IEK +  +    LG+LT CPTN+GT +
Sbjct: 105 IMINEEDHIRIQSITKGFNLQKAFEKANQIDNMIEKNVNLAFDKDLGYLTSCPTNIGTGL 164

Query: 409 RASV--HIXXXXXXXXXXXLEEVASKYHLQVRGTRGEHTEAEGGVYDISNKRRMGLTEYD 236
           RASV  H+           L    S+  + VRG  GE ++A G +Y ISN+  +GL E +
Sbjct: 165 RASVMIHLPALSMNNRISALLNAISQLGMTVRGIYGEGSKALGNIYQISNQITLGLDEVE 224

Query: 235 AVKEMYDGIAELIKIE 188
            +  +   I ++I  E
Sbjct: 225 IMNNLKAVIKQIINEE 240


>UniRef50_Q18V69 Cluster: ATP:guanido phosphotransferase; n=2;
           Desulfitobacterium hafniense|Rep: ATP:guanido
           phosphotransferase - Desulfitobacterium hafniense
           (strain DCB-2)
          Length = 350

 Score = 86.2 bits (204), Expect = 8e-16
 Identities = 47/148 (31%), Positives = 81/148 (54%), Gaps = 2/148 (1%)
 Frame = -3

Query: 625 RGIYHNENKTFLVWCNEEDHLRIISMQMGGDLQQVYKRLVSAVNEIEKKIPFSHHDRLGF 446
           RG+  N +    V  NEEDHLRI  +  G  L++ Y    +  +++E+++ F++ +  G+
Sbjct: 102 RGVAINSDHRVSVMVNEEDHLRIQVLLPGDQLKEAYLLSNTMDDQLEERLDFAYREAQGY 161

Query: 445 LTFCPTNLGTTVRASVHIXXXXXXXXXXXLEEVASKYH--LQVRGTRGEHTEAEGGVYDI 272
           LT CPTN+GT +RASV +            + + +  H  L VRG  GE ++A G +Y +
Sbjct: 162 LTACPTNVGTGMRASVMVHMPALVMTNRVQQLLGALNHLGLAVRGLYGEGSQAFGHIYQV 221

Query: 271 SNKRRMGLTEYDAVKEMYDGIAELIKIE 188
           SN+  +G +E D +  +     ++I+ E
Sbjct: 222 SNQITLGKSEEDTITHLEAVTRQIIEQE 249


>UniRef50_Q0AUE7 Cluster: ATP:guanido phosphotransferase; n=1;
           Syntrophomonas wolfei subsp. wolfei str. Goettingen|Rep:
           ATP:guanido phosphotransferase - Syntrophomonas wolfei
           subsp. wolfei (strain Goettingen)
          Length = 359

 Score = 85.8 bits (203), Expect = 1e-15
 Identities = 50/151 (33%), Positives = 81/151 (53%), Gaps = 2/151 (1%)
 Frame = -3

Query: 625 RGIYHNENKTFLVWCNEEDHLRIISMQMGGDLQQVYKRLVSAVNEIEKKIPFSHHDRLGF 446
           +G+    + +  V  NEEDHLRI     G  L++ Y+R     + +EK++ F+  DR G+
Sbjct: 107 QGLLVKPDGSLAVMINEEDHLRIQCFLPGLQLEEAYRRAQEIDDALEKELDFAFDDRRGY 166

Query: 445 LTFCPTNLGTTVRAS--VHIXXXXXXXXXXXLEEVASKYHLQVRGTRGEHTEAEGGVYDI 272
           LT CPTN+GT +RAS  +H+           + +  ++  L VRG  GE TEA G  + +
Sbjct: 167 LTSCPTNIGTGMRASLMLHLPAITISGQSGHIFQNLNQLGLTVRGIYGEGTEAIGNFFQL 226

Query: 271 SNKRRMGLTEYDAVKEMYDGIAELIKIEKSL 179
           SN+  +G +E D    +     ++I+ E+ L
Sbjct: 227 SNQITLGQSEEDINASLTTISQQVIEQERML 257


>UniRef50_A6C8T0 Cluster: ATP:guanido phosphotransferase; n=4;
           Planctomycetales|Rep: ATP:guanido phosphotransferase -
           Planctomyces maris DSM 8797
          Length = 330

 Score = 85.8 bits (203), Expect = 1e-15
 Identities = 48/155 (30%), Positives = 81/155 (52%), Gaps = 2/155 (1%)
 Frame = -3

Query: 643 RFWPTGRGIYHNENKTFLVWCNEEDHLRIISMQMGGDLQQVYKRLVSAVNEIEKKIPFSH 464
           R  P G G+   EN   +V  NEEDHLR+  ++ G  L + +  +    + +E+++ ++ 
Sbjct: 74  RSGPRGVGLDSEENIGIMV--NEEDHLRLQVLRSGFSLNECWDTINQIDDLLEQEVTYAF 131

Query: 463 HDRLGFLTFCPTNLGTTVRASV--HIXXXXXXXXXXXLEEVASKYHLQVRGTRGEHTEAE 290
            +  G+LT CPTN+GT +R SV  H+           + +   K +L VRG  GE ++A 
Sbjct: 132 SEEFGYLTACPTNVGTGIRVSVMLHLPALVITKEIQKVFQALQKINLAVRGLYGEGSQAM 191

Query: 289 GGVYDISNKRRMGLTEYDAVKEMYDGIAELIKIEK 185
           G  Y ISN+  +G TE   +  + + +  +I  E+
Sbjct: 192 GDFYQISNQVTLGQTEQQLIDSIKEVVPNIISYER 226


