SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= cesb0024
         (892 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_Q9WR81 Cluster: Polyprotein; n=31; root|Rep: Polyprotei...   112   1e-23
UniRef50_Q9WR79 Cluster: Polyprotein; n=3; Bovine viral diarrhea...   112   1e-23
UniRef50_Q7RJC6 Cluster: Ubiquitin; n=1; Plasmodium yoelii yoeli...   112   1e-23
UniRef50_UPI000155314F Cluster: PREDICTED: similar to ubiquitin ...   110   4e-23
UniRef50_A0PDJ3 Cluster: Polyprotein; n=65; root|Rep: Polyprotei...   110   4e-23
UniRef50_UPI00006CFD8F Cluster: Ubiquitin family protein; n=1; T...   109   1e-22
UniRef50_A0CI21 Cluster: Chromosome undetermined scaffold_187, w...   107   3e-22
UniRef50_A6SBB4 Cluster: 60S ribosomal protein L40; n=1; Botryot...   107   3e-22
UniRef50_Q0WRN6 Cluster: Polyubiquitin 4 UBQ4; n=6; Eukaryota|Re...   106   7e-22
UniRef50_A2YRX2 Cluster: Putative uncharacterized protein; n=2; ...   105   2e-21
UniRef50_Q9FWV0 Cluster: Putative ubiquitin/ribosomal protein S2...   103   6e-21
UniRef50_Q868B2 Cluster: Polyubiquitin; n=3; Eukaryota|Rep: Poly...   103   8e-21
UniRef50_A1TWA7 Cluster: Ubiquitin precursor; n=1; Acidovorax av...   101   2e-20
UniRef50_Q9E2W4 Cluster: Polyprotein; n=1; Bovine viral diarrhea...   100   6e-20
UniRef50_Q7XBP6 Cluster: Ubiquitin/ribosomal protein P1 fusion; ...   100   6e-20
UniRef50_Q91BI7 Cluster: Ubiquitin GP37 fusion protein; n=2; Spo...    96   9e-19
UniRef50_Q5D8K9 Cluster: SJCHGC02785 protein; n=1; Schistosoma j...    96   1e-18
UniRef50_Q6WMU7 Cluster: Ubiquitin-like protein Ublp94.4; n=1; A...    92   2e-17
UniRef50_P62979 Cluster: 40S ribosomal protein S27a; n=188; root...    91   3e-17
UniRef50_Q9SYE9 Cluster: F15I1.1 protein; n=1; Arabidopsis thali...    89   1e-16
UniRef50_Q7XB26 Cluster: Ubiquitin/actin fusion protein 4; n=1; ...    89   2e-16
UniRef50_P16709 Cluster: Ubiquitin-like protein precursor; n=19;...    87   6e-16
UniRef50_Q9YMT1 Cluster: Viral ubiquitin; n=1; Lymantria dispar ...    85   2e-15
UniRef50_UPI000155E27A Cluster: PREDICTED: similar to ubiquitin ...    84   5e-15
UniRef50_UPI0000DA4142 Cluster: PREDICTED: similar to ribosomal ...    83   9e-15
UniRef50_Q8IM64 Cluster: Ribosomal S27a, putative; n=6; Plasmodi...    82   2e-14
UniRef50_Q22T79 Cluster: Ubiquitin family protein; n=1; Tetrahym...    81   4e-14
UniRef50_Q9SHE7 Cluster: NEDD8-like protein RUB1 precursor; n=19...    79   2e-13
UniRef50_UPI0000ECA612 Cluster: UPI0000ECA612 related cluster; n...    78   3e-13
UniRef50_Q6ZCA5 Cluster: Monoubiquitin/carboxy-extension protein...    75   2e-12
UniRef50_Q9VJ33 Cluster: NEDD8 precursor; n=546; root|Rep: NEDD8...    75   2e-12
UniRef50_Q0V3T0 Cluster: Putative uncharacterized protein; n=1; ...    75   3e-12
UniRef50_Q4Q216 Cluster: Ubiquitin/ribosomal protein S27a, putat...    74   4e-12
UniRef50_Q9SYF2 Cluster: F15I1.4 protein; n=4; Arabidopsis thali...    73   1e-11
UniRef50_Q15843 Cluster: NEDD8 precursor; n=1233; root|Rep: NEDD...    73   1e-11
UniRef50_A2YRX0 Cluster: Putative uncharacterized protein; n=1; ...    72   2e-11
UniRef50_Q5CQW0 Cluster: Ribosomal protein S27a, ubiquitin plus ...    72   2e-11
UniRef50_Q9FWU7 Cluster: Putative polyubiquitin; n=3; Oryza sati...    71   3e-11
UniRef50_UPI00005A2EE8 Cluster: PREDICTED: similar to ubiquitin ...    71   4e-11
UniRef50_Q6A1P6 Cluster: Putative uncharacterized protein; n=1; ...    71   5e-11
UniRef50_Q236S9 Cluster: Ubiquitin family protein; n=2; Alveolat...    70   7e-11
UniRef50_Q54V68 Cluster: Putative uncharacterized protein; n=3; ...    69   2e-10
UniRef50_A6RQL0 Cluster: Ubiquitin; n=2; Sclerotiniaceae|Rep: Ub...    68   3e-10
UniRef50_Q00UH7 Cluster: Polyubiquitin 2; n=1; Ostreococcus taur...    67   5e-10
UniRef50_Q4U8U0 Cluster: S27 ribosomal protein, putative; n=3; P...    66   1e-09
UniRef50_O44819 Cluster: Putative uncharacterized protein; n=1; ...    66   1e-09
UniRef50_Q5MGJ9 Cluster: Ribosomal protein 3; n=1; Lonomia obliq...    65   2e-09
UniRef50_Q0C9H7 Cluster: Putative uncharacterized protein; n=1; ...    64   5e-09
UniRef50_A2EJ38 Cluster: Ubiquitin family protein; n=4; Trichomo...    63   8e-09
UniRef50_Q99351 Cluster: D.melanogaster polytene; n=5; Drosophil...    62   1e-08
UniRef50_A2FSJ6 Cluster: Ubiquitin family protein; n=2; Trichomo...    62   1e-08
UniRef50_Q5X991 Cluster: BUBL1 protein; n=2; Paramecium tetraure...    62   2e-08
UniRef50_A7APS7 Cluster: Ubiquitin family protein; n=1; Babesia ...    62   2e-08
UniRef50_Q2HDX3 Cluster: Putative uncharacterized protein; n=1; ...    62   2e-08
UniRef50_UPI0000D56A31 Cluster: PREDICTED: similar to CG15771-PA...    61   3e-08
UniRef50_UPI00006CB3CF Cluster: Ubiquitin family protein; n=1; T...    61   3e-08
UniRef50_UPI00006CAF49 Cluster: Ribosomal protein S27a containin...    61   3e-08
UniRef50_A0C9Z8 Cluster: Chromosome undetermined scaffold_160, w...    61   3e-08
UniRef50_A2Q424 Cluster: Ubiquitin; TRAF-like; n=2; Medicago tru...    60   6e-08
UniRef50_UPI0000E475A1 Cluster: PREDICTED: similar to ubiquitin;...    60   1e-07
UniRef50_A4VDK0 Cluster: Putative uncharacterized protein; n=1; ...    60   1e-07
UniRef50_Q7T2M6 Cluster: Ubquitin-like protein 1; n=1; Carassius...    59   1e-07
UniRef50_Q54V65 Cluster: Putative uncharacterized protein; n=1; ...    59   1e-07
UniRef50_Q5KK31 Cluster: Ribosomal chaperone, putative; n=1; Fil...    59   1e-07
UniRef50_Q03919 Cluster: NEDD8-like protein RUB1 precursor; n=8;...    59   1e-07
UniRef50_Q013L7 Cluster: Glucose-repressible alcohol dehydrogena...    59   2e-07
UniRef50_A7F3U9 Cluster: Putative uncharacterized protein; n=1; ...    58   3e-07
UniRef50_Q7T2M5 Cluster: Ubquitin-like protein 2; n=8; Clupeocep...    57   5e-07
UniRef50_A0C4L4 Cluster: Chromosome undetermined scaffold_15, wh...    57   7e-07
UniRef50_UPI0000604492 Cluster: PREDICTED: similar to ubiquitin ...    56   1e-06
UniRef50_Q91890 Cluster: Ubiquitin-like fusion protein; n=6; Eum...    56   1e-06
UniRef50_Q4MZU6 Cluster: Putative uncharacterized protein; n=1; ...    56   1e-06
UniRef50_Q4UDK2 Cluster: Ubiquitin,putative; n=2; Theileria|Rep:...    55   2e-06
UniRef50_Q4CNV2 Cluster: Ubiquitin, putative; n=2; Trypanosoma|R...    55   2e-06
UniRef50_A2FER2 Cluster: Ubiquitin family protein; n=3; Trichomo...    55   2e-06
UniRef50_Q4RSW8 Cluster: Chromosome 12 SCAF14999, whole genome s...    55   3e-06
UniRef50_UPI0000498E95 Cluster: 40S ribosomal protein S27a; n=1;...    53   1e-05
UniRef50_UPI000023DB70 Cluster: hypothetical protein FG00163.1; ...    53   1e-05
UniRef50_Q22X50 Cluster: Ubiquitin family protein; n=2; Tetrahym...    52   1e-05
UniRef50_A2ECR8 Cluster: Ubiquitin family protein; n=1; Trichomo...    52   1e-05
UniRef50_UPI0000D56CAF Cluster: PREDICTED: similar to AN1, ubiqu...    52   2e-05
UniRef50_Q06Z45 Cluster: Interferon stimulated gene 15; n=1; Gad...    52   2e-05
UniRef50_Q9FH07 Cluster: Arabidopsis thaliana genomic DNA, chrom...    52   2e-05
UniRef50_Q54MD2 Cluster: Putative uncharacterized protein; n=3; ...    52   2e-05
UniRef50_O13255 Cluster: 2',5'-oligo adenylate synthetase A; n=1...    52   3e-05
UniRef50_A2Z8U3 Cluster: Putative uncharacterized protein; n=1; ...    51   3e-05
UniRef50_A0E5Z2 Cluster: Chromosome undetermined scaffold_8, who...    51   3e-05
UniRef50_Q7XDE7 Cluster: Ubiquitin family protein, expressed; n=...    51   5e-05
UniRef50_Q4UIY1 Cluster: Ubiquitin-related chaperonin, putative;...    51   5e-05
UniRef50_A0BZP2 Cluster: Chromosome undetermined scaffold_14, wh...    51   5e-05
UniRef50_Q5C0U3 Cluster: SJCHGC08803 protein; n=1; Schistosoma j...    50   6e-05
UniRef50_P11441 Cluster: Ubiquitin-like protein 4A; n=32; Eutele...    50   6e-05
UniRef50_A7R2A7 Cluster: Chromosome undetermined scaffold_411, w...    50   8e-05
UniRef50_A2ESV4 Cluster: Ubiquitin family protein; n=1; Trichomo...    50   8e-05
UniRef50_Q86XD8 Cluster: AN1-type zinc finger and ubiquitin doma...    50   8e-05
UniRef50_UPI0001554F34 Cluster: PREDICTED: similar to AN1, ubiqu...    50   1e-04
UniRef50_Q9VEP9 Cluster: CG16941-PA; n=7; Endopterygota|Rep: CG1...    50   1e-04
UniRef50_A0C2N0 Cluster: Chromosome undetermined scaffold_145, w...    50   1e-04
UniRef50_Q84UT7 Cluster: Calreticulin interacted protein; n=7; O...    49   1e-04
UniRef50_Q4Q2Y8 Cluster: Ubiquitin-like protein; n=3; Leishmania...    49   1e-04
UniRef50_Q7QYQ3 Cluster: GLP_393_14301_14531; n=1; Giardia lambl...    49   2e-04
UniRef50_Q96T88 Cluster: E3 ubiquitin-protein ligase UHRF1; n=44...    49   2e-04
UniRef50_Q4SKY0 Cluster: Chromosome 17 SCAF14563, whole genome s...    48   2e-04
UniRef50_Q23CW9 Cluster: Putative uncharacterized protein; n=1; ...    48   2e-04
UniRef50_A2G7G9 Cluster: Ubiquitin family protein; n=1; Trichomo...    48   2e-04
UniRef50_P48510 Cluster: Ubiquitin domain-containing protein DSK...    48   2e-04
UniRef50_P91057 Cluster: Putative uncharacterized protein; n=1; ...    48   3e-04
UniRef50_Q33AC4 Cluster: Protein kinase domain containing protei...    48   4e-04
UniRef50_Q4P3T5 Cluster: Putative uncharacterized protein; n=1; ...    48   4e-04
UniRef50_A4RK10 Cluster: Putative uncharacterized protein; n=1; ...    48   4e-04
UniRef50_Q7SZF4 Cluster: HLA-B-associated transcript 3; n=5; Dan...    47   6e-04
UniRef50_Q4UC28 Cluster: Putative uncharacterized protein; n=1; ...    47   6e-04
UniRef50_Q0DJQ4 Cluster: Os05g0242100 protein; n=3; Oryza sativa...    47   7e-04
UniRef50_Q4YYI6 Cluster: Ubiquitin-like protein, putative; n=3; ...    47   7e-04
UniRef50_A7ASK4 Cluster: Ubiquitin domain containing protein fam...    47   7e-04
UniRef50_Q5KMP1 Cluster: Putative uncharacterized protein; n=1; ...    47   7e-04
UniRef50_O15205 Cluster: Ubiquitin D; n=18; Eutheria|Rep: Ubiqui...    47   7e-04
UniRef50_Q6C7B6 Cluster: Similar to sp|P48510 Saccharomyces cere...    46   0.001
UniRef50_A0RUP3 Cluster: Ribosomal protein S27AE; n=1; Cenarchae...    46   0.001
UniRef50_Q9SU29 Cluster: Polyubiquitin-like protein; n=2; core e...    46   0.001
UniRef50_Q7XD49 Cluster: Putative uncharacterized protein; n=4; ...    46   0.001
UniRef50_Q95TI4 Cluster: SD01679p; n=10; Endopterygota|Rep: SD01...    46   0.001
UniRef50_Q17E87 Cluster: Putative uncharacterized protein; n=1; ...    46   0.001
UniRef50_Q55K49 Cluster: Putative uncharacterized protein; n=2; ...    46   0.001
UniRef50_Q07371 Cluster: Ubiquitin-like protein 1; n=1; Caenorha...    46   0.001
UniRef50_Q9NIF3 Cluster: Ubiquitin-like fusion protein SonA; n=2...    46   0.002
UniRef50_Q2HT46 Cluster: HECT; Ubiquitin; n=2; Medicago truncatu...    45   0.002
UniRef50_Q4H2N4 Cluster: Ci-UHRF2 protein; n=3; Deuterostomia|Re...    45   0.002
UniRef50_A5AB45 Cluster: Remark: Dsk2p is a nuclear-enriched pro...    45   0.002
UniRef50_UPI0000E46F9B Cluster: PREDICTED: similar to Chain A, S...    45   0.003
UniRef50_A6N155 Cluster: Polyubiquitin containing 7 ubiquitin mo...    45   0.003
UniRef50_A0DYM1 Cluster: Chromosome undetermined scaffold_7, who...    45   0.003
UniRef50_Q2UTN9 Cluster: Nucleotide excision repair factor NEF2;...    45   0.003
UniRef50_UPI00015B5086 Cluster: PREDICTED: similar to ENSANGP000...    44   0.004
UniRef50_UPI0001554645 Cluster: PREDICTED: similar to Parkinson ...    44   0.004
UniRef50_UPI000065FB66 Cluster: E3 ubiquitin-protein ligase UHRF...    44   0.004
UniRef50_A0E6I1 Cluster: Chromosome undetermined scaffold_8, who...    44   0.004
UniRef50_Q8SUA1 Cluster: Putative uncharacterized protein ECU10_...    44   0.004
UniRef50_Q5CR28 Cluster: DSK2 like protein with a ubiquitin doma...    44   0.005
UniRef50_Q55DZ2 Cluster: Putative uncharacterized protein; n=1; ...    44   0.005
UniRef50_Q54L35 Cluster: Putative uncharacterized protein; n=1; ...    44   0.005
UniRef50_A7STF8 Cluster: Predicted protein; n=1; Nematostella ve...    44   0.005
UniRef50_A5K4E9 Cluster: Ubiquitin domain containing protein; n=...    44   0.005
UniRef50_Q15646 Cluster: 59 kDa 2'-5'-oligoadenylate synthetase-...    44   0.005
UniRef50_UPI0000E495BE Cluster: PREDICTED: similar to polyubiqui...    44   0.007
UniRef50_UPI0000D55C1D Cluster: PREDICTED: similar to HLA-B-asso...    44   0.007