>UniRef50_Q67JN4 Cluster: Putative ATP:guanido phosphotransferase
           STH3134; n=6; Firmicutes|Rep: Putative ATP:guanido
           phosphotransferase STH3134 - Symbiobacterium
           thermophilum
          Length = 353

 Score = 85.4 bits (202), Expect = 1e-15
 Identities = 51/141 (36%), Positives = 82/141 (58%), Gaps = 3/141 (2%)
 Frame = -3

Query: 610 NENKTFLVWCNEEDHLRIISMQMGGDLQQVYKRLVSAVNE-IEKKIPFSHHDRLGFLTFC 434
           +E++   +  NEEDHLRI  +  G  LQ+ + R+ S V++ +E+++ F+  ++LG+LT C
Sbjct: 111 SEDEAISIMVNEEDHLRIQVLASGLQLQEAW-RVASQVDDALEQRLQFAFDEQLGYLTAC 169

Query: 433 PTNLGTTVRASV--HIXXXXXXXXXXXLEEVASKYHLQVRGTRGEHTEAEGGVYDISNKR 260
           PTN+GT +RASV  H+           L    S+  L VRG  GE TEA G ++ ISN+ 
Sbjct: 170 PTNVGTGLRASVMMHLPALVLTQQAGRLFHNLSQLGLVVRGLYGEGTEAAGQIFQISNQT 229

Query: 259 RMGLTEYDAVKEMYDGIAELI 197
            +G  E + +  + + IA  +
Sbjct: 230 SLGKAEEEIIANL-EAIARTV 249


>UniRef50_Q8R7S0 Cluster: Putative ATP:guanido phosphotransferase
           TTE2328; n=4; Clostridia|Rep: Putative ATP:guanido
           phosphotransferase TTE2328 - Thermoanaerobacter
           tengcongensis
          Length = 337

 Score = 85.4 bits (202), Expect = 1e-15
 Identities = 51/147 (34%), Positives = 82/147 (55%), Gaps = 2/147 (1%)
 Frame = -3

Query: 631 TGRGIYHNENKTFLVWCNEEDHLRIISMQMGGDLQQVYKRLVSAVNEIEKKIPFSHHDRL 452
           TG  +  ++N T  +  NEEDHLRI  +  G  L + +       + IE+ I +++ +++
Sbjct: 88  TGYALIKDDN-TVSIMVNEEDHLRIQCILPGLKLDESWDMADKIDDLIEETIDYAYDEKI 146

Query: 451 GFLTFCPTNLGTTVRAS--VHIXXXXXXXXXXXLEEVASKYHLQVRGTRGEHTEAEGGVY 278
           G+LT CPTN+GT +RAS  VH+           +    SK  + VRG  GE T+A G +Y
Sbjct: 147 GYLTSCPTNVGTGIRASVMVHLPALTITGQISNILNSVSKIGMAVRGIYGEGTQALGDIY 206

Query: 277 DISNKRRMGLTEYDAVKEMYDGIAELI 197
            ISN+  +G +E + + E  +G+A+ I
Sbjct: 207 QISNQVTLGQSEKEII-ENIEGVAKQI 232


>UniRef50_Q890L4 Cluster: Putative ATP:guanido phosphotransferase
           CTC_02634; n=3; Clostridium|Rep: Putative ATP:guanido
           phosphotransferase CTC_02634 - Clostridium tetani
          Length = 340

 Score = 85.0 bits (201), Expect = 2e-15
 Identities = 43/144 (29%), Positives = 81/144 (56%), Gaps = 2/144 (1%)
 Frame = -3

Query: 610 NENKTFLVWCNEEDHLRIISMQMGGDLQQVYKRLVSAVNEIEKKIPFSHHDRLGFLTFCP 431
           NE++T  +  NEEDH+R+  +  G +L++ YK      + IE+ + ++  + LG++T CP
Sbjct: 96  NEDETVSLMINEEDHIRLQCITNGFNLEEAYKCAEDLDDLIEENLDYAFDENLGYMTACP 155

Query: 430 TNLGTTVRASV--HIXXXXXXXXXXXLEEVASKYHLQVRGTRGEHTEAEGGVYDISNKRR 257
           TNLGT +RASV  H+           +    ++  + +RG  GE ++  G ++ +SN+  
Sbjct: 156 TNLGTGLRASVMIHLPTLTMNREINKIFSGLTQIGMTIRGIYGEGSKVVGNLFQVSNQLT 215

Query: 256 MGLTEYDAVKEMYDGIAELIKIEK 185
           +GL+E + +  +   + ++I  EK
Sbjct: 216 LGLSEEEVINNLKAVVYQIINQEK 239


>UniRef50_Q18CB0 Cluster: Putative ATP:guanido phosphotransferase;
           n=1; Clostridium difficile 630|Rep: Putative ATP:guanido
           phosphotransferase - Clostridium difficile (strain 630)
          Length = 341

 Score = 83.8 bits (198), Expect = 4e-15
 Identities = 49/149 (32%), Positives = 83/149 (55%), Gaps = 6/149 (4%)
 Frame = -3

Query: 607 ENKTFLVWCNEEDHLRIISMQMGGDLQQVYKRLVSAVNEIEKKIPFSHHDRLGFLTFCPT 428
           ++KT  +  NEEDH+RI ++    +L+  Y       + +E  + ++ + +LG+LT CPT
Sbjct: 91  KDKTISIMINEEDHIRIQTICDDLNLEYAYSVANEIDDLLESSLEYAFNTKLGYLTSCPT 150