UniRef50_Q9YHD3 Cluster: Scythe; n=6; Xenopus|Rep: Scythe - Xeno...    44   0.007
UniRef50_A7RYS4 Cluster: Predicted protein; n=1; Nematostella ve...    44   0.007
UniRef50_A2FA32 Cluster: Ubiquitin family protein; n=11; Trichom...    44   0.007
UniRef50_A0E2Q5 Cluster: Chromosome undetermined scaffold_75, wh...    44   0.007
UniRef50_Q4PG40 Cluster: Putative uncharacterized protein; n=1; ...    44   0.007
UniRef50_Q54TK0 Cluster: Putative uncharacterized protein; n=1; ...    43   0.009
UniRef50_Q6MVN0 Cluster: Related to ubiquitin-like protein DSK2;...    43   0.009
UniRef50_Q6M029 Cluster: 30S ribosomal protein S27ae; n=6; Eurya...    43   0.009
UniRef50_UPI0001554DB9 Cluster: PREDICTED: similar to inhibitor ...    43   0.012
UniRef50_UPI0000D554E4 Cluster: PREDICTED: similar to CG16941-PA...    43   0.012
UniRef50_Q53MR5 Cluster: Ubiquitin family, putative; n=2; Oryza ...    43   0.012
UniRef50_O60260 Cluster: Parkin; n=71; Eumetazoa|Rep: Parkin - H...    43   0.012
UniRef50_UPI0000D557CB Cluster: PREDICTED: similar to ubiquitin-...    42   0.016
UniRef50_Q10S80 Cluster: Ubiquitin family protein, expressed; n=...    42   0.016
UniRef50_A2EN73 Cluster: Ubiquitin family protein; n=1; Trichomo...    42   0.016
UniRef50_Q553G0 Cluster: Putative uncharacterized protein; n=2; ...    42   0.021
UniRef50_P91052 Cluster: Putative uncharacterized protein; n=2; ...    42   0.021
UniRef50_A2DY94 Cluster: Ubiquitin family protein; n=1; Trichomo...    42   0.021
UniRef50_A0BIE9 Cluster: Chromosome undetermined scaffold_11, wh...    42   0.021
UniRef50_Q0U9Z4 Cluster: Predicted protein; n=1; Phaeosphaeria n...    42   0.021
UniRef50_UPI0001509B75 Cluster: Ubiquitin family protein; n=1; T...    42   0.028
UniRef50_UPI00004985B5 Cluster: hypothetical protein 103.t00036;...    42   0.028
UniRef50_Q10NT3 Cluster: Expressed protein; n=3; Oryza sativa|Re...    42   0.028
UniRef50_Q8I2T2 Cluster: Ubiquitin-like protein, putative; n=2; ...    42   0.028
UniRef50_Q54QA5 Cluster: Putative uncharacterized protein; n=1; ...    42   0.028
UniRef50_A5K6T6 Cluster: Ubiquitin-like protein, putative; n=1; ...    42   0.028
UniRef50_A2G7G2 Cluster: Ubiquitin family protein; n=1; Trichomo...    42   0.028
UniRef50_A2F4J1 Cluster: Ubiquitin family protein; n=1; Trichomo...    42   0.028
UniRef50_UPI0000F2EC07 Cluster: PREDICTED: similar to interferon...    41   0.037
UniRef50_UPI0000DB7798 Cluster: PREDICTED: similar to ubiquitin-...    41   0.049
UniRef50_UPI000058738C Cluster: PREDICTED: hypothetical protein;...    41   0.049
UniRef50_A2EDJ2 Cluster: Ribosomal protein S27a, putative; n=5; ...    41   0.049
UniRef50_A4RL24 Cluster: Putative uncharacterized protein; n=1; ...    41   0.049
UniRef50_A7DS39 Cluster: Ribosomal protein S27a; n=1; Candidatus...    41   0.049
UniRef50_Q19KS6 Cluster: Ubiquitin-like protein 4B; n=1; Monodel...    41   0.049
UniRef50_UPI000051618B Cluster: PREDICTED: similar to CG7215-PA,...    40   0.064
UniRef50_Q5J4W3 Cluster: Parkin; n=3; Tetraodontidae|Rep: Parkin...    40   0.064
UniRef50_Q7XCL2 Cluster: Ubiquitin family protein, expressed; n=...    40   0.064
UniRef50_Q2QU13 Cluster: Ubiquitin family protein, expressed; n=...    40   0.064
UniRef50_A3BRN9 Cluster: Putative uncharacterized protein; n=3; ...    40   0.064
UniRef50_A2XN69 Cluster: Putative uncharacterized protein; n=2; ...    40   0.064
UniRef50_Q554E9 Cluster: Putative uncharacterized protein; n=2; ...    40   0.064
UniRef50_Q54LV1 Cluster: RepC-binding protein A; n=2; Dictyostel...    40   0.064
UniRef50_A7T1V0 Cluster: Predicted protein; n=1; Nematostella ve...    40   0.064
UniRef50_Q5KN72 Cluster: Uv excision repair protein rhp23, putat...    40   0.064
UniRef50_A1CUI4 Cluster: Ubiquitin-like protein DskB, putative; ...    40   0.064
UniRef50_Q0P460 Cluster: Zgc:153389; n=3; Danio rerio|Rep: Zgc:1...    40   0.085
UniRef50_A7QUN3 Cluster: Chromosome chr10 scaffold_179, whole ge...    40   0.085
UniRef50_A2Q1T1 Cluster: Ubiquitin; n=1; Medicago truncatula|Rep...    40   0.085
UniRef50_Q7QWK0 Cluster: GLP_538_1417_1800; n=1; Giardia lamblia...    40   0.085
UniRef50_A7AVL0 Cluster: Ubiquitin family domain containing prot...    40   0.085
UniRef50_A2G7U9 Cluster: Ubiquitin family protein; n=1; Trichomo...    40   0.085
UniRef50_A2DZ98 Cluster: Ubiquitin family protein; n=1; Trichomo...    40   0.085
UniRef50_A0DJC7 Cluster: Chromosome undetermined scaffold_53, wh...    40   0.085
UniRef50_A7QS28 Cluster: Chromosome undetermined scaffold_155, w...    40   0.11 
UniRef50_Q56J89 Cluster: RAD23B-like protein; n=1; Adineta ricci...    40   0.11 
UniRef50_Q386A3 Cluster: Ubiquitin-like protein, putative; n=1; ...    40   0.11 
UniRef50_A2E296 Cluster: Ubiquitin family protein; n=1; Trichomo...    40   0.11 
UniRef50_A7FA67 Cluster: Putative uncharacterized protein; n=1; ...    40   0.11 
UniRef50_Q96PU4 Cluster: E3 ubiquitin-protein ligase UHRF2; n=26...    40   0.11 
UniRef50_UPI0000DB7150 Cluster: PREDICTED: similar to HLA-B-asso...    39   0.15 
UniRef50_A7QF39 Cluster: Chromosome chr16 scaffold_86, whole gen...    39   0.15 
UniRef50_A7P609 Cluster: Chromosome chr4 scaffold_6, whole genom...    39   0.15 
UniRef50_Q86Q31 Cluster: Scythe-like protein; n=1; Hydra vulgari...    39   0.15 
UniRef50_Q4T7D6 Cluster: Chromosome undetermined SCAF8128, whole...    39   0.20 
UniRef50_Q9ZT95 Cluster: Putative ubiquitin-like protein; n=2; A...    39   0.20 
UniRef50_Q0KIL5 Cluster: Putative uncharacterized protein; n=1; ...    39   0.20 
UniRef50_Q9VWD9 Cluster: CG14224-PA; n=4; Endopterygota|Rep: CG1...    39   0.20 
UniRef50_Q0W6G3 Cluster: 30S ribosomal protein S27AE; n=2; Eurya...    39   0.20 
UniRef50_O74803 Cluster: UV excision repair protein rhp23; n=1; ...    39   0.20 
UniRef50_UPI000023F381 Cluster: hypothetical protein FG08156.1; ...    38   0.26 
UniRef50_Q4RRW6 Cluster: Chromosome 7 SCAF15001, whole genome sh...    38   0.26 
UniRef50_Q9FY57 Cluster: Putative uncharacterized protein T5K6_7...    38   0.26 
UniRef50_Q5JNE7 Cluster: Putative uncharacterized protein P0435H...    38   0.26 
UniRef50_A2EJ41 Cluster: Ubiquitin family protein; n=1; Trichomo...    38   0.26 
UniRef50_Q8N7F7 Cluster: Ubiquitin-like protein 4B; n=9; Eutheri...    38   0.26 
UniRef50_Q15459 Cluster: Splicing factor 3 subunit 1; n=43; Coel...    38   0.26 
UniRef50_P54725 Cluster: UV excision repair protein RAD23 homolo...    38   0.26 
UniRef50_UPI00015B5080 Cluster: PREDICTED: similar to NP95; n=1;...    38   0.34 
UniRef50_Q8LF25 Cluster: DNA-damage inducible protein DDI1-like;...    38   0.34 
UniRef50_P91055 Cluster: Putative uncharacterized protein; n=1; ...    38   0.34 
UniRef50_A0BMS1 Cluster: Chromosome undetermined scaffold_117, w...    38   0.34 
UniRef50_Q4PEX0 Cluster: Putative uncharacterized protein; n=1; ...    38   0.34 
UniRef50_Q10169 Cluster: Deubiquitination-protection protein dph...    38   0.34 
UniRef50_UPI0000498B1D Cluster: ubiquitin-like protein; n=1; Ent...    38   0.45 
UniRef50_Q015S3 Cluster: Ubiquitin-conjugating enzyme 9 homolog;...    38   0.45 
UniRef50_O03991 Cluster: RAD23 protein, isoform II; n=1; Daucus ...    38   0.45 
UniRef50_Q8IAZ4 Cluster: Putative uncharacterized protein PF08_0...    38   0.45 
UniRef50_Q7PRQ2 Cluster: ENSANGP00000017457; n=1; Anopheles gamb...    38   0.45 
UniRef50_O44820 Cluster: Putative uncharacterized protein; n=2; ...    38   0.45 
UniRef50_A6S9G3 Cluster: Putative uncharacterized protein; n=2; ...    38   0.45 
UniRef50_A6S7C5 Cluster: Predicted protein; n=2; Sclerotiniaceae...    38   0.45 
UniRef50_Q8WUN7 Cluster: Ubiquitin domain-containing protein 2; ...    38   0.45 
UniRef50_Q3ECA5 Cluster: Uncharacterized protein At1g79650.3; n=...    37   0.60 
UniRef50_Q173F1 Cluster: Ubiquilin 1,2; n=5; Neoptera|Rep: Ubiqu...    37   0.60 
UniRef50_A7RES3 Cluster: Predicted protein; n=3; Nematostella ve...    37   0.60 
UniRef50_A0CBZ8 Cluster: Chromosome undetermined scaffold_166, w...    37   0.60 
UniRef50_Q6C8W3 Cluster: Similar to sp|O74803 Schizosaccharomyce...    37   0.60 
UniRef50_Q5KCT4 Cluster: Putative uncharacterized protein; n=1; ...    37   0.60 
UniRef50_Q8TVD7 Cluster: 30S ribosomal protein S27ae; n=21; Eury...    37   0.60 
UniRef50_P32628 Cluster: UV excision repair protein RAD23; n=4; ...    37   0.60 
UniRef50_Q54JB0 Cluster: Putative uncharacterized protein; n=1; ...    37   0.79 
UniRef50_Q174A3 Cluster: Ubiquitin conjugating enzyme 7 interact...    37   0.79 
UniRef50_A6ND44 Cluster: Uncharacterized protein UBQLN4; n=2; Ho...    37   0.79 
UniRef50_Q6CAG8 Cluster: Yarrowia lipolytica chromosome D of str...    37   0.79 
UniRef50_Q9NRR5 Cluster: Ubiquilin-4; n=19; Theria|Rep: Ubiquili...    37   0.79 
UniRef50_Q9H347 Cluster: Ubiquilin-3; n=10; Theria|Rep: Ubiquili...    37   0.79 
UniRef50_A7PXI1 Cluster: Chromosome chr12 scaffold_36, whole gen...    36   1.0  
UniRef50_A0DWV1 Cluster: Chromosome undetermined scaffold_67, wh...    36   1.0  
UniRef50_A2AB51 Cluster: HLA-B associated transcript 3; n=36; Eu...    36   1.0  
UniRef50_Q92353 Cluster: Ubiquitin carboxyl-terminal hydrolase 6...    36   1.0  
UniRef50_P61240 Cluster: 30S ribosomal protein S27ae; n=2; Archa...    36   1.0  
UniRef50_P46379 Cluster: Large proline-rich protein BAT3; n=108;...    36   1.0  
UniRef50_UPI00003633B7 Cluster: Ubiquilin-4 (Ataxin-1 ubiquitin-...    36   1.4  
UniRef50_Q4T158 Cluster: Chromosome 21 SCAF10714, whole genome s...    36   1.4  
UniRef50_Q8VWY0 Cluster: Ubiquitin-like protein; n=1; Cucumis sa...    36   1.4  
UniRef50_UPI0000EBE1A5 Cluster: PREDICTED: similar to LOC512938 ...    36   1.8  
UniRef50_Q5BXC3 Cluster: SJCHGC06167 protein; n=2; Schistosoma j...    36   1.8  
UniRef50_Q17JC6 Cluster: Uv excision repair protein rad23; n=1; ...    36   1.8  
UniRef50_A2F733 Cluster: Ubiquitin family protein; n=1; Trichomo...    36   1.8  
UniRef50_Q8SV38 Cluster: Putative uncharacterized protein ECU07_...    36   1.8  
UniRef50_UPI0000E47B82 Cluster: PREDICTED: hypothetical protein,...    35   2.4  
UniRef50_Q4Q222 Cluster: Ubiquitin-like protein, putative; n=4; ...    35   2.4  
UniRef50_A7SRL4 Cluster: Predicted protein; n=1; Nematostella ve...    35   2.4  
UniRef50_Q2FS44 Cluster: Ribosomal protein S27a; n=2; Methanomic...    35   2.4  
UniRef50_UPI00015A6B69 Cluster: hypothetical protein LOC445284; ...    35   3.2  
UniRef50_Q6AXI3 Cluster: Zgc:92001; n=10; Coelomata|Rep: Zgc:920...    35   3.2  
UniRef50_A5B3W2 Cluster: Putative uncharacterized protein; n=1; ...    35   3.2  
UniRef50_Q201W5 Cluster: Putative RAD23-like B; n=2; Neoptera|Re...    35   3.2  
UniRef50_Q6BXC6 Cluster: Debaryomyces hansenii chromosome B of s...    35   3.2  
UniRef50_UPI0000585D05 Cluster: PREDICTED: similar to parkin; n=...    34   4.2  
UniRef50_Q9XZE0 Cluster: DHR23; n=5; Sophophora|Rep: DHR23 - Dro...    34   4.2  
UniRef50_Q1ZXM9 Cluster: Ubiquitin domain-containing protein; n=...    34   4.2  
UniRef50_A7SV03 Cluster: Predicted protein; n=1; Nematostella ve...    34   4.2  
UniRef50_Q4T4S5 Cluster: Chromosome undetermined SCAF9556, whole...    34   5.6  
UniRef50_Q2QU15 Cluster: Expressed protein; n=3; Oryza sativa|Re...    34   5.6  
UniRef50_Q8SU87 Cluster: Putative uncharacterized protein ECU11_...    34   5.6  
UniRef50_Q67W65 Cluster: Transcription initiation factor TFIID s...    34   5.6  
UniRef50_A0T470 Cluster: ORF27; n=5; Nucleopolyhedrovirus|Rep: O...    33   7.4  
UniRef50_Q5VMK8 Cluster: Putative uncharacterized protein P0529C...    33   7.4  
UniRef50_Q5CXV9 Cluster: RAD23p, UB+UBA domains protein; n=2; Cr...    33   7.4  
UniRef50_Q5CUV4 Cluster: UB domain containing protein; n=3; Euka...    33   7.4  
UniRef50_Q5BX61 Cluster: SJCHGC01182 protein; n=1; Schistosoma j...    33   7.4  
UniRef50_A2E190 Cluster: Ubiquitin family protein; n=9; Trichomo...    33   7.4  
UniRef50_UPI00006CB419 Cluster: Ubiquitin family protein; n=1; T...    33   9.8  
UniRef50_Q9LY93 Cluster: Putative uncharacterized protein F18O22...    33   9.8  
UniRef50_Q0J0T6 Cluster: Os09g0484300 protein; n=4; BEP clade|Re...    33   9.8  
UniRef50_P05161 Cluster: Interferon-induced 17 kDa protein precu...    33   9.8  

>UniRef50_Q9WR81 Cluster: Polyprotein; n=31; root|Rep: Polyprotein -
           Bovine viral diarrhea virus 2 (BVDV-2)
          Length = 432

 Score =  112 bits (269), Expect = 1e-23
 Identities = 53/54 (98%), Positives = 54/54 (100%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 240 VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 293



 Score =  112 bits (269), Expect = 1e-23
 Identities = 53/54 (98%), Positives = 54/54 (100%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 316 VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 369


>UniRef50_Q9WR79 Cluster: Polyprotein; n=3; Bovine viral diarrhea
           virus 2|Rep: Polyprotein - Bovine viral diarrhea virus 2
           (BVDV-2)
          Length = 261

 Score =  112 bits (269), Expect = 1e-23
 Identities = 53/54 (98%), Positives = 54/54 (100%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 145 VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 198


>UniRef50_Q7RJC6 Cluster: Ubiquitin; n=1; Plasmodium yoelii
           yoelii|Rep: Ubiquitin - Plasmodium yoelii yoelii
          Length = 162

 Score =  112 bits (269), Expect = 1e-23
 Identities = 53/54 (98%), Positives = 54/54 (100%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 52  VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 105


>UniRef50_UPI000155314F Cluster: PREDICTED: similar to ubiquitin
           A-52 residue ribosomal protein fusion product 1; n=3;
           Euarchontoglires|Rep: PREDICTED: similar to ubiquitin
           A-52 residue ribosomal protein fusion product 1 - Mus
           musculus
          Length = 203

 Score =  110 bits (265), Expect = 4e-23
 Identities = 52/54 (96%), Positives = 54/54 (100%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VEPSDTI+NVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 94  VEPSDTIKNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 147


>UniRef50_A0PDJ3 Cluster: Polyprotein; n=65; root|Rep: Polyprotein -
           Bovine viral diarrhea virus (BVDV) (Mucosal disease
           virus)
          Length = 630

 Score =  110 bits (265), Expect = 4e-23
 Identities = 52/53 (98%), Positives = 53/53 (100%)
 Frame = -2

Query: 888 EPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           EPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 339 EPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 391



 Score = 46.4 bits (105), Expect = 0.001
 Identities = 19/24 (79%), Positives = 21/24 (87%)
 Frame = -2

Query: 612 ENGKIHRLRRECTGEQCGAGVFMA 541
           ENGKI RLRREC  ++CGAGVFMA
Sbjct: 298 ENGKISRLRRECPSDECGAGVFMA 321


>UniRef50_UPI00006CFD8F Cluster: Ubiquitin family protein; n=1;
            Tetrahymena thermophila SB210|Rep: Ubiquitin family
            protein - Tetrahymena thermophila SB210
          Length = 1252

 Score =  109 bits (261), Expect = 1e-22
 Identities = 52/54 (96%), Positives = 53/54 (98%)
 Frame = -2

Query: 891  VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
            VE SDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 1040 VEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 1093



 Score =  109 bits (261), Expect = 1e-22
 Identities = 52/54 (96%), Positives = 53/54 (98%)
 Frame = -2

Query: 891  VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
            VE SDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 1116 VEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 1169



 Score =  109 bits (261), Expect = 1e-22
 Identities = 52/54 (96%), Positives = 53/54 (98%)
 Frame = -2

Query: 891  VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
            VE SDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 1192 VEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 1245


>UniRef50_A0CI21 Cluster: Chromosome undetermined scaffold_187,
           whole genome shotgun sequence; n=2; Eukaryota|Rep:
           Chromosome undetermined scaffold_187, whole genome
           shotgun sequence - Paramecium tetraurelia
          Length = 271

 Score =  107 bits (258), Expect = 3e-22
 Identities = 51/54 (94%), Positives = 53/54 (98%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VEPSDTI+ VKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 17  VEPSDTIDAVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70



 Score = 84.6 bits (200), Expect = 3e-15
 Identities = 36/54 (66%), Positives = 48/54 (88%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VE +D++E++K +IQDKEGIPPNQQRLIF+G QLED +TL +YN++ EST+HLV
Sbjct: 93  VESTDSVESLKKQIQDKEGIPPNQQRLIFSGHQLEDEKTLLEYNVENESTIHLV 146


>UniRef50_A6SBB4 Cluster: 60S ribosomal protein L40; n=1;
           Botryotinia fuckeliana B05.10|Rep: 60S ribosomal protein
           L40 - Botryotinia fuckeliana B05.10
          Length = 607

 Score =  107 bits (258), Expect = 3e-22
 Identities = 51/54 (94%), Positives = 53/54 (98%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VE SDTI+NVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 496 VESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 549


>UniRef50_Q0WRN6 Cluster: Polyubiquitin 4 UBQ4; n=6; Eukaryota|Rep:
           Polyubiquitin 4 UBQ4 - Arabidopsis thaliana (Mouse-ear
           cress)
          Length = 351

 Score =  106 bits (255), Expect = 7e-22
 Identities = 50/54 (92%), Positives = 53/54 (98%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VE SDTI+NVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTL+DYNIQKESTLHLV
Sbjct: 17  VESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV 70



 Score =  106 bits (255), Expect = 7e-22
 Identities = 50/54 (92%), Positives = 53/54 (98%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VE SDTI+NVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTL+DYNIQKESTLHLV
Sbjct: 93  VESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV 146



 Score =  106 bits (255), Expect = 7e-22
 Identities = 50/54 (92%), Positives = 53/54 (98%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VE SDTI+NVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTL+DYNIQKESTLHLV
Sbjct: 214 VESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV 267



 Score =  106 bits (255), Expect = 7e-22
 Identities = 50/54 (92%), Positives = 53/54 (98%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VE SDTI+NVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTL+DYNIQKESTLHLV
Sbjct: 290 VESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV 343



 Score = 29.1 bits (62), Expect(2) = 6.4
 Identities = 13/15 (86%), Positives = 14/15 (93%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQ 847
           VE SDTI+NVKAKIQ
Sbjct: 169 VESSDTIDNVKAKIQ 183



 Score = 23.4 bits (48), Expect(2) = 6.4
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = -2

Query: 759 IQKESTLHLV 730
           IQKESTLHLV
Sbjct: 182 IQKESTLHLV 191


>UniRef50_A2YRX2 Cluster: Putative uncharacterized protein; n=2;
           Oryza sativa|Rep: Putative uncharacterized protein -
           Oryza sativa subsp. indica (Rice)
          Length = 324

 Score =  105 bits (251), Expect = 2e-21
 Identities = 49/54 (90%), Positives = 53/54 (98%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VE SDTI+NVKAKIQDKEGIPP+QQRLIFAGKQLE+GRTL+DYNIQKESTLHLV
Sbjct: 251 VESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEEGRTLADYNIQKESTLHLV 304



 Score = 66.5 bits (155), Expect = 9e-10
 Identities = 38/58 (65%), Positives = 45/58 (77%), Gaps = 4/58 (6%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRL--IFAG-KQLED-GRTLSDYNIQKESTLHLV 730
           V PSDTI++VKAKIQDK GI  +QQ L  + AG KQL+D G TL+DY+I  ESTLHLV
Sbjct: 17  VRPSDTIDDVKAKIQDKVGIRSDQQHLVDVSAGSKQLDDGGSTLADYDIHDESTLHLV 74


>UniRef50_Q9FWV0 Cluster: Putative ubiquitin/ribosomal protein S27a
           fusion protein; n=2; Eukaryota|Rep: Putative
           ubiquitin/ribosomal protein S27a fusion protein - Oryza
           sativa subsp. japonica (Rice)
          Length = 147

 Score =  103 bits (247), Expect = 6e-21
 Identities = 59/126 (46%), Positives = 74/126 (58%), Gaps = 5/126 (3%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHL---VXXX 721
           +EPSDT+E+VK K+ DKEG+PP+QQ LIF G QL+DG TL  Y IQ+ESTLHL   +   
Sbjct: 22  MEPSDTVESVKVKLVDKEGLPPDQQPLIFQGHQLDDGHTLIYYGIQEESTLHLLGRICGG 81

Query: 720 XXXXXXXXXKNYSTPXXXXXXXXXXKLAVLRFYKVDE-NGKIHRLRRECTGEQC-GAGVF 547
                    K Y+TP          +LAVLR Y+VD+  GK+ RLR  C   +C   G  
Sbjct: 82  GGGNKKRKKKAYATPKKGKHEHRKEELAVLRHYRVDDVMGKVERLRLMCPNPECKDVGAL 141

Query: 546 MAVMED 529
           MA   D
Sbjct: 142 MAKHHD 147


>UniRef50_Q868B2 Cluster: Polyubiquitin; n=3; Eukaryota|Rep:
           Polyubiquitin - Euglypha rotunda
          Length = 177

 Score =  103 bits (246), Expect = 8e-21
 Identities = 48/54 (88%), Positives = 51/54 (94%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VE SDTIENVK KIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYN+ KE+TLHLV
Sbjct: 10  VEASDTIENVKQKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNVTKEATLHLV 63



 Score =  103 bits (246), Expect = 8e-21
 Identities = 48/54 (88%), Positives = 51/54 (94%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VE SDTIENVK KIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYN+ KE+TLHLV
Sbjct: 88  VEASDTIENVKQKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNVTKEATLHLV 141


>UniRef50_A1TWA7 Cluster: Ubiquitin precursor; n=1; Acidovorax
           avenae subsp. citrulli AAC00-1|Rep: Ubiquitin precursor
           - Acidovorax avenae subsp. citrulli (strain AAC00-1)
          Length = 287

 Score =  101 bits (242), Expect = 2e-20
 Identities = 47/54 (87%), Positives = 52/54 (96%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VEPSD+IENVKAKIQD++ IPP +QRLIFAGKQLEDGRTLSDYNIQK+STLHLV
Sbjct: 56  VEPSDSIENVKAKIQDQKDIPPERQRLIFAGKQLEDGRTLSDYNIQKDSTLHLV 109


>UniRef50_Q9E2W4 Cluster: Polyprotein; n=1; Bovine viral diarrhea
           virus type 2|Rep: Polyprotein - Bovine viral diarrhea
           virus type 2
          Length = 636

 Score =  100 bits (239), Expect = 6e-20
 Identities = 48/53 (90%), Positives = 50/53 (94%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHL 733
           VEPSDTIENVKAKIQDKEGIPP+QQRLI AGKQLEDGRTLS Y IQKESTL+L
Sbjct: 371 VEPSDTIENVKAKIQDKEGIPPDQQRLILAGKQLEDGRTLSAYKIQKESTLYL 423