Query: 427 NLGTTVRASV--HIXXXXXXXXXXXLEEVASKYHLQVRGTRGEHTEAEGGVYDISNKRRM 254
           N GT +RASV  H+           L +++S+  + +RG  GE TEA G +Y ISN+  +
Sbjct: 151 NTGTGMRASVMMHLPALSQLGYMDELYKISSQIGIAIRGIYGERTEALGNIYQISNQLTL 210

Query: 253 GLTEYDAVKEM----YDGIAELIKIEKSL 179
           G TE + ++ +     D I++ IK  + L
Sbjct: 211 GRTESNIIENVSGLTKDAISKEIKAREIL 239


>UniRef50_A1HTJ5 Cluster: ATP:guanido phosphotransferase; n=1;
           Thermosinus carboxydivorans Nor1|Rep: ATP:guanido
           phosphotransferase - Thermosinus carboxydivorans Nor1
          Length = 360

 Score = 83.0 bits (196), Expect = 7e-15
 Identities = 49/150 (32%), Positives = 78/150 (52%), Gaps = 2/150 (1%)
 Frame = -3

Query: 625 RGIYHNENKTFLVWCNEEDHLRIISMQMGGDLQQVYKRLVSAVNEIEKKIPFSHHDRLGF 446
           R +   ++    +  NEEDHLRI  +  G +L    K      + IE +   +  +++G+
Sbjct: 105 RALIVRDDAAVSIMINEEDHLRIQCLAPGLNLNDALKCANKVDDAIEGRHDIAFSEQMGY 164

Query: 445 LTFCPTNLGTTVRAS--VHIXXXXXXXXXXXLEEVASKYHLQVRGTRGEHTEAEGGVYDI 272
           LT CPTNLGT +RAS  VH+           L   A++  L VRG  GE +EA G ++ I
Sbjct: 165 LTACPTNLGTGLRASVMVHLPALVLSGQINRLVTAATQLGLAVRGIYGEGSEAVGNIFQI 224

Query: 271 SNKRRMGLTEYDAVKEMYDGIAELIKIEKS 182
           SN+  +G  E + V+ +Y    +++  E+S
Sbjct: 225 SNQLTLGHGEQEIVENLYSVARQVVDHERS 254


>UniRef50_Q41AF9 Cluster: ATP:guanido phosphotransferase; n=1;
           Exiguobacterium sibiricum 255-15|Rep: ATP:guanido
           phosphotransferase - Exiguobacterium sibiricum 255-15
          Length = 357

 Score = 77.4 bits (182), Expect = 3e-13
 Identities = 42/149 (28%), Positives = 78/149 (52%), Gaps = 2/149 (1%)
 Frame = -3

Query: 622 GIYHNENKTFLVWCNEEDHLRIISMQMGGDLQQVYKRLVSAVNEIEKKIPFSHHDRLGFL 443
           G++ +E++   V  NEEDH RI ++  G  L++ ++        I ++   +  D LG+L
Sbjct: 99  GLFISEDEQISVMVNEEDHFRIQTLLPGLQLEEAFRVAKQVDRLISERFKIAFDDTLGYL 158

Query: 442 TFCPTNLGTTVRASV--HIXXXXXXXXXXXLEEVASKYHLQVRGTRGEHTEAEGGVYDIS 269
           T CP+N+GT +RASV  H+             +   +    +RG  GE ++A G ++ +S
Sbjct: 159 TTCPSNVGTGLRASVMLHLPGLVLTNQIQGYIKHLRQLGFAIRGRYGEGSDASGRMFQLS 218

Query: 268 NKRRMGLTEYDAVKEMYDGIAELIKIEKS 182
           N+R +G +E   + +    +  LI+ E++
Sbjct: 219 NQRTLGASEDMLITDYQFAVEALIEAEQA 247


>UniRef50_P91251 Cluster: Putative uncharacterized protein; n=1;
           Caenorhabditis elegans|Rep: Putative uncharacterized
           protein - Caenorhabditis elegans
          Length = 106

 Score = 75.4 bits (177), Expect = 1e-12
 Identities = 33/76 (43%), Positives = 55/76 (72%)
 Frame = -3

Query: 418 TTVRASVHIXXXXXXXXXXXLEEVASKYHLQVRGTRGEHTEAEGGVYDISNKRRMGLTEY 239
           T++++SVHI            +++ S+  LQ+RG  GE+++ + G+YDISNK+R+GLTEY
Sbjct: 24  TSLKSSVHIKLPKISAKDDF-KKICSEMKLQIRGIHGEYSDLKEGIYDISNKQRLGLTEY 82

Query: 238 DAVKEMYDGIAELIKI 191
            AV++MYDG+ +LI++
Sbjct: 83  QAVRQMYDGLKKLIEL 98


>UniRef50_UPI00015A66B5 Cluster: UPI00015A66B5 related cluster; n=3;
           Danio rerio|Rep: UPI00015A66B5 UniRef100 entry - Danio
           rerio
          Length = 375

 Score = 72.1 bits (169), Expect = 1e-11
 Identities = 43/154 (27%), Positives = 79/154 (51%), Gaps = 5/154 (3%)
 Frame = -3

Query: 643 RFWPTGRGIYHNENKTFLVWCNEEDHLRIISMQMGGDLQQVYKRLVSAVNEIE---KKI- 476
           R WP  R ++ +++ +  VW N EDHL+++S +    LQ+ +K +   V ++E   KK+ 
Sbjct: 205 RDWPDARALWSSKDGSLAVWVNMEDHLKLVSYRSDASLQEAFKTICINVQKLETLYKKLR 264