 Score = 95.9 bits (228), Expect = 1e-18
 Identities = 45/53 (84%), Positives = 47/53 (88%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHL 733
           VEPSDTIENVKAKIQDKEGIPP Q+RLIF   + ED RTLSDYNIQKESTLHL
Sbjct: 447 VEPSDTIENVKAKIQDKEGIPPGQKRLIFPANKREDARTLSDYNIQKESTLHL 499



 Score = 76.6 bits (180), Expect = 8e-13
 Identities = 35/36 (97%), Positives = 36/36 (100%)
 Frame = -2

Query: 837 GIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           GIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 313 GIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 348


>UniRef50_Q7XBP6 Cluster: Ubiquitin/ribosomal protein P1 fusion;
           n=3; Chlorarachniophyceae|Rep: Ubiquitin/ribosomal
           protein P1 fusion - Bigelowiella natans (Pedinomonas
           minutissima) (Chlorarachnion sp.(strain CCMP 621))
          Length = 221

 Score =  100 bits (239), Expect = 6e-20
 Identities = 47/54 (87%), Positives = 50/54 (92%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           V+ SDTI  VK KIQDKEGIPP+QQRLIFAGKQLEDGRTL+DYNIQKESTLHLV
Sbjct: 19  VDSSDTINTVKQKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV 72


>UniRef50_Q91BI7 Cluster: Ubiquitin GP37 fusion protein; n=2;
           Spodoptera litura NPV|Rep: Ubiquitin GP37 fusion protein
           - Spodoptera litura multicapsid nucleopolyhedrovirus
           (SpltMNPV)
          Length = 351

 Score = 96.3 bits (229), Expect = 9e-19
 Identities = 43/54 (79%), Positives = 49/54 (90%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VEPSD++E VK +I DKEG+PP+QQRLIFAGKQLED  T+SDYNIQKESTLHLV
Sbjct: 36  VEPSDSVETVKQRIADKEGVPPDQQRLIFAGKQLEDSMTMSDYNIQKESTLHLV 89


>UniRef50_Q5D8K9 Cluster: SJCHGC02785 protein; n=1; Schistosoma
           japonicum|Rep: SJCHGC02785 protein - Schistosoma
           japonicum (Blood fluke)
          Length = 153

 Score = 95.9 bits (228), Expect = 1e-18
 Identities = 53/129 (41%), Positives = 68/129 (52%)
 Frame = -2

Query: 885 PSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVXXXXXXXX 706
           P+++++++K KI    GI  + Q L   G  L D   L + +      + +         
Sbjct: 19  PNESVKSLKDKISVATGIHASTQSLYHHGLPLLDSSLLEELDFTDLDNVDVNCELLGGGK 78

Query: 705 XXXXKNYSTPXXXXXXXXXXKLAVLRFYKVDENGKIHRLRRECTGEQCGAGVFMAVMEDR 526
               KNY+TP          KLA L+FYKVD NGKI RLRREC  E+CGAGVFMA   DR
Sbjct: 79  KRKKKNYTTPRKIKHKKKKVKLATLKFYKVDSNGKITRLRRECPSEKCGAGVFMASHFDR 138

Query: 525 HYCGKCHST 499
            YCGKC  T
Sbjct: 139 EYCGKCALT 147


>UniRef50_Q6WMU7 Cluster: Ubiquitin-like protein Ublp94.4; n=1;
           Acanthamoeba castellanii|Rep: Ubiquitin-like protein
           Ublp94.4 - Acanthamoeba castellanii (Amoeba)
          Length = 853

 Score = 92.3 bits (219), Expect = 2e-17
 Identities = 43/54 (79%), Positives = 49/54 (90%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           V  SD+IE VK K+QDKEGIPP+QQRLIFAGKQLE+ RTL++YNIQKESTLHLV
Sbjct: 357 VSSSDSIEAVKHKLQDKEGIPPDQQRLIFAGKQLEESRTLAEYNIQKESTLHLV 410


>UniRef50_P62979 Cluster: 40S ribosomal protein S27a; n=188;
           root|Rep: 40S ribosomal protein S27a - Homo sapiens
           (Human)
          Length = 80

 Score = 91.1 bits (216), Expect = 3e-17
 Identities = 44/73 (60%), Positives = 51/73 (69%), Gaps = 1/73 (1%)
 Frame = -2

Query: 690 NYSTPXXXXXXXXXXKLAVLRFYKVDENGKIHRLRRECTGEQCGAGVFMAVMEDRHYCGK 511
           +Y+TP          KLAVL++YKVDENGKI RLRREC  ++CGAGVFMA   DRHYCGK
Sbjct: 8   SYTTPKKNKHKRKKVKLAVLKYYKVDENGKISRLRRECPSDECGAGVFMASHFDRHYCGK 67

Query: 510 CHSTMVF-KDDDK 475
           C  T  F K +DK
Sbjct: 68  CCLTYCFNKPEDK 80


>UniRef50_Q9SYE9 Cluster: F15I1.1 protein; n=1; Arabidopsis
           thaliana|Rep: F15I1.1 protein - Arabidopsis thaliana
           (Mouse-ear cress)
          Length = 158

 Score = 89.4 bits (212), Expect = 1e-16
 Identities = 41/54 (75%), Positives = 47/54 (87%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VE  DTIEN+KAKIQDK+GIP +QQRLIF GKQLEDG TL+DYNIQ +S LHL+
Sbjct: 102 VENCDTIENIKAKIQDKQGIPVDQQRLIFKGKQLEDGLTLADYNIQNDSILHLI 155


>UniRef50_Q7XB26 Cluster: Ubiquitin/actin fusion protein 4; n=1;
           Bigelowiella natans|Rep: Ubiquitin/actin fusion protein
           4 - Bigelowiella natans (Pedinomonas minutissima)
           (Chlorarachnion sp.(strain CCMP 621))
          Length = 234

 Score = 88.6 bits (210), Expect = 2e-16
 Identities = 40/52 (76%), Positives = 47/52 (90%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLH 736
           V+PS+TI+NVK KIQ+KEG+PP+Q RLIFAGKQLEDGRTL+  NIQ ESTLH
Sbjct: 10  VDPSETIDNVKEKIQEKEGVPPDQLRLIFAGKQLEDGRTLAHCNIQNESTLH 61


>UniRef50_P16709 Cluster: Ubiquitin-like protein precursor; n=19;
           root|Rep: Ubiquitin-like protein precursor - Autographa
           californica nuclear polyhedrosis virus (AcMNPV)
          Length = 77

 Score = 87.0 bits (206), Expect = 6e-16
 Identities = 37/53 (69%), Positives = 48/53 (90%)
 Frame = -2

Query: 888 EPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           EP++T+ ++K KI DKEG+P +QQRLIFAGKQLED +T++DYNIQKESTLH+V
Sbjct: 18  EPAETVADLKQKIADKEGVPVDQQRLIFAGKQLEDSKTMADYNIQKESTLHMV 70


>UniRef50_Q9YMT1 Cluster: Viral ubiquitin; n=1; Lymantria dispar
           MNPV|Rep: Viral ubiquitin - Lymantria dispar multicapsid
           nuclear polyhedrosis virus (LdMNPV)
          Length = 150

 Score = 85.0 bits (201), Expect = 2e-15
 Identities = 38/54 (70%), Positives = 48/54 (88%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VE +D+++ +K KI DKEGIP +QQRLI+AGKQL+D RTL+DYNIQKE+TLHLV
Sbjct: 17  VEATDSVQTLKEKILDKEGIPADQQRLIYAGKQLDDERTLNDYNIQKEATLHLV 70


>UniRef50_UPI000155E27A Cluster: PREDICTED: similar to ubiquitin
           A-52 residue ribosomal protein fusion product 1; n=1;
           Equus caballus|Rep: PREDICTED: similar to ubiquitin A-52
           residue ribosomal protein fusion product 1 - Equus
           caballus
          Length = 141

 Score = 83.8 bits (198), Expect = 5e-15
 Identities = 40/53 (75%), Positives = 44/53 (83%)
 Frame = -2

Query: 888 EPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           EPSDT ENVK KIQDKEGI P+QQ L F G  LEDGRT SDYNIQK+STL+L+
Sbjct: 10  EPSDTTENVKTKIQDKEGILPSQQCLAFVGTHLEDGRTRSDYNIQKKSTLNLL 62


>UniRef50_UPI0000DA4142 Cluster: PREDICTED: similar to ribosomal
           protein S27a; n=1; Rattus norvegicus|Rep: PREDICTED:
           similar to ribosomal protein S27a - Rattus norvegicus
          Length = 122

 Score = 83.0 bits (196), Expect = 9e-15
 Identities = 58/126 (46%), Positives = 69/126 (54%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVXXXXXX 712
           VEPSDTIENVKAKIQD+EGIPP+QQRL+FAG       TL+D   +K             
Sbjct: 19  VEPSDTIENVKAKIQDEEGIPPHQQRLVFAGTL----STLTDSGAKKRK----------- 63

Query: 711 XXXXXXKNYSTPXXXXXXXXXXKLAVLRFYKVDENGKIHRLRRECTGEQCGAGVFMAVME 532
                 K+Y+            KLAVL+ +KVDENGKI R   E   ++CGAG       
Sbjct: 64  ------KSYTAHKKSKHRRKKVKLAVLKHHKVDENGKISRRCWERPSDECGAG---GGHF 114

Query: 531 DRHYCG 514
           D HYCG
Sbjct: 115 DMHYCG 120


>UniRef50_Q8IM64 Cluster: Ribosomal S27a, putative; n=6;
           Plasmodium|Rep: Ribosomal S27a, putative - Plasmodium
           falciparum (isolate 3D7)
          Length = 149

 Score = 81.8 bits (193), Expect = 2e-14
 Identities = 49/131 (37%), Positives = 67/131 (51%)
 Frame = -2

Query: 879 DTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVXXXXXXXXXX 700
           + I+NVK +I + +GIP   Q+L   G+ LED   L         TL+L           
Sbjct: 21  NNIKNVKEQIFELKGIPYELQKLYKNGRHLEDEELLEIDKSDYAYTLNLNFGLLGGAKKK 80

Query: 699 XXKNYSTPXXXXXXXXXXKLAVLRFYKVDENGKIHRLRRECTGEQCGAGVFMAVMEDRHY 520
             K Y  P          KLAVL+FYKV ++GK+ RL+R+C  + C  G  MA   DR Y
Sbjct: 81  KKKVYKKPKKEKHKKKKVKLAVLKFYKVGDDGKVFRLKRQC--DNCAPGTLMASHFDRDY 138

Query: 519 CGKCHSTMVFK 487
           CG+CH T++ K
Sbjct: 139 CGRCHLTIMKK 149


>UniRef50_Q22T79 Cluster: Ubiquitin family protein; n=1; Tetrahymena
           thermophila SB210|Rep: Ubiquitin family protein -
           Tetrahymena thermophila SB210
          Length = 564

 Score = 81.0 bits (191), Expect = 4e-14
 Identities = 38/53 (71%), Positives = 44/53 (83%)
 Frame = -2

Query: 888 EPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           + SDTI+N+K KI D EGIPP+QQRLIF GK LE+G TLSDYNIQ  ST+HLV
Sbjct: 301 DSSDTIDNIKNKIYDIEGIPPDQQRLIFPGKILENGYTLSDYNIQNGSTIHLV 353


>UniRef50_Q9SHE7 Cluster: NEDD8-like protein RUB1 precursor; n=19;
           Eukaryota|Rep: NEDD8-like protein RUB1 precursor -
           Arabidopsis thaliana (Mouse-ear cress)
          Length = 80

 Score = 78.6 bits (185), Expect = 2e-13
 Identities = 33/54 (61%), Positives = 44/54 (81%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           +EP+DTI+ +K ++++KEGIPP QQRLI+AGKQL D +T  DYNI+  S LHLV
Sbjct: 17  IEPTDTIDRIKERVEEKEGIPPVQQRLIYAGKQLADDKTAKDYNIEGGSVLHLV 70


>UniRef50_UPI0000ECA612 Cluster: UPI0000ECA612 related cluster; n=5;
           Gallus gallus|Rep: UPI0000ECA612 UniRef100 entry -
           Gallus gallus
          Length = 287

 Score = 78.2 bits (184), Expect = 3e-13
 Identities = 33/55 (60%), Positives = 46/55 (83%)
 Frame = +1

Query: 715 TTKPQHQVEGGFLLDIVVREGTSIFQLLSSKDQPLLIGRDSLFVLNFSFHILDGI 879
           T++ QHQ++GG LLD+VVR+G  IFQLL+SKDQPLLI R++ F+L+   HIL+G+
Sbjct: 146 TSQAQHQMQGGLLLDVVVRQGAPIFQLLTSKDQPLLIRRNAFFILDLGLHILNGV 200



 Score = 78.2 bits (184), Expect = 3e-13
 Identities = 33/56 (58%), Positives = 46/56 (82%)
 Frame = +1

Query: 712 ATTKPQHQVEGGFLLDIVVREGTSIFQLLSSKDQPLLIGRDSLFVLNFSFHILDGI 879
           A+ + QHQ++GG LLD+VVR+G  +FQLL+SKDQPLLIGR++  VL+   HIL+G+
Sbjct: 221 ASPQAQHQMQGGLLLDVVVRQGAPVFQLLASKDQPLLIGRNAFLVLDLGLHILNGV 276



 Score = 73.7 bits (173), Expect = 6e-12
 Identities = 31/54 (57%), Positives = 43/54 (79%)
 Frame = +1

Query: 712 ATTKPQHQVEGGFLLDIVVREGTSIFQLLSSKDQPLLIGRDSLFVLNFSFHILD 873
           A+ + QHQ++GG  LD+VVR+G  +FQLL+SKDQPLLIGR++ FVL+   HI +
Sbjct: 69  ASPQTQHQMQGGLFLDVVVRQGAPVFQLLASKDQPLLIGRNAFFVLDLGLHIFN 122



 Score = 66.5 bits (155), Expect = 9e-10
 Identities = 28/48 (58%), Positives = 40/48 (83%)
 Frame = +1

Query: 736 VEGGFLLDIVVREGTSIFQLLSSKDQPLLIGRDSLFVLNFSFHILDGI 879
           ++GG LLD+VVR+G  +FQLL+SK+QPLLI R++ FVL+   HIL+G+
Sbjct: 1   MQGGLLLDVVVRQGAPVFQLLASKNQPLLIRRNAFFVLDLGLHILNGV 48