Query: 475 -PFSHHDRLGFLTFCPTNLGTTVRASVHIXXXXXXXXXXXLEEVASKYHLQVRGTRGEHT 299
             F     LG++   P  +GT ++ASV +           L+++  +  LQ+  T    +
Sbjct: 265 HTFIWKTHLGWVVSSPAEVGTGLKASVSV-NLLNLAKNKRLDDILDRLRLQMETT----S 319

Query: 298 EAEGGVYDISNKRRMGLTEYDAVKEMYDGIAELI 197
             + GVY ISN + +G+TE    + + DG+   +
Sbjct: 320 AGDPGVYKISNLQTIGVTEVGLTQLVVDGVVNAL 353


>UniRef50_A6LPN2 Cluster: ATP:guanido phosphotransferase; n=1;
           Clostridium beijerinckii NCIMB 8052|Rep: ATP:guanido
           phosphotransferase - Clostridium beijerinckii NCIMB 8052
          Length = 337

 Score = 72.1 bits (169), Expect = 1e-11
 Identities = 36/140 (25%), Positives = 75/140 (53%), Gaps = 2/140 (1%)
 Frame = -3

Query: 610 NENKTFLVWCNEEDHLRIISMQMGGDLQQVYKRLVSAVNEIEKKIPFSHHDRLGFLTFCP 431
           N+ +   +  NE+DH+ +  +  G  L+++++R     ++IE+   ++  + LG+LT  P
Sbjct: 97  NKEEDLSIMINEKDHINLQCVSDGLKLEEIFERATVIDDKIEENFDYAFDETLGYLTASP 156

Query: 430 TNLGTTVRASV--HIXXXXXXXXXXXLEEVASKYHLQVRGTRGEHTEAEGGVYDISNKRR 257
            N+GT ++ASV  H+           + +   K  + ++G   + T+  G +Y ISNK  
Sbjct: 157 ENIGTGMKASVVLHLPALSMSEEINNISKRLGKLGIAIKGVHLDGTKVFGNLYRISNKVS 216

Query: 256 MGLTEYDAVKEMYDGIAELI 197
           +GLTE + + ++ + +  +I
Sbjct: 217 LGLTEENIINKLKEAVWSII 236


>UniRef50_A6PV57 Cluster: ATP:guanido phosphotransferase; n=1;
           Victivallis vadensis ATCC BAA-548|Rep: ATP:guanido
           phosphotransferase - Victivallis vadensis ATCC BAA-548
          Length = 222

 Score = 70.5 bits (165), Expect = 4e-11
 Identities = 37/107 (34%), Positives = 62/107 (57%), Gaps = 2/107 (1%)
 Frame = -3

Query: 496 NEIEKKIPFSHHDRLGFLTFCPTNLGTTVRASV--HIXXXXXXXXXXXLEEVASKYHLQV 323
           +E+ +K+ ++  +RLGFLT CPTN+GT +RASV  H+             +  +K +L V
Sbjct: 17  DELGRKLDYAFDERLGFLTCCPTNVGTGMRASVMLHLPGLVMTGQIGPTIQGVNKLNLAV 76

Query: 322 RGTRGEHTEAEGGVYDISNKRRMGLTEYDAVKEMYDGIAELIKIEKS 182
           RG  GE T+  G ++ +SN+  +G +E   ++ +   I +LI  EK+
Sbjct: 77  RGIFGEGTDNRGNLFQVSNQSTLGESESQIIERLNMVIRQLISHEKN 123


>UniRef50_A7RG45 Cluster: Predicted protein; n=1; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 372

 Score = 68.1 bits (159), Expect = 2e-10
 Identities = 33/121 (27%), Positives = 60/121 (49%), Gaps = 5/121 (4%)
 Frame = -3

Query: 739 LTGMSKETQQQLIDDHFLFKEGDRFMQAANACRFWPTGRGIYHNENKTFLVWCNEEDHLR 560
           +  + +  Q+ L  ++ +       M  +   R WP  RGI+   +KTF+V  NE DHL+
Sbjct: 175 IVDLPESDQKHLTANNLMLVHNTPEMTCSERSRDWPDARGIFFTSDKTFVVHVNEADHLK 234

Query: 559 IISMQMGGDLQQVYKRLVSAVNEIEKKI-----PFSHHDRLGFLTFCPTNLGTTVRASVH 395
           +I    G DL   Y R    ++++E+++      F+  D LG++   P +LGT +   + 
Sbjct: 235 VICWSQGSDLFDTYDRFQRGLSQLEEELKQNDEEFALSDHLGYIVSDPRHLGTAMEVRMR 294

Query: 394 I 392
           +
Sbjct: 295 V 295


>UniRef50_Q8XHP0 Cluster: Putative ATP:guanido phosphotransferase
           CPE2442; n=3; Clostridium perfringens|Rep: Putative
           ATP:guanido phosphotransferase CPE2442 - Clostridium
           perfringens
          Length = 337

 Score = 65.3 bits (152), Expect = 2e-09
 Identities = 39/145 (26%), Positives = 71/145 (48%), Gaps = 2/145 (1%)
 Frame = -3

Query: 610 NENKTFLVWCNEEDHLRIISMQMGGDLQQVYKRLVSAVNEIEKKIPFSHHDRLGFLTFCP 431
           N+N  F +  NEE+H+ I     G  L++VY ++    + IE+KI +S    LG+LT   
Sbjct: 95  NKNGEFNILLNEEEHIGIECTNSGLSLREVYSKVDKLDDLIEEKIHYSFDSELGYLTSNI 154

Query: 430 TNLGTTVRASV--HIXXXXXXXXXXXLEEVASKYHLQVRGTRGEHTEAEGGVYDISNKRR 257
            NLGT +R  V  H+           ++    +  + ++       +  G +Y++SN + 
Sbjct: 155 KNLGTALRTKVFIHLPLLSSNNLIRIIKNALKEEGITLKSIYNSGNKDVGNIYEVSNIKT 214

Query: 256 MGLTEYDAVKEMYDGIAELIKIEKS 182
           +G++E D +  +     +LI  EK+
Sbjct: 215 LGMSEKDILDSLISITNKLILREKN 239


>UniRef50_Q1FFB3 Cluster: ATP:guanido phosphotransferase; n=1;
           Clostridium phytofermentans ISDg|Rep: ATP:guanido
           phosphotransferase - Clostridium phytofermentans ISDg
          Length = 207

 Score = 64.5 bits (150), Expect = 3e-09
 Identities = 36/110 (32%), Positives = 60/110 (54%), Gaps = 2/110 (1%)
 Frame = -3

Query: 622 GIYHNENKTFLVWCNEEDHLRIISMQMGGDLQQVYKRLVSAVNEIEKKIPFSHHDRLGFL 443
           G+  +E++   V  NEEDHLRI ++  G ++++ +       +   +++ +++ DR G+L
Sbjct: 96  GLIVSEDEGISVMVNEEDHLRIQAISSGMNMEKAFLDADRVDDFFSEQLGYAYDDRYGYL 155

Query: 442 TFCPTNLGTTVRAS--VHIXXXXXXXXXXXLEEVASKYHLQVRGTRGEHT 299
           T CPTN+GT +RAS  V +           L E   +Y  Q+RG  GE T
Sbjct: 156 TSCPTNVGTGLRASYMVFLPALNIAGKIEKLAEEIGRYGAQIRGIYGEGT 205


>UniRef50_UPI0000DB7740 Cluster: PREDICTED: similar to CG30274-PA;
           n=1; Apis mellifera|Rep: PREDICTED: similar to
           CG30274-PA - Apis mellifera
          Length = 482

 Score = 62.9 bits (146), Expect = 8e-09
 Identities = 40/158 (25%), Positives = 70/158 (44%), Gaps = 3/158 (1%)
 Frame = -3

Query: 643 RFWPTGRGIYHNENKTFLVWCNEEDHLRIISMQMG---GDLQQVYKRLVSAVNEIEKKIP 473
           + WP GRG+Y        +W N +DHLRI+S       G +   Y R+   +   + ++ 
Sbjct: 303 KHWPYGRGVYVASAGDLAIWVNVQDHLRIVSRTSDTRPGLIGHAYARMAKLMMVFDSRLK 362

Query: 472 FSHHDRLGFLTFCPTNLGTTVRASVHIXXXXXXXXXXXLEEVASKYHLQVRGTRGEHTEA 293
           F    +LGFL+  P  +G T+R +V I           L+ +     L +R T    T  
Sbjct: 363 FKRDRKLGFLSARPYAIGNTLRFNVLIRFPELSKEFDHLKHLCVVRGLSIRETVKRDT-- 420

Query: 292 EGGVYDISNKRRMGLTEYDAVKEMYDGIAELIKIEKSL 179
                 I N++ + +TE   +++    +  ++ +EK L
Sbjct: 421 ----VRIGNQQSLSITELQTLQDFSRAVLNVLALEKEL 454


>UniRef50_Q8MMD7 Cluster: CG30274-PA; n=4; Diptera|Rep: CG30274-PA -
           Drosophila melanogaster (Fruit fly)
          Length = 468

 Score = 61.3 bits (142), Expect = 2e-08
 Identities = 45/170 (26%), Positives = 76/170 (44%), Gaps = 8/170 (4%)
 Frame = -3

Query: 664 MQAANACRF----WPTGRGIYHNENKTFLVWCNEEDHLRIISMQMG---GDLQQVYKRLV 506
           +QAA +  F    WP GRG + N      VW N ++HLRIIS        D+   Y R+ 
Sbjct: 278 VQAAESTAFNGALWPYGRGAFVNSANNMAVWLNCQEHLRIISTTSSKEPADMGAAYTRVG 337

Query: 505 SAVNEIEKKIPFSHHDRLGFLTFCPTNLGTTVRASVHIXXXXXXXXXXXLEEVASKYHL- 329
            A+  +E ++ F     LG+L   P+ LGT ++ +  +           ++E+ +  HL 
Sbjct: 338 RAITYLETQLHFKESYLLGYLQSRPSYLGTGLKMTTIV------KLTNLMKEMDNLRHLC 391

Query: 328 QVRGTRGEHTEAEGGVYDISNKRRMGLTEYDAVKEMYDGIAELIKIEKSL 179
            VRG              + N + MG+ EY   ++    +  ++ +EK +
Sbjct: 392 SVRGLSMVTNRLSKLTVRLVNMQSMGVVEYVLFQDYCTAVTNILSLEKDM 441


>UniRef50_A7S2W4 Cluster: Predicted protein; n=1; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 261

 Score = 53.2 bits (122), Expect = 6e-06
 Identities = 32/121 (26%), Positives = 57/121 (47%), Gaps = 5/121 (4%)
 Frame = -3