>UniRef50_Q6ZCA5 Cluster: Monoubiquitin/carboxy-extension protein
           fusion-like; n=2; Oryza sativa|Rep:
           Monoubiquitin/carboxy-extension protein fusion-like -
           Oryza sativa subsp. japonica (Rice)
          Length = 212

 Score = 75.4 bits (177), Expect = 2e-12
 Identities = 35/53 (66%), Positives = 42/53 (79%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHL 733
           V P DT+  VKAKIQ K GIP  QQRL+FAG+ LEDGRTL++Y I+KE+ LHL
Sbjct: 17  VNPWDTVGKVKAKIQAKGGIPAAQQRLMFAGRHLEDGRTLAEYGIKKEANLHL 69


>UniRef50_Q9VJ33 Cluster: NEDD8 precursor; n=546; root|Rep: NEDD8
           precursor - Drosophila melanogaster (Fruit fly)
          Length = 84

 Score = 75.4 bits (177), Expect = 2e-12
 Identities = 29/54 (53%), Positives = 43/54 (79%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           +EP+D ++ +K ++++KEGIPP QQRLIF+GKQ+ D +T +DY +Q  S LHLV
Sbjct: 17  IEPTDKVDRIKERVEEKEGIPPQQQRLIFSGKQMNDDKTAADYKVQGGSVLHLV 70


>UniRef50_Q0V3T0 Cluster: Putative uncharacterized protein; n=1;
           Phaeosphaeria nodorum|Rep: Putative uncharacterized
           protein - Phaeosphaeria nodorum (Septoria nodorum)
          Length = 375

 Score = 74.5 bits (175), Expect = 3e-12
 Identities = 33/50 (66%), Positives = 41/50 (82%)
 Frame = -2

Query: 879 DTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           DT+E +K +I+DKEGIP NQ RLIFAGKQLEDGRT++ Y I  E T+H+V
Sbjct: 239 DTVEVIKCRIEDKEGIPWNQMRLIFAGKQLEDGRTIAHYKILYEGTVHVV 288


>UniRef50_Q4Q216 Cluster: Ubiquitin/ribosomal protein S27a,
           putative; n=13; Eukaryota|Rep: Ubiquitin/ribosomal
           protein S27a, putative - Leishmania major
          Length = 152

 Score = 74.1 bits (174), Expect = 4e-12
 Identities = 47/136 (34%), Positives = 67/136 (49%), Gaps = 5/136 (3%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVXXXXXX 712
           V   DT+  +KA+    +G       L FAG  L +   L+ Y + KEST+ +V      
Sbjct: 17  VSAEDTVGFLKAQANVTQG------NLFFAGMCLAEEEPLAAYGLSKESTVDVVIPVEGG 70

Query: 711 XXXXXXKN-YSTPXXXXXXXXXXKLAVLRFYKVDENG----KIHRLRRECTGEQCGAGVF 547
                 K  ++ P          K+  L+++KV EN     K+ R R++C   QCGAGV+
Sbjct: 71  KGKKKKKRIFTKPKKPTHRHKLEKMRALKYFKVTENDDGSYKVERTRQDCPHPQCGAGVY 130

Query: 546 MAVMEDRHYCGKCHST 499
           MA  +DR YCGKCH T
Sbjct: 131 MAQHKDRQYCGKCHLT 146


>UniRef50_Q9SYF2 Cluster: F15I1.4 protein; n=4; Arabidopsis
           thaliana|Rep: F15I1.4 protein - Arabidopsis thaliana
           (Mouse-ear cress)
          Length = 144

 Score = 72.9 bits (171), Expect = 1e-11
 Identities = 33/53 (62%), Positives = 42/53 (79%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHL 733
           V+ SDTI  +KAK ++KEGIP  QQRLIF G+ LED + +SDYNI+ ESTLH+
Sbjct: 85  VKGSDTIRELKAKHEEKEGIPVEQQRLIFQGRVLEDSKAISDYNIKHESTLHI 137


>UniRef50_Q15843 Cluster: NEDD8 precursor; n=1233; root|Rep: NEDD8
           precursor - Homo sapiens (Human)
          Length = 81

 Score = 72.5 bits (170), Expect = 1e-11
 Identities = 29/54 (53%), Positives = 42/54 (77%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           +EP+D +E +K ++++KEGIPP QQRLI++GKQ+ D +T +DY I   S LHLV
Sbjct: 17  IEPTDKVERIKERVEEKEGIPPQQQRLIYSGKQMNDEKTAADYKILGGSVLHLV 70


>UniRef50_A2YRX0 Cluster: Putative uncharacterized protein; n=1;
           Oryza sativa (indica cultivar-group)|Rep: Putative
           uncharacterized protein - Oryza sativa subsp. indica
           (Rice)
          Length = 253

 Score = 72.1 bits (169), Expect = 2e-11
 Identities = 33/37 (89%), Positives = 36/37 (97%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDG 781
           VE SDTI+NVKAKIQDKEGIPP+QQRLIFAGKQLE+G
Sbjct: 215 VESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEEG 251


>UniRef50_Q5CQW0 Cluster: Ribosomal protein S27a, ubiquitin plus
           zincribbon, UB13p; n=2; Cryptosporidium|Rep: Ribosomal
           protein S27a, ubiquitin plus zincribbon, UB13p -
           Cryptosporidium parvum Iowa II
          Length = 159

 Score = 72.1 bits (169), Expect = 2e-11
 Identities = 46/131 (35%), Positives = 69/131 (52%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVXXXXXX 712
           V+P+ +++ ++  I +  GI  + Q + +    L++  TL    I   STL+ V      
Sbjct: 20  VDPTMSVKELRHIISEFSGISIDSQCISYGFGILDEFETLEQAGISDYSTLY-VSEAMLG 78

Query: 711 XXXXXXKNYSTPXXXXXXXXXXKLAVLRFYKVDENGKIHRLRRECTGEQCGAGVFMAVME 532
                 KN++ P          KLAVL++YKVD + K+ +LRREC  E CGAGVFMA   
Sbjct: 79  GAKKKKKNFTKPKKIKHKKKKVKLAVLKYYKVDGD-KVVKLRRECPAETCGAGVFMAQHF 137

Query: 531 DRHYCGKCHST 499
           +R  CG+C  T
Sbjct: 138 NRTSCGRCGLT 148


>UniRef50_Q9FWU7 Cluster: Putative polyubiquitin; n=3; Oryza
           sativa|Rep: Putative polyubiquitin - Oryza sativa subsp.
           japonica (Rice)
          Length = 307

 Score = 71.3 bits (167), Expect = 3e-11
 Identities = 31/53 (58%), Positives = 44/53 (83%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHL 733
           VEPSDT+E+VK ++Q+K+G+PP QQRLIF G+QL+DG T++   I+K S L+L
Sbjct: 86  VEPSDTVESVKLQLQEKDGLPPCQQRLIFEGRQLDDGDTVASCGIRKHSYLNL 138



 Score = 56.8 bits (131), Expect = 7e-07
 Identities = 27/55 (49%), Positives = 41/55 (74%), Gaps = 2/55 (3%)
 Frame = -2

Query: 891 VEPSDTIENVKAKI--QDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHL 733
           V+PSDT+ +VK K+  + K+   P +QRL+F+G +L D RTL+ Y I++ESTL+L
Sbjct: 192 VQPSDTVGSVKVKLYYRKKKKTMPCKQRLVFSGMELADDRTLASYGIEEESTLYL 246



 Score = 45.2 bits (102), Expect = 0.002
 Identities = 27/53 (50%), Positives = 36/53 (67%), Gaps = 3/53 (5%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLE--DG-RTLSDYNIQKEST 742
           VEPSDT+E+VKAKI+   GI      L + GKQ++  DG RTL+DY I+  +T
Sbjct: 17  VEPSDTVESVKAKIKAMSGI-TEDFGLAYDGKQMDEADGHRTLADYGIRDPAT 68


>UniRef50_UPI00005A2EE8 Cluster: PREDICTED: similar to ubiquitin C;
           n=1; Canis lupus familiaris|Rep: PREDICTED: similar to
           ubiquitin C - Canis familiaris
          Length = 166

 Score = 70.9 bits (166), Expect = 4e-11
 Identities = 36/54 (66%), Positives = 39/54 (72%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VEP DT EN KAKIQDKEGI   QQ LIFAG+Q ED   +SD N QK+S LH V
Sbjct: 36  VEPRDTTENAKAKIQDKEGILLTQQHLIFAGQQSEDSPIVSDNNSQKKSILHSV 89


>UniRef50_Q6A1P6 Cluster: Putative uncharacterized protein; n=1;
           Euplotes vannus|Rep: Putative uncharacterized protein -
           Euplotes vannus
          Length = 177

 Score = 70.5 bits (165), Expect = 5e-11
 Identities = 50/146 (34%), Positives = 77/146 (52%), Gaps = 2/146 (1%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVXXXXXX 712
           V+  DTI  +KAKI ++EGI      LI    QLED  T ++  +  E+T+ +       
Sbjct: 17  VDECDTIATMKAKISEQEGIAAESIVLINGLSQLEDQMTFAECELNNEATVTMTLKMLGG 76

Query: 711 XXXXXXKNYSTPXXXXXXXXXXKLAVLRFYKVDENGKIHRLRRECTGEQCGAGVFMAVME 532
                 K Y+ P          K+ VL +++VD+NGKI +L++E + EQ  AG ++A  +
Sbjct: 77  KKKKKKKVYTKPKKIPHKHENIKMRVLSYFEVDKNGKIEKLKQE-SPEQ--AGCYLADHK 133

Query: 531 DRHYCGKCHSTMVFK--DDDK*ISPL 460
           DR +CGK    M +K   D K I+P+
Sbjct: 134 DRMHCGKT-GYMFYKMTADGKRIAPV 158


>UniRef50_Q236S9 Cluster: Ubiquitin family protein; n=2;
           Alveolata|Rep: Ubiquitin family protein - Tetrahymena
           thermophila SB210
          Length = 2194

 Score = 70.1 bits (164), Expect = 7e-11
 Identities = 31/53 (58%), Positives = 41/53 (77%)
 Frame = -2

Query: 888 EPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           E  DTI N+K +IQD+ G PPNQQR +FAGK LED RT+ DYN++  ST++L+
Sbjct: 733 ESDDTILNLKTQIQDQIGFPPNQQRFLFAGKILEDERTVGDYNMKTGSTINLI 785



 Score = 40.3 bits (90), Expect = 0.064
 Identities = 24/56 (42%), Positives = 33/56 (58%), Gaps = 3/56 (5%)
 Frame = -2

Query: 891  VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNI---QKESTLHL 733
            V+PS  I ++K  I  K  I    Q L FAG ++ + +TLSDY+I    +E TLHL
Sbjct: 951  VQPSHKILDIKEMIFKKTNINVKDQSLKFAGNEMINQKTLSDYSIIDSTEEFTLHL 1006


>UniRef50_Q54V68 Cluster: Putative uncharacterized protein; n=3;
           Dictyostelium discoideum AX4|Rep: Putative
           uncharacterized protein - Dictyostelium discoideum AX4
          Length = 314

 Score = 68.9 bits (161), Expect = 2e-10
 Identities = 33/53 (62%), Positives = 42/53 (79%)
 Frame = -2

Query: 888 EPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           + S  IE +K+ I   +GI  +QQRL++AGKQLEDGR+L +YNIQKESTLHLV
Sbjct: 83  QSSMLIETLKSMIFKNQGILEDQQRLLYAGKQLEDGRSLFEYNIQKESTLHLV 135


>UniRef50_A6RQL0 Cluster: Ubiquitin; n=2; Sclerotiniaceae|Rep:
           Ubiquitin - Botryotinia fuckeliana B05.10
          Length = 77

 Score = 68.1 bits (159), Expect = 3e-10
 Identities = 29/54 (53%), Positives = 41/54 (75%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VE  + IE VK K+++KEGIPP QQRLI+ GKQ+ D + + DY+++  +TLHLV
Sbjct: 17  VEADNKIERVKEKVEEKEGIPPVQQRLIYGGKQMADDKLVQDYDLEPGATLHLV 70


>UniRef50_Q00UH7 Cluster: Polyubiquitin 2; n=1; Ostreococcus
           tauri|Rep: Polyubiquitin 2 - Ostreococcus tauri
          Length = 124

 Score = 67.3 bits (157), Expect = 5e-10
 Identities = 26/48 (54%), Positives = 38/48 (79%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKE 748
           +EP+D++E +K ++++KEGIPP QQRLIF GKQ+ D +   DYNI+ E
Sbjct: 44  IEPTDSVERIKERVEEKEGIPPVQQRLIFGGKQMNDEKIAKDYNIEVE 91


>UniRef50_Q4U8U0 Cluster: S27 ribosomal protein, putative; n=3;
           Piroplasmida|Rep: S27 ribosomal protein, putative -
           Theileria annulata
          Length = 162

 Score = 65.7 bits (153), Expect = 1e-09
 Identities = 41/101 (40%), Positives = 54/101 (53%), Gaps = 2/101 (1%)
 Frame = -2

Query: 795 QLEDGRTLSDYNIQKESTLHLVXXXXXXXXXXXXKN--YSTPXXXXXXXXXXKLAVLRFY 622
           +L+D   LSD  +  EST+ L             K   Y+TP          KLAVL++Y
Sbjct: 57  ELDDELELSDLLVD-ESTISLDHHLELLGGGKKRKKKQYTTPKKVKHKKKKVKLAVLKYY 115

Query: 621 KVDENGKIHRLRRECTGEQCGAGVFMAVMEDRHYCGKCHST 499
           KVD + K+ RL ++C GE CG GVFMA   +R YCG+C  T
Sbjct: 116 KVDGD-KVVRLLKDCPGENCGRGVFMAAHNNRTYCGRCQLT 155


>UniRef50_O44819 Cluster: Putative uncharacterized protein; n=1;
           Caenorhabditis elegans|Rep: Putative uncharacterized
           protein - Caenorhabditis elegans
          Length = 292

 Score = 65.7 bits (153), Expect = 1e-09
 Identities = 28/54 (51%), Positives = 40/54 (74%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           ++ +DT+E +K K+Q+K G+PP+QQRLIF   QLE+ R L  YNI+ E  +HLV
Sbjct: 177 IKNTDTVETLKFKVQNKHGVPPDQQRLIFGRAQLENDRALFAYNIRDEDIIHLV 230



 Score = 36.3 bits (80), Expect = 1.0
 Identities = 19/53 (35%), Positives = 30/53 (56%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHL 733
           VE SD I+++  K+ + +  P     ++      +D RT+SDYNI+  STL L
Sbjct: 105 VEASDAIKDLNFKVAEAQRKPHQPSNIVLC----KDQRTISDYNIKNGSTLRL 153