Query: 739 LTGMSKETQQQLIDDHFLFKEGDRFMQAANACRFWPTGRGIYHNENKTFLVWCNEEDHLR 560
           L  +S +++  LI  H +F+      Q  +    W +GRGI+ +     +   NE +H+ 
Sbjct: 141 LARISSKSRDTLITKHGIFRN-----QKLDCDDTWSSGRGIWRDGTSNAIALVNEREHII 195

Query: 559 IISMQMGGDLQQVYKRLVSAVNEIEKKIPFSHHDRL-----GFLTFCPTNLGTTVRASVH 395
            ++ + GGDL   + R+   V   E  +  + H  +     GFL   P  +GT +R SV+
Sbjct: 196 FLTQEFGGDLCHAFYRMRDLVERTELALEKTGHKYMHSVVYGFLVSSPQEVGTGLRISVN 255

Query: 394 I 392
           +
Sbjct: 256 V 256


>UniRef50_Q73L28 Cluster: ATP:guanido phosphotransferase domain
           protein; n=1; Treponema denticola|Rep: ATP:guanido
           phosphotransferase domain protein - Treponema denticola
          Length = 357

 Score = 50.4 bits (115), Expect = 5e-05
 Identities = 38/150 (25%), Positives = 69/150 (46%), Gaps = 3/150 (2%)
 Frame = -3

Query: 625 RGIYHNENKTFLVWCNEEDHLRIISMQMGGDLQQVYKRLVSAVNEIEKKIPFSHHDRLGF 446
           + +  +EN +  +  N EDH+ I S   G D ++VY R      ++ +KI F+    LGF
Sbjct: 96  KAVLVHENGSLYIGLNLEDHINITSFAAGMDPEEVYARASFVELKMREKIKFAEDRDLGF 155

Query: 445 LTFCPTNLGTTVRASV--HIXXXXXXXXXXXLEEVASKYHLQVRGTRGEHTEAE-GGVYD 275
           LT     +GT ++ SV               + E+  + +L V G    ++++  G ++ 
Sbjct: 156 LTSNLMKIGTGLKFSVLCSFPGILYSNCLGSVLELTKQNNLNVAGYYSPNSKSSIGALFL 215

Query: 274 ISNKRRMGLTEYDAVKEMYDGIAELIKIEK 185
           ISN    G  E    ++    +  +I+IE+
Sbjct: 216 ISNAVSAGDNEEIQTEDFISCVNSIIEIER 245


>UniRef50_Q6MA01 Cluster: Putative arginine kinase; n=1; Candidatus
           Protochlamydia amoebophila UWE25|Rep: Putative arginine
           kinase - Protochlamydia amoebophila (strain UWE25)
          Length = 329

 Score = 49.6 bits (113), Expect = 8e-05
 Identities = 43/181 (23%), Positives = 75/181 (41%), Gaps = 2/181 (1%)
 Frame = -3

Query: 715 QQQLIDDHFLFKEGDRFMQAANACRFWPTGRGIYHNENKTFLVWCNEEDHLRIISMQMGG 536
           +++L+ +HFL  E   F QA        TG     + +  FL   N  DHL +  +    
Sbjct: 53  EKELLVEHFLTPES--FHQAN-------TGEAFVLDASGEFLAVFNLRDHLMLHWVDTKE 103

Query: 535 DLQQVYKRLVSAVNEIEKKIPFSHHDRLGFLTFCPTNLGT--TVRASVHIXXXXXXXXXX 362
           +L+  ++RLV     +   + F+   + GFLT  PT  GT   V   +H+          
Sbjct: 104 ELEGAWERLVKIETNLNNLVNFAFSSKFGFLTADPTRCGTGLIVTIFLHLPGLIYTNRLN 163

Query: 361 XLEEVASKYHLQVRGTRGEHTEAEGGVYDISNKRRMGLTEYDAVKEMYDGIAELIKIEKS 182
            + +      ++  G +G   E  G +    N   +G+TE + +  +     +L   EKS
Sbjct: 164 DVLQKDKDEGIEQTGLQGNPHEIIGDIVAFHNNYTLGMTEENIISSLRTLATKLALEEKS 223

Query: 181 L 179
           +
Sbjct: 224 V 224


>UniRef50_Q9Z7K4 Cluster: Putative ATP:guanido phosphotransferase
           CPn_0701/CP_0045/CPj0701/CpB0728; n=16;
           Chlamydiaceae|Rep: Putative ATP:guanido
           phosphotransferase CPn_0701/CP_0045/CPj0701/CpB0728 -
           Chlamydia pneumoniae (Chlamydophila pneumoniae)
          Length = 358

 Score = 47.6 bits (108), Expect = 3e-04
 Identities = 29/131 (22%), Positives = 55/131 (41%)
 Frame = -3

Query: 634 PTGRGIYHNENKTFLVWCNEEDHLRIISMQMGGDLQQVYKRLVSAVNEIEKKIPFSHHDR 455
           P G  +  + +  FL   N +DHL +  +   G++++   +LV   + +  K+ F+    
Sbjct: 99  PEGEALVVSRSGDFLAAINFQDHLVLHGIDFQGNVEKTLDQLVQLDSYLHSKLSFAFSSE 158

Query: 454 LGFLTFCPTNLGTTVRASVHIXXXXXXXXXXXLEEVASKYHLQVRGTRGEHTEAEGGVYD 275
            GFLT  P N GT +++   +              +  +  +         T   G +  
Sbjct: 159 FGFLTTNPKNCGTGLKSQCFLHIPALLYSKEFTNLIDEEVEIITSSLLLGVTGFPGNIVV 218