>UniRef50_Q5MGJ9 Cluster: Ribosomal protein 3; n=1; Lonomia
           obliqua|Rep: Ribosomal protein 3 - Lonomia obliqua
           (Moth)
          Length = 42

 Score = 65.3 bits (152), Expect = 2e-09
 Identities = 28/40 (70%), Positives = 34/40 (85%)
 Frame = -2

Query: 546 MAVMEDRHYCGKCHSTMVFKDDDK*ISPL*PVRNARDCCV 427
           MAVMEDRHYCGKCHSTMVFKDDD  +SPL  ++++R  C+
Sbjct: 1   MAVMEDRHYCGKCHSTMVFKDDDNRLSPL-SLKDSRPLCM 39


>UniRef50_Q0C9H7 Cluster: Putative uncharacterized protein; n=1;
           Aspergillus terreus NIH2624|Rep: Putative
           uncharacterized protein - Aspergillus terreus (strain
           NIH 2624)
          Length = 115

 Score = 64.1 bits (149), Expect = 5e-09
 Identities = 25/48 (52%), Positives = 38/48 (79%)
 Frame = -2

Query: 873 IENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           +  +K ++++KEGIPP QQRLIF GKQ+ D +T ++YN++  +TLHLV
Sbjct: 61  VSRIKERVEEKEGIPPVQQRLIFGGKQMADDKTAAEYNLEGGATLHLV 108


>UniRef50_A2EJ38 Cluster: Ubiquitin family protein; n=4; Trichomonas
           vaginalis G3|Rep: Ubiquitin family protein - Trichomonas
           vaginalis G3
          Length = 457

 Score = 63.3 bits (147), Expect = 8e-09
 Identities = 27/46 (58%), Positives = 38/46 (82%)
 Frame = -2

Query: 867 NVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           ++  KIQDKEGIP +QQRL++AG QL++ +++  Y IQK+STLHLV
Sbjct: 204 DIMYKIQDKEGIPMDQQRLVYAGAQLDEDKSIGYYKIQKDSTLHLV 249


>UniRef50_Q99351 Cluster: D.melanogaster polytene; n=5; Drosophila
           melanogaster|Rep: D.melanogaster polytene - Drosophila
           melanogaster (Fruit fly)
          Length = 152

 Score = 62.5 bits (145), Expect = 1e-08
 Identities = 27/55 (49%), Positives = 40/55 (72%)
 Frame = +1

Query: 715 TTKPQHQVEGGFLLDIVVREGTSIFQLLSSKDQPLLIGRDSLFVLNFSFHILDGI 879
           TT+ ++QV+GG LLD+V+ +G S+   L+ +DQ LLI  DSL +LN   HIL+G+
Sbjct: 17  TTETKNQVKGGLLLDVVIGQGASVXXXLAGEDQTLLIWGDSLLILNLGLHILNGV 71



 Score = 42.3 bits (95), Expect = 0.016
 Identities = 22/52 (42%), Positives = 26/52 (50%)
 Frame = +3

Query: 720 EASTPGGGWIPSGYCSPRGYVHLPAAFQQRSTFVDWEGFPLCLEF*LSHSRW 875
           E   P  GW PSG C+  G VH  AA ++RS   D   FP   E    HS+W
Sbjct: 95  ETXEPSEGWTPSGCCNRTGCVHPQAACRRRSDAADLGEFPPYPESWPLHSQW 146


>UniRef50_A2FSJ6 Cluster: Ubiquitin family protein; n=2; Trichomonas
           vaginalis G3|Rep: Ubiquitin family protein - Trichomonas
           vaginalis G3
          Length = 76

 Score = 62.5 bits (145), Expect = 1e-08
 Identities = 24/54 (44%), Positives = 42/54 (77%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           ++  D +E++KAKIQ +EG+P NQQ LI++G +L +G T+ DY++++  T+HL+
Sbjct: 17  IDNYDRVEDIKAKIQAQEGVPLNQQDLIYSGMRLINGSTIQDYSLKRNDTIHLI 70


>UniRef50_Q5X991 Cluster: BUBL1 protein; n=2; Paramecium
           tetraurelia|Rep: BUBL1 protein - Paramecium tetraurelia
          Length = 862

 Score = 62.1 bits (144), Expect = 2e-08
 Identities = 29/48 (60%), Positives = 38/48 (79%)
 Frame = -2

Query: 876 TIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHL 733
           +IE +K  IQ++EGIPP+QQRLIF G  L+DG+ L +YNI  ESTL+L
Sbjct: 157 SIEQLKMLIQNREGIPPDQQRLIFEGILLQDGKMLWEYNIGPESTLYL 204



 Score = 35.5 bits (78), Expect = 1.8
 Identities = 16/48 (33%), Positives = 28/48 (58%)
 Frame = -2

Query: 885 PSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKEST 742
           P   ++N+K  I+ K+GIP   Q+L + G  ++D  +L DY + +  T
Sbjct: 370 PYFLVQNLKVIIEKKKGIPMIDQQLYYQGILMKDHFSLEDYKLLQNGT 417


>UniRef50_A7APS7 Cluster: Ubiquitin family protein; n=1; Babesia
           bovis|Rep: Ubiquitin family protein - Babesia bovis
          Length = 163

 Score = 62.1 bits (144), Expect = 2e-08
 Identities = 24/54 (44%), Positives = 40/54 (74%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           V+P+DT+   K K+  K+ +P +QQR+I+ GK L+D +TL++YNIQ  + +H+V
Sbjct: 104 VDPNDTVLEFKKKLSKKQKLPVDQQRIIYQGKMLQDHKTLAEYNIQNNAVIHMV 157


>UniRef50_Q2HDX3 Cluster: Putative uncharacterized protein; n=1;
           Chaetomium globosum|Rep: Putative uncharacterized
           protein - Chaetomium globosum (Soil fungus)
          Length = 104

 Score = 62.1 bits (144), Expect = 2e-08
 Identities = 28/54 (51%), Positives = 37/54 (68%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VE SD +  +K  +++KEGIPP QQRLI  GKQ+ D +T  DY +   +TLHLV
Sbjct: 44  VEGSDQVSKIKDLVEEKEGIPPAQQRLIHGGKQMVDDKTADDYALVGGATLHLV 97


>UniRef50_UPI0000D56A31 Cluster: PREDICTED: similar to CG15771-PA,
           isoform A; n=2; Endopterygota|Rep: PREDICTED: similar to
           CG15771-PA, isoform A - Tribolium castaneum
          Length = 309

 Score = 61.3 bits (142), Expect = 3e-08
 Identities = 26/48 (54%), Positives = 35/48 (72%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKE 748
           VEP+D I  +K K++++EGIPP QQRLI  GKQL+D RT+  Y  + E
Sbjct: 84  VEPTDKIITIKEKLEEREGIPPEQQRLIHQGKQLKDDRTIESYKFRGE 131


>UniRef50_UPI00006CB3CF Cluster: Ubiquitin family protein; n=1;
           Tetrahymena thermophila SB210|Rep: Ubiquitin family
           protein - Tetrahymena thermophila SB210
          Length = 480

 Score = 61.3 bits (142), Expect = 3e-08
 Identities = 29/53 (54%), Positives = 39/53 (73%)
 Frame = -2

Query: 888 EPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           E +D ++ VK  +Q K  +P  +QR+IFAGKQLED R L+ Y IQKESTL++V
Sbjct: 40  ECTDNVQRVKELVQIKLNMPIERQRIIFAGKQLEDHRILAGYGIQKESTLYVV 92


>UniRef50_UPI00006CAF49 Cluster: Ribosomal protein S27a containing
           protein; n=1; Tetrahymena thermophila SB210|Rep:
           Ribosomal protein S27a containing protein - Tetrahymena
           thermophila SB210
          Length = 189

 Score = 61.3 bits (142), Expect = 3e-08
 Identities = 28/65 (43%), Positives = 38/65 (58%)
 Frame = -2

Query: 690 NYSTPXXXXXXXXXXKLAVLRFYKVDENGKIHRLRRECTGEQCGAGVFMAVMEDRHYCGK 511
           +Y+T           KL  L FYK++ NGK+   ++ C   +CG G+FMA   DRHYCGK
Sbjct: 79  SYTTKKKTKHRHVHTKLGALAFYKLENNGKVSLQQKGCP--KCGPGIFMAKHYDRHYCGK 136

Query: 510 CHSTM 496
           CH T+
Sbjct: 137 CHLTL 141


>UniRef50_A0C9Z8 Cluster: Chromosome undetermined scaffold_160,
           whole genome shotgun sequence; n=1; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_160,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 226

 Score = 61.3 bits (142), Expect = 3e-08
 Identities = 28/31 (90%), Positives = 30/31 (96%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAG 799
           VEPSDTI+ VKAKIQDKEGIPP+QQRLIFAG
Sbjct: 196 VEPSDTIDAVKAKIQDKEGIPPDQQRLIFAG 226


>UniRef50_A2Q424 Cluster: Ubiquitin; TRAF-like; n=2; Medicago
           truncatula|Rep: Ubiquitin; TRAF-like - Medicago
           truncatula (Barrel medic)
          Length = 343

 Score = 60.5 bits (140), Expect = 6e-08
 Identities = 30/51 (58%), Positives = 36/51 (70%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTL 739
           V   DTI +VK KI D+       QRLIFAGKQL+D RT++DYNIQ EST+
Sbjct: 284 VNSLDTICSVKEKILDETEYSMQSQRLIFAGKQLDDSRTVADYNIQNESTI 334


>UniRef50_UPI0000E475A1 Cluster: PREDICTED: similar to ubiquitin;
           n=2; Strongylocentrotus purpuratus|Rep: PREDICTED:
           similar to ubiquitin - Strongylocentrotus purpuratus
          Length = 494

 Score = 59.7 bits (138), Expect = 1e-07
 Identities = 27/53 (50%), Positives = 36/53 (67%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHL 733
           V  SDT + +K ++  K GIPPN QRLI+ GKQ+E   TL +YNI + ST+ L
Sbjct: 137 VRLSDTADALKRQVDKKTGIPPNVQRLIYQGKQMEGSTTLEEYNIGQHSTIEL 189



 Score = 59.3 bits (137), Expect = 1e-07
 Identities = 27/51 (52%), Positives = 36/51 (70%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTL 739
           V  SDT  N+K ++  K GIPPN QRL+F  KQL+D  TL +Y I+K+ST+
Sbjct: 213 VHLSDTTNNLKRQVYKKIGIPPNIQRLVFGCKQLQDSWTLKEYGIRKQSTI 263



 Score = 48.8 bits (111), Expect = 2e-04
 Identities = 22/53 (41%), Positives = 35/53 (66%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHL 733
           V  SDT + +K +++ K  IPPN Q LI+ GK LE  + L +Y ++++ST+ L
Sbjct: 437 VRMSDTADALKRQVEKKICIPPNVQVLIYNGKLLEGSKALEEYGMRRDSTIEL 489


>UniRef50_A4VDK0 Cluster: Putative uncharacterized protein; n=1;
           Tetrahymena thermophila SB210|Rep: Putative
           uncharacterized protein - Tetrahymena thermophila SB210
          Length = 591

 Score = 59.7 bits (138), Expect = 1e-07
 Identities = 29/53 (54%), Positives = 41/53 (77%)
 Frame = -2

Query: 888 EPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           E SDTIEN++ KIQDK+GI  +QQRLI+  KQL+D +TL++  + +E TL L+
Sbjct: 328 ECSDTIENLQLKIQDKKGIHRDQQRLIYDNKQLDDKKTLNECGLFQEDTLLLL 380


>UniRef50_Q7T2M6 Cluster: Ubquitin-like protein 1; n=1; Carassius
           auratus|Rep: Ubquitin-like protein 1 - Carassius auratus
           (Goldfish)
          Length = 155

 Score = 59.3 bits (137), Expect = 1e-07
 Identities = 25/53 (47%), Positives = 39/53 (73%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHL 733
           VE ++T++ ++ KI  K+G+P +QQRLI+ G+QLE G  L DY+I   ST+H+
Sbjct: 96  VEVNETVDQLQTKIFRKDGVPKDQQRLIYNGRQLEAGMKLQDYDITSGSTIHM 148


>UniRef50_Q54V65 Cluster: Putative uncharacterized protein; n=1;
           Dictyostelium discoideum AX4|Rep: Putative
           uncharacterized protein - Dictyostelium discoideum AX4
          Length = 226

 Score = 59.3 bits (137), Expect = 1e-07
 Identities = 27/50 (54%), Positives = 37/50 (74%)
 Frame = -2

Query: 882 SDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHL 733
           S ++  +K+ I  KEGI  NQQ L+FAGK +ED +++SDY I KEST+HL
Sbjct: 35  SMSVTTLKSLIYTKEGIEVNQQALVFAGKPMEDCKSISDYYIHKESTIHL 84


>UniRef50_Q5KK31 Cluster: Ribosomal chaperone, putative; n=1;
           Filobasidiella neoformans|Rep: Ribosomal chaperone,
           putative - Cryptococcus neoformans (Filobasidiella
           neoformans)
          Length = 88

 Score = 59.3 bits (137), Expect = 1e-07
 Identities = 25/48 (52%), Positives = 34/48 (70%)
 Frame = -2

Query: 873 IENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           I  VK ++++K GIPP QQRLIF GK + D +T+ DY IQ  + +HLV
Sbjct: 29  ISKVKERVEEKAGIPPVQQRLIFGGKAMGDDKTIQDYKIQAGAAIHLV 76


>UniRef50_Q03919 Cluster: NEDD8-like protein RUB1 precursor; n=8;
           Eukaryota|Rep: NEDD8-like protein RUB1 precursor -
           Saccharomyces cerevisiae (Baker's yeast)
          Length = 77

 Score = 59.3 bits (137), Expect = 1e-07
 Identities = 25/54 (46%), Positives = 41/54 (75%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           ++ SD + ++K  +++KEGIPP+QQRLIF GKQ++D  T++D ++ +   LHLV
Sbjct: 17  LKESDLVYHIKELLEEKEGIPPSQQRLIFQGKQIDDKLTVTDAHLVEGMQLHLV 70


>UniRef50_Q013L7 Cluster: Glucose-repressible alcohol dehydrogenase
           transcriptional effector CCR4 and related proteins; n=2;
           Ostreococcus|Rep: Glucose-repressible alcohol
           dehydrogenase transcriptional effector CCR4 and related
           proteins - Ostreococcus tauri
          Length = 866

 Score = 58.8 bits (136), Expect = 2e-07
 Identities = 24/55 (43%), Positives = 40/55 (72%)
 Frame = +1