Query: 274 ISNKRRMGLTE 242
           +SN+  +GLTE
Sbjct: 219 LSNRCSLGLTE 229


>UniRef50_UPI0000F21069 Cluster: PREDICTED: similar to creatine
           kinase; n=1; Danio rerio|Rep: PREDICTED: similar to
           creatine kinase - Danio rerio
          Length = 296

 Score = 42.7 bits (96), Expect = 0.009
 Identities = 15/45 (33%), Positives = 28/45 (62%)
 Frame = -3

Query: 643 RFWPTGRGIYHNENKTFLVWCNEEDHLRIISMQMGGDLQQVYKRL 509
           R WP  R ++ +++ +  VW N EDHL+++S +    LQ+ +K +
Sbjct: 185 RDWPDARALWLSKDGSLAVWVNMEDHLKLVSYRSDASLQEAFKTI 229



 Score = 35.1 bits (77), Expect = 1.8
 Identities = 16/39 (41%), Positives = 26/39 (66%)
 Frame = -3

Query: 295 AEGGVYDISNKRRMGLTEYDAVKEMYDGIAELIKIEKSL 179
           ++ GVY ISN + +G+TE    + + DG+  LI++EK L
Sbjct: 244 SDPGVYKISNLQTIGVTEVGLTQLVVDGVKLLIRMEKRL 282


>UniRef50_UPI00006CC371 Cluster: ATP:guanido phosphotransferase,
           C-terminal catalytic domain containing protein; n=1;
           Tetrahymena thermophila SB210|Rep: ATP:guanido
           phosphotransferase, C-terminal catalytic domain
           containing protein - Tetrahymena thermophila SB210
          Length = 1237

 Score = 41.9 bits (94), Expect = 0.016
 Identities = 23/100 (23%), Positives = 45/100 (45%), Gaps = 1/100 (1%)
 Frame = -3

Query: 688 LFKEGDRFMQAANACRFWPTGRGIYHNENKTFLVWCNEEDHLRI-ISMQMGGDLQQVYKR 512
           L KE +  +++    R WP  R I  + NK +L+  N+EDH  +  S     +  +   +
Sbjct: 255 LIKESNALLRSGLRYREWPDSRSIAISNNKKYLIQVNKEDHFELKCSGTKELNFLEYLVQ 314

Query: 511 LVSAVNEIEKKIPFSHHDRLGFLTFCPTNLGTTVRASVHI 392
            +     ++K + F+   + GF T  P   G  ++  + +
Sbjct: 315 SIQITQLLDKHLGFNFDSKEGFTTVKPIYQGLALKFKIKV 354


>UniRef50_UPI00005A299A Cluster: PREDICTED: similar to low-density
           lipoprotein receptor-related protein 10 precursor; n=1;
           Canis lupus familiaris|Rep: PREDICTED: similar to
           low-density lipoprotein receptor-related protein 10
           precursor - Canis familiaris
          Length = 562

 Score = 40.7 bits (91), Expect = 0.037
 Identities = 18/46 (39%), Positives = 30/46 (65%)
 Frame = -3

Query: 316 TRGEHTEAEGGVYDISNKRRMGLTEYDAVKEMYDGIAELIKIEKSL 179
           T G  T A GGV+D+SN   +G +E + V+ + DG+  L+++E+ L
Sbjct: 310 TGGVDTAAVGGVFDVSNADHLGFSEVELVQMVVDGVKLLVEMEQWL 355


>UniRef50_A0DFG3 Cluster: Chromosome undetermined scaffold_49, whole
           genome shotgun sequence; n=1; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_49,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 984

 Score = 37.5 bits (83), Expect = 0.34
 Identities = 40/182 (21%), Positives = 73/182 (40%), Gaps = 9/182 (4%)
 Frame = -3

Query: 739 LTGMSKETQQQLIDDHFLFKEGDRFMQAAN----ACRF--WPTGRGIYHNENKTFLVWCN 578
           L+ M++E  ++L  +  LFK+ D      N      R   WP  R +  + +K  +VW N
Sbjct: 223 LSAMAQEDVRKLQINDKLFKKKDPNQAIINQIFKGLRHPDWPVDRMVLQSSDKQNIVWIN 282

Query: 577 EEDHLRIISMQM-GGDLQQVYKRLVSAVNEIEKKIPFSHHDRLGFLTFCP--TNLGTTVR 407
            EDHL+   + +    +             ++ K   S  D+ G+ T  P  + LG T  
Sbjct: 283 REDHLKFKFLNLEKTSIIDALDNCCKMNQYLDSKELVSFDDKFGYHTVKPQFSGLGLTFT 342

Query: 406 ASVHIXXXXXXXXXXXLEEVASKYHLQVRGTRGEHTEAEGGVYDISNKRRMGLTEYDAVK 227
               +              ++SK   +V   +   T+ +   + I ++R  GLT    V+
Sbjct: 343 LKFKLDQQSINKIKSNNNNLSSKIQNKVFNVQ---TKEKDKYFTIKSERCTGLTMKQYVE 399

Query: 226 EM 221
           ++
Sbjct: 400 QL 401


>UniRef50_Q9D1Z4 Cluster: Adult retina cDNA, RIKEN full-length
           enriched library, clone:A930016O22 product:hypothetical
           protein, full insert sequence; n=3; Murinae|Rep: Adult
           retina cDNA, RIKEN full-length enriched library,
           clone:A930016O22 product:hypothetical protein, full
           insert sequence - Mus musculus (Mouse)
          Length = 102

 Score = 37.1 bits (82), Expect = 0.46
 Identities = 21/42 (50%), Positives = 24/42 (57%)
 Frame = +3