Query: 715 TTKPQHQVEGGFLLDIVVREGTSIFQLLSSKDQPLLIGRDSLFVLNFSFHILDGI 879
           T++ QHQVE   LLD+V+R+  ++ +LL  ++Q LLI RD+L +L+   H++DG+
Sbjct: 687 TSQAQHQVERRLLLDVVIRQRAAVLELLPRENQTLLIRRDALLILDLRLHVVDGV 741


>UniRef50_A7F3U9 Cluster: Putative uncharacterized protein; n=1;
           Sclerotinia sclerotiorum 1980|Rep: Putative
           uncharacterized protein - Sclerotinia sclerotiorum 1980
          Length = 418

 Score = 58.0 bits (134), Expect = 3e-07
 Identities = 29/50 (58%), Positives = 36/50 (72%)
 Frame = -2

Query: 879 DTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           +TIE +K  +   EGIP NQQRLIF GKQLED  TL D NI + +T+H+V
Sbjct: 203 ETIELLKDSVFIIEGIPANQQRLIFGGKQLEDQDTLWDCNIAEGATIHMV 252


>UniRef50_Q7T2M5 Cluster: Ubquitin-like protein 2; n=8;
           Clupeocephala|Rep: Ubquitin-like protein 2 - Carassius
           auratus (Goldfish)
          Length = 161

 Score = 57.2 bits (132), Expect = 5e-07
 Identities = 24/53 (45%), Positives = 39/53 (73%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHL 733
           V+ ++T++ ++ KI  KE +P +QQRLI++GKQLE G+ L DYNI   S +++
Sbjct: 102 VDVNETVDQLQTKIFQKERVPNDQQRLIYSGKQLEAGKKLQDYNITSGSIIYM 154


>UniRef50_A0C4L4 Cluster: Chromosome undetermined scaffold_15, whole
            genome shotgun sequence; n=7; Paramecium tetraurelia|Rep:
            Chromosome undetermined scaffold_15, whole genome shotgun
            sequence - Paramecium tetraurelia
          Length = 1027

 Score = 56.8 bits (131), Expect = 7e-07
 Identities = 26/64 (40%), Positives = 34/64 (53%)
 Frame = -2

Query: 690  NYSTPXXXXXXXXXXKLAVLRFYKVDENGKIHRLRRECTGEQCGAGVFMAVMEDRHYCGK 511
            N++ P          KLA L+ Y +D  G + R  ++C   QC  GV+MA   DRHYCG 
Sbjct: 917  NFAKPKKKKHRHRKVKLATLKLYTIDNKGVVQRSHKQCP--QCPQGVYMAKHFDRHYCGT 974

Query: 510  CHST 499
            CH T
Sbjct: 975  CHQT 978


>UniRef50_UPI0000604492 Cluster: PREDICTED: similar to ubiquitin
           A-52 residue ribosomal protein fusion product 1; n=1;
           Mus musculus|Rep: PREDICTED: similar to ubiquitin A-52
           residue ribosomal protein fusion product 1 - Mus
           musculus
          Length = 177

 Score = 56.0 bits (129), Expect = 1e-06
 Identities = 32/55 (58%), Positives = 38/55 (69%), Gaps = 1/55 (1%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDG-RTLSDYNIQKESTLHLV 730
           +EPS+TIENVK KIQD+ GIP     L    +Q   G  TLSDY IQ+ESTLHL+
Sbjct: 54  IEPSNTIENVKVKIQDEGGIP-----LDHPHQQTSGGCHTLSDYGIQEESTLHLM 103


>UniRef50_Q91890 Cluster: Ubiquitin-like fusion protein; n=6;
           Eumetazoa|Rep: Ubiquitin-like fusion protein - Xenopus
           laevis (African clawed frog)
          Length = 701

 Score = 56.0 bits (129), Expect = 1e-06
 Identities = 28/54 (51%), Positives = 37/54 (68%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           V P +T+ +VK+KIQ  EGIP  QQ LI+   +LED  +LSDYNI +  TL +V
Sbjct: 44  VSPYETVTSVKSKIQRLEGIPVAQQHLIWNNMELEDECSLSDYNISEGCTLKMV 97


>UniRef50_Q4MZU6 Cluster: Putative uncharacterized protein; n=1;
           Theileria parva|Rep: Putative uncharacterized protein -
           Theileria parva
          Length = 513

 Score = 56.0 bits (129), Expect = 1e-06
 Identities = 25/54 (46%), Positives = 37/54 (68%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           ++ S+T+ NVK+ I+ + GIP + QRLIF G  L+D  TL  YNI   +T+H+V
Sbjct: 19  LDSSNTVRNVKSLIEVRNGIPASHQRLIFRGHLLKDDHTLDFYNITSGNTIHIV 72


>UniRef50_Q4UDK2 Cluster: Ubiquitin,putative; n=2; Theileria|Rep:
           Ubiquitin,putative - Theileria annulata
          Length = 170

 Score = 55.2 bits (127), Expect = 2e-06
 Identities = 24/54 (44%), Positives = 40/54 (74%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           V  ++T+ ++K K++ ++ IP +QQRLIF GK LE+G+T++DY I+  + L LV
Sbjct: 111 VSQNETVLDLKNKLEKEQTIPVDQQRLIFDGKLLENGKTIADYGIKDNAVLQLV 164


>UniRef50_Q4CNV2 Cluster: Ubiquitin, putative; n=2; Trypanosoma|Rep:
           Ubiquitin, putative - Trypanosoma cruzi
          Length = 78

 Score = 55.2 bits (127), Expect = 2e-06
 Identities = 23/50 (46%), Positives = 35/50 (70%)
 Frame = -2

Query: 879 DTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           +TI  +K K+++ EGIP    RL++ GKQLEDG+ + +Y I   +TLH+V
Sbjct: 22  NTIAELKEKLEESEGIPGKMIRLVYQGKQLEDGKRIKEYPIAAGATLHMV 71


>UniRef50_A2FER2 Cluster: Ubiquitin family protein; n=3; Trichomonas
           vaginalis G3|Rep: Ubiquitin family protein - Trichomonas
           vaginalis G3
          Length = 378

 Score = 55.2 bits (127), Expect = 2e-06
 Identities = 26/48 (54%), Positives = 33/48 (68%)
 Frame = -2

Query: 876 TIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHL 733
           TIE++K  I  K G+ P  QRLIFAGKQ+ED  TL DYN+    T++L
Sbjct: 236 TIEDLKIFIDYKLGVYPESQRLIFAGKQMEDENTLMDYNVHDGDTINL 283


>UniRef50_Q4RSW8 Cluster: Chromosome 12 SCAF14999, whole genome
           shotgun sequence; n=3; Percomorpha|Rep: Chromosome 12
           SCAF14999, whole genome shotgun sequence - Tetraodon
           nigroviridis (Green puffer)
          Length = 158

 Score = 54.8 bits (126), Expect = 3e-06
 Identities = 22/54 (40%), Positives = 36/54 (66%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           V+P + +   K K+Q KE +  +QQRL+  G+++ DG  LSDY +Q +ST+ L+
Sbjct: 99  VKPDEAVTEFKKKVQTKERVQASQQRLLHQGREMMDGYKLSDYGVQNQSTIELM 152


>UniRef50_UPI0000498E95 Cluster: 40S ribosomal protein S27a; n=1;
           Entamoeba histolytica HM-1:IMSS|Rep: 40S ribosomal
           protein S27a - Entamoeba histolytica HM-1:IMSS
          Length = 139

 Score = 52.8 bits (121), Expect = 1e-05
 Identities = 22/47 (46%), Positives = 29/47 (61%)
 Frame = -2

Query: 642 LAVLRFYKVDENGKIHRLRRECTGEQCGAGVFMAVMEDRHYCGKCHS 502
           LA L  Y V   GK+ RLR+ C  ++CG   F+A  +DR  CGKCH+
Sbjct: 87  LACLTHYNVTSAGKVERLRKCCANKKCGVACFLAQHKDRLTCGKCHT 133


>UniRef50_UPI000023DB70 Cluster: hypothetical protein FG00163.1;
           n=1; Gibberella zeae PH-1|Rep: hypothetical protein
           FG00163.1 - Gibberella zeae PH-1
          Length = 400

 Score = 52.8 bits (121), Expect = 1e-05
 Identities = 22/52 (42%), Positives = 35/52 (67%)
 Frame = -2

Query: 888 EPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHL 733
           E   T++++K +I D  G  P+QQ LI+ GK+LED R  +DY++Q+ S + L
Sbjct: 198 ENDSTVQDIKDRIHDTRGTRPDQQLLIYEGKELEDARKWTDYSLQRASIIFL 249


>UniRef50_Q22X50 Cluster: Ubiquitin family protein; n=2; Tetrahymena
           thermophila SB210|Rep: Ubiquitin family protein -
           Tetrahymena thermophila SB210
          Length = 745

 Score = 52.4 bits (120), Expect = 1e-05
 Identities = 23/48 (47%), Positives = 35/48 (72%)
 Frame = -2

Query: 873 IENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           +E +K +I ++  I P QQRLI+AG+QLED + L  YN+Q++  +HLV
Sbjct: 389 VEQLKNQISEQLEISPTQQRLIYAGQQLEDDQQLYFYNLQRDCVVHLV 436



 Score = 50.8 bits (116), Expect = 5e-05
 Identities = 24/50 (48%), Positives = 34/50 (68%)
 Frame = -2

Query: 879 DTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           D++E +K  IQD EGIP +QQRLIF GK++E+  +L  Y I     ++LV
Sbjct: 484 DSVEILKYHIQDSEGIPIDQQRLIFQGKEIENDYSLDMYEIDDGDIINLV 533



 Score = 44.8 bits (101), Expect = 0.003
 Identities = 20/51 (39%), Positives = 32/51 (62%)
 Frame = -2

Query: 882 SDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           ++TI+ +K K+     +     +LIF G+QLED  TL++Y I+  S +HLV
Sbjct: 299 NNTIDQIKQKLSSLSEVECEFMKLIFCGRQLEDNFTLNNYEIKDGSIIHLV 349


>UniRef50_A2ECR8 Cluster: Ubiquitin family protein; n=1; Trichomonas
           vaginalis G3|Rep: Ubiquitin family protein - Trichomonas
           vaginalis G3
          Length = 79

 Score = 52.4 bits (120), Expect = 1e-05
 Identities = 21/54 (38%), Positives = 36/54 (66%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VE +DTIE +K+++   +GI P+QQR+++ G  L D  T+    I+ + T+H+V
Sbjct: 19  VEQTDTIEKIKSQLYSMDGIAPDQQRILYKGLALPDTATIESSGIKNDETVHMV 72


>UniRef50_UPI0000D56CAF Cluster: PREDICTED: similar to AN1,
           ubiquitin-like, homolog; n=1; Tribolium castaneum|Rep:
           PREDICTED: similar to AN1, ubiquitin-like, homolog -
           Tribolium castaneum
          Length = 563

 Score = 52.0 bits (119), Expect = 2e-05
 Identities = 25/54 (46%), Positives = 34/54 (62%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           V  +DT+  +K +IQ  EGIP +QQ LIF  K+L+D R L D  I+  S + LV
Sbjct: 31  VSATDTVREIKQRIQRVEGIPIHQQNLIFQSKELKDSRRLCDAGIKNGSIIKLV 84


>UniRef50_Q06Z45 Cluster: Interferon stimulated gene 15; n=1; Gadus
           morhua|Rep: Interferon stimulated gene 15 - Gadus morhua
           (Atlantic cod)
          Length = 158

 Score = 52.0 bits (119), Expect = 2e-05
 Identities = 22/54 (40%), Positives = 37/54 (68%), Gaps = 1/54 (1%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDG-RTLSDYNIQKESTLHL 733
           V P +T+   K K++ +E +  +QQRL+   KQ++DG RTL  YN+++ ST++L
Sbjct: 98  VRPGETVAGFKLKVKQREKVAEDQQRLMHESKQMDDGSRTLESYNVKEGSTIYL 151


>UniRef50_Q9FH07 Cluster: Arabidopsis thaliana genomic DNA,
           chromosome 5, TAC clone:K5J14; n=2; Arabidopsis
           thaliana|Rep: Arabidopsis thaliana genomic DNA,
           chromosome 5, TAC clone:K5J14 - Arabidopsis thaliana
           (Mouse-ear cress)
          Length = 902

 Score = 52.0 bits (119), Expect = 2e-05
 Identities = 23/54 (42%), Positives = 35/54 (64%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           V  ++T+   K KI  + G+P  QQRLIF G+ L+D   LS+Y+++   TLHL+
Sbjct: 63  VNKNETVLLFKEKIASETGVPVGQQRLIFRGRVLKDDHPLSEYHLENGHTLHLI 116


>UniRef50_Q54MD2 Cluster: Putative uncharacterized protein; n=3;
           Dictyostelium discoideum AX4|Rep: Putative
           uncharacterized protein - Dictyostelium discoideum AX4
          Length = 312

 Score = 52.0 bits (119), Expect = 2e-05
 Identities = 23/53 (43%), Positives = 35/53 (66%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHL 733
           V+ S+ ++N+K KI+ K  +P   Q L + GK+LED   +SDYNI   ST+H+
Sbjct: 82  VKESELVKNIKGKIRYKIDLPVRFQTLYYCGKKLEDDHLISDYNITYGSTIHM 134


>UniRef50_O13255 Cluster: 2',5'-oligo adenylate synthetase A; n=11;
           Gallus gallus|Rep: 2',5'-oligo adenylate synthetase A -
           Gallus gallus (Chicken)
          Length = 514

 Score = 51.6 bits (118), Expect = 3e-05
 Identities = 21/54 (38%), Positives = 37/54 (68%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           V P+DT++ +K +I  ++ +P  QQRL +  K+LE+  TL  Y++Q  ST++L+
Sbjct: 444 VRPTDTVKQLKQQIYARQHVPVEQQRLTYETKELENHHTLEHYHVQPRSTIYLL 497


>UniRef50_A2Z8U3 Cluster: Putative uncharacterized protein; n=1;
           Oryza sativa (indica cultivar-group)|Rep: Putative
           uncharacterized protein - Oryza sativa subsp. indica
           (Rice)
          Length = 204

 Score = 51.2 bits (117), Expect = 3e-05
 Identities = 28/56 (50%), Positives = 40/56 (71%), Gaps = 3/56 (5%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQL--EDG-RTLSDYNIQKESTLHL 733
           VEPS+T++ +K KIQDKEGI  +   L  AG++L  EDG   L+DY +Q EST+++
Sbjct: 49  VEPSNTVKILKEKIQDKEGIMQSDFWLHHAGERLAEEDGDHLLADYGVQNESTVYI 104