Query: 186 FSILMSSAMPSYISLTASYSVSPMRRLLEMSYTPPSASVCSP 311
           FSI   S  PS  S T S S  P R  LEMS T P+A+V +P
Sbjct: 12  FSISTISFTPSTTSCTCSTSDEPSRSALEMSNTAPTAAVSTP 53


>UniRef50_Q8F905 Cluster: Putative uncharacterized protein; n=4;
           Leptospira|Rep: Putative uncharacterized protein -
           Leptospira interrogans
          Length = 266

 Score = 35.9 bits (79), Expect = 1.1
 Identities = 16/60 (26%), Positives = 36/60 (60%), Gaps = 1/60 (1%)
 Frame = -3

Query: 577 EEDHLRIISMQMGGDLQQVYKRLV-SAVNEIEKKIPFSHHDRLGFLTFCPTNLGTTVRAS 401
           +E+H+R     +   + ++++++  S + ++E +  F +   LG++T CPTN GT ++ S
Sbjct: 147 DEEHIRW--EVLASTVSELFRQIENSPLEKLENQNDFDYDPELGYVTSCPTNAGTGIKIS 204


>UniRef50_UPI0000EBCDFC Cluster: PREDICTED: hypothetical protein;
           n=1; Bos taurus|Rep: PREDICTED: hypothetical protein -
           Bos taurus
          Length = 1460

 Score = 34.7 bits (76), Expect = 2.4
 Identities = 16/33 (48%), Positives = 19/33 (57%)
 Frame = -2

Query: 524 GVQEAGERRQRDREEDPVLAPRPARLPHVLPDQ 426
           G+  A   + RDRE  P+L  RP  LPHV P Q
Sbjct: 452 GICNAPAVKMRDRESPPLLHSRPHLLPHVYPPQ 484


>UniRef50_Q99IE7 Cluster: Non-structural polyprotein p200 (p200)
           [Contains: Protease p150 (EC 3.4.22.-) (p150);
           RNA-directed RNA polymerase/triphosphatase/helicase p90
           (EC 2.7.7.48) (EC 3.6.1.15) (EC 3.6.1.-) (p90)]; n=113;
           root|Rep: Non-structural polyprotein p200 (p200)
           [Contains: Protease p150 (EC 3.4.22.-) (p150);
           RNA-directed RNA polymerase/triphosphatase/helicase p90
           (EC 2.7.7.48) (EC 3.6.1.15) (EC 3.6.1.-) (p90)] -
           Rubella virus (strain TO-336 vaccine) (RUBV)
          Length = 2116

 Score = 34.3 bits (75), Expect = 3.2
 Identities = 18/35 (51%), Positives = 20/35 (57%), Gaps = 1/35 (2%)
 Frame = -2

Query: 503 RRQRDREEDPV-LAPRPARLPHVLPDQPGHHGPRL 402
           R + D    P  LAPRPAR P VL   P H+GP L
Sbjct: 543 RARADTAAAPAPLAPRPARCPTVLYRHPAHYGPWL 577


>UniRef50_P26460 Cluster: Creatine kinase B-type; n=1; Squalus
           acanthias|Rep: Creatine kinase B-type - Squalus
           acanthias (Spiny dogfish)
          Length = 52

 Score = 34.3 bits (75), Expect = 3.2
 Identities = 12/24 (50%), Positives = 19/24 (79%)
 Frame = -3

Query: 463 HDRLGFLTFCPTNLGTTVRASVHI 392
           ++ LG++  CP+NLGT +RA VH+
Sbjct: 29  NEHLGYVLTCPSNLGTXLRAXVHV 52


>UniRef50_A0C4M0 Cluster: Chromosome undetermined scaffold_15, whole
            genome shotgun sequence; n=1; Paramecium tetraurelia|Rep:
            Chromosome undetermined scaffold_15, whole genome shotgun
            sequence - Paramecium tetraurelia
          Length = 3363

 Score = 33.5 bits (73), Expect = 5.6
 Identities = 12/27 (44%), Positives = 16/27 (59%)
 Frame = -3

Query: 622  GIYHNENKTFLVWCNEEDHLRIISMQM 542
            G YH++NK   VW   EDHL+    +M
Sbjct: 1054 GYYHDQNKNLCVWIKTEDHLKCSDYKM 1080


>UniRef50_Q4TDL5 Cluster: Chromosome undetermined SCAF6178, whole
           genome shotgun sequence; n=1; Tetraodon
           nigroviridis|Rep: Chromosome undetermined SCAF6178,
           whole genome shotgun sequence - Tetraodon nigroviridis
           (Green puffer)
          Length = 225

 Score = 33.1 bits (72), Expect = 7.4
 Identities = 14/47 (29%), Positives = 24/47 (51%), Gaps = 1/47 (2%)
 Frame = -2

Query: 545 DGRRPAAGVQEAGERRQRDREEDPVLAPRPARLPHVLP-DQPGHHGP 408
           DG RPA G +    +  +     P++  +P    H++P ++P  HGP
Sbjct: 35  DGNRPARGARLRPRKLHQHSHNIPLMGHQPPEFRHIIPYNRPHGHGP 81


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 508,410,184
Number of Sequences: 1657284
Number of extensions: 9114877
Number of successful extensions: 34606
Number of sequences better than 10.0: 60
Number of HSP's better than 10.0 without gapping: 33116
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 34514
length of database: 575,637,011
effective HSP length: 99
effective length of database: 411,565,895
effective search space used: 60911752460
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).