>UniRef50_A0E5Z2 Cluster: Chromosome undetermined scaffold_8, whole
           genome shotgun sequence; n=3; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_8,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 458

 Score = 51.2 bits (117), Expect = 3e-05
 Identities = 21/53 (39%), Positives = 38/53 (71%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHL 733
           ++P++T++ +K  IQ+K  IP ++QRLI+ G+ LE+ +TL DY +Q +  + L
Sbjct: 21  IDPNNTVQQLKNVIQNKLNIPFDKQRLIYQGRVLENNKTLQDYKLQNDHVVLL 73


>UniRef50_Q7XDE7 Cluster: Ubiquitin family protein, expressed; n=5;
           Oryza sativa|Rep: Ubiquitin family protein, expressed -
           Oryza sativa subsp. japonica (Rice)
          Length = 328

 Score = 50.8 bits (116), Expect = 5e-05
 Identities = 21/51 (41%), Positives = 39/51 (76%)
 Frame = -2

Query: 882 SDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           S++I ++KA+I+ +EGI  N+Q L++AG+QLED + LS  +++ + T H++
Sbjct: 112 SNSIADIKAEIEQEEGILMNEQILMYAGQQLEDNQLLSQCDLRNDQTFHVL 162



 Score = 46.4 bits (105), Expect = 0.001
 Identities = 20/53 (37%), Positives = 34/53 (64%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHL 733
           V  +DT++ +K+K+   EGI  ++Q + FAG  L++   L+DYNI   S++ L
Sbjct: 34  VNSTDTVDQIKSKLSAIEGIDKSKQEMFFAGMHLKNEDKLADYNIMTNSSVDL 86


>UniRef50_Q4UIY1 Cluster: Ubiquitin-related chaperonin, putative;
           n=2; Theileria|Rep: Ubiquitin-related chaperonin,
           putative - Theileria annulata
          Length = 319

 Score = 50.8 bits (116), Expect = 5e-05
 Identities = 23/54 (42%), Positives = 34/54 (62%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VEP  T+  +K K  DK   P ++QRLIF G+ ++D   LS  N++  +T+HLV
Sbjct: 19  VEPEMTVLQLKEKCSDKANAPADKQRLIFKGRIIKDEEVLSALNVEDGNTIHLV 72


>UniRef50_A0BZP2 Cluster: Chromosome undetermined scaffold_14, whole
           genome shotgun sequence; n=2; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_14,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 353

 Score = 50.8 bits (116), Expect = 5e-05
 Identities = 21/54 (38%), Positives = 37/54 (68%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           ++P+ T++ +K K+  K    P+Q ++IF GK L+D   LS+ N++ +ST+HLV
Sbjct: 20  IDPNVTVKELKEKLTPKFNSEPSQMKIIFQGKILKDNDILSNVNVKTDSTMHLV 73


>UniRef50_Q5C0U3 Cluster: SJCHGC08803 protein; n=1; Schistosoma
           japonicum|Rep: SJCHGC08803 protein - Schistosoma
           japonicum (Blood fluke)
          Length = 193

 Score = 50.4 bits (115), Expect = 6e-05
 Identities = 25/54 (46%), Positives = 35/54 (64%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           V P++T+ +VK +IQ   GIP  QQ LI+   +L+D   L DY+I + STL LV
Sbjct: 19  VSPTETVVSVKFEIQRAGGIPITQQHLIWQNNELDDHCCLKDYSISEGSTLRLV 72


>UniRef50_P11441 Cluster: Ubiquitin-like protein 4A; n=32;
           Euteleostomi|Rep: Ubiquitin-like protein 4A - Homo
           sapiens (Human)
          Length = 157

 Score = 50.4 bits (115), Expect = 6e-05
 Identities = 23/54 (42%), Positives = 33/54 (61%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           V   + +  +K  + +K  +P  QQRL+F GK L DG+ LSDY+I   S L+LV
Sbjct: 17  VPEDELVSTLKQLVSEKLNVPVRQQRLLFKGKALADGKRLSDYSIGPNSKLNLV 70


>UniRef50_A7R2A7 Cluster: Chromosome undetermined scaffold_411,
           whole genome shotgun sequence; n=1; Vitis vinifera|Rep:
           Chromosome undetermined scaffold_411, whole genome
           shotgun sequence - Vitis vinifera (Grape)
          Length = 903

 Score = 50.0 bits (114), Expect = 8e-05
 Identities = 22/44 (50%), Positives = 32/44 (72%)
 Frame = -2

Query: 861 KAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           K KI ++ G+P  QQRLIF GK L+D + L++Y+++   TLHLV
Sbjct: 50  KEKIANEIGVPVEQQRLIFRGKVLKDDQLLAEYHVENGHTLHLV 93


>UniRef50_A2ESV4 Cluster: Ubiquitin family protein; n=1; Trichomonas
           vaginalis G3|Rep: Ubiquitin family protein - Trichomonas
           vaginalis G3
          Length = 303

 Score = 50.0 bits (114), Expect = 8e-05
 Identities = 25/51 (49%), Positives = 31/51 (60%)
 Frame = -2

Query: 882 SDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           SDT+  VK  + +K  + PNQ RL+FAGK L D  TL  Y I   S L+LV
Sbjct: 24  SDTVNTVKELLVEKTSLQPNQMRLVFAGKVLSDEITLQFYEIVDGSKLYLV 74


>UniRef50_Q86XD8 Cluster: AN1-type zinc finger and ubiquitin
           domain-containing protein 1; n=30; Eumetazoa|Rep:
           AN1-type zinc finger and ubiquitin domain-containing
           protein 1 - Homo sapiens (Human)
          Length = 727

 Score = 50.0 bits (114), Expect = 8e-05
 Identities = 26/54 (48%), Positives = 36/54 (66%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           V P +T+ +VKAKI+  EGIP  +Q LI+   +LE+   L+DYNI +  TL LV
Sbjct: 44  VSPFETVISVKAKIRRLEGIPICRQHLIWNNMELENDYCLNDYNISEGCTLKLV 97


>UniRef50_UPI0001554F34 Cluster: PREDICTED: similar to AN1,
           ubiquitin-like, homolog; n=2; Ornithorhynchus
           anatinus|Rep: PREDICTED: similar to AN1, ubiquitin-like,
           homolog - Ornithorhynchus anatinus
          Length = 728

 Score = 49.6 bits (113), Expect = 1e-04
 Identities = 26/54 (48%), Positives = 33/54 (61%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           V P +T+ +VKAKIQ  EGIP  QQ LI+   +LED   L+DYN+   S    V
Sbjct: 70  VSPFETVISVKAKIQRLEGIPICQQHLIWNNVELEDDYCLNDYNVSLASCFRQV 123


>UniRef50_Q9VEP9 Cluster: CG16941-PA; n=7; Endopterygota|Rep:
           CG16941-PA - Drosophila melanogaster (Fruit fly)
          Length = 784

 Score = 49.6 bits (113), Expect = 1e-04
 Identities = 19/50 (38%), Positives = 34/50 (68%)
 Frame = -2

Query: 882 SDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHL 733
           S+ I N+K K+QD+ G+PP +Q++ + G   +D  T++ YN+   +T+HL
Sbjct: 725 SEPIANLKTKLQDETGMPPAKQKIFYEGMFFKDSNTMAFYNLVNGTTVHL 774


>UniRef50_A0C2N0 Cluster: Chromosome undetermined scaffold_145,
           whole genome shotgun sequence; n=2; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_145,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 77

 Score = 49.6 bits (113), Expect = 1e-04
 Identities = 20/54 (37%), Positives = 36/54 (66%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           +E  +TI+ +K ++Q+KEGI   Q +LIF G+ L++   ++D  +Q   T+H+V
Sbjct: 17  IEADNTIQQLKMQLQEKEGISSEQFKLIFKGRHLQEDNKIADAQMQAGDTVHMV 70


>UniRef50_Q84UT7 Cluster: Calreticulin interacted protein; n=7;
           Oryza sativa|Rep: Calreticulin interacted protein -
           Oryza sativa (Rice)
          Length = 966

 Score = 49.2 bits (112), Expect = 1e-04
 Identities = 22/45 (48%), Positives = 32/45 (71%)
 Frame = -2

Query: 864 VKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           +K KI +  G+P +QQRLIF G+ L+D   LS+Y+++   TLHLV
Sbjct: 49  LKEKIVEATGVPVDQQRLIFRGRVLKDDHLLSEYHLEDGYTLHLV 93


>UniRef50_Q4Q2Y8 Cluster: Ubiquitin-like protein; n=3;
           Leishmania|Rep: Ubiquitin-like protein - Leishmania
           major
          Length = 80

 Score = 49.2 bits (112), Expect = 1e-04
 Identities = 20/52 (38%), Positives = 35/52 (67%)
 Frame = -2

Query: 885 PSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           P +T+ ++KAK+++ EGIP     L+ +G++LED  TL + NI    T+++V
Sbjct: 22  PDNTVGDIKAKLEETEGIPQKMIMLVHSGRKLEDNATLEECNIHAGITINMV 73


>UniRef50_Q7QYQ3 Cluster: GLP_393_14301_14531; n=1; Giardia lamblia
           ATCC 50803|Rep: GLP_393_14301_14531 - Giardia lamblia
           ATCC 50803
          Length = 76

 Score = 48.8 bits (111), Expect = 2e-04
 Identities = 20/54 (37%), Positives = 38/54 (70%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           V P++TI ++K K+ D+EGI P QQ++++  +QL++  T+ + N++   T+ LV
Sbjct: 17  VAPTETILDIKNKVYDQEGIHPAQQKMLYLAQQLQNTTTVEEANLKAGITIQLV 70


>UniRef50_Q96T88 Cluster: E3 ubiquitin-protein ligase UHRF1; n=44;
           Eumetazoa|Rep: E3 ubiquitin-protein ligase UHRF1 - Homo
           sapiens (Human)
          Length = 793

 Score = 48.8 bits (111), Expect = 2e-04
 Identities = 20/48 (41%), Positives = 31/48 (64%)
 Frame = -2

Query: 873 IENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           +E ++ KIQ+   + P  QRL + GKQ+EDG TL DY ++   T+ L+
Sbjct: 25  VEELRRKIQELFHVEPGLQRLFYRGKQMEDGHTLFDYEVRLNDTIQLL 72


>UniRef50_Q4SKY0 Cluster: Chromosome 17 SCAF14563, whole genome
           shotgun sequence; n=3; Euteleostomi|Rep: Chromosome 17
           SCAF14563, whole genome shotgun sequence - Tetraodon
           nigroviridis (Green puffer)
          Length = 695

 Score = 48.4 bits (110), Expect = 2e-04
 Identities = 26/54 (48%), Positives = 33/54 (61%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           V P + + +VKAKIQ  EGIP  QQ LI+   +L+D   L DY I +  TL LV
Sbjct: 44  VLPFEAVVSVKAKIQRLEGIPVAQQHLIWNNLELDDEHCLHDYGIAEGCTLKLV 97


>UniRef50_Q23CW9 Cluster: Putative uncharacterized protein; n=1;
            Tetrahymena thermophila SB210|Rep: Putative
            uncharacterized protein - Tetrahymena thermophila SB210
          Length = 1456

 Score = 48.4 bits (110), Expect = 2e-04
 Identities = 21/51 (41%), Positives = 34/51 (66%)
 Frame = -2

Query: 882  SDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
            SDTI+ +K +++    IP ++QRLIF+G+ L D +TL D  I+    +HL+
Sbjct: 1007 SDTIKYLKEEVEQALNIPIDKQRLIFSGRYLRDDQTLKDNQIENGHVIHLI 1057


>UniRef50_A2G7G9 Cluster: Ubiquitin family protein; n=1; Trichomonas
           vaginalis G3|Rep: Ubiquitin family protein - Trichomonas
           vaginalis G3
          Length = 76

 Score = 48.4 bits (110), Expect = 2e-04
 Identities = 23/54 (42%), Positives = 33/54 (61%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VEPS TI  +K ++  +EGI   QQRL+F G+ L D +T+   +I     LH+V
Sbjct: 17  VEPSITIAAIKEELLQREGISIEQQRLLFRGQNLTDNQTVETAHISAGEVLHMV 70


>UniRef50_P48510 Cluster: Ubiquitin domain-containing protein DSK2;
           n=11; Saccharomycetales|Rep: Ubiquitin domain-containing
           protein DSK2 - Saccharomyces cerevisiae (Baker's yeast)
          Length = 373

 Score = 48.4 bits (110), Expect = 2e-04
 Identities = 23/54 (42%), Positives = 32/54 (59%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           V P  T+   K  I    GIP   QRLI++GK L+D +T+  Y+IQ   ++HLV
Sbjct: 18  VAPESTVLQFKEAINKANGIPVANQRLIYSGKILKDDQTVESYHIQDGHSVHLV 71


>UniRef50_P91057 Cluster: Putative uncharacterized protein; n=1;
           Caenorhabditis elegans|Rep: Putative uncharacterized
           protein - Caenorhabditis elegans
          Length = 226

 Score = 48.0 bits (109), Expect = 3e-04
 Identities = 21/51 (41%), Positives = 33/51 (64%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTL 739
           +   DT+ ++K  I+ +  IP +   L F+GK+LED  ++ DYNIQK ST+
Sbjct: 169 IHREDTVFDIKNDIEHRHDIPQHSYWLSFSGKRLEDHCSIGDYNIQKSSTI 219


>UniRef50_Q33AC4 Cluster: Protein kinase domain containing protein,
           expressed; n=7; Oryza sativa|Rep: Protein kinase domain
           containing protein, expressed - Oryza sativa subsp.
           japonica (Rice)
          Length = 795

 Score = 47.6 bits (108), Expect = 4e-04
 Identities = 20/54 (37%), Positives = 38/54 (70%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           V+ S+++ +VK +I+ KEGI  + Q L++AG+QL+D + LS + +  +  LH++
Sbjct: 540 VKNSNSVADVKVEIERKEGILQDNQMLMYAGRQLDDRQILSHFGLSDDQILHVL 593


>UniRef50_Q4P3T5 Cluster: Putative uncharacterized protein; n=1;
           Ustilago maydis|Rep: Putative uncharacterized protein -
           Ustilago maydis (Smut fungus)
          Length = 447

 Score = 47.6 bits (108), Expect = 4e-04
 Identities = 21/50 (42%), Positives = 36/50 (72%)
 Frame = -2

Query: 888 EPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTL 739
           E +DTI  +K+KIQ+++G  P  Q++IF+GK L D +T++D  I+++  L
Sbjct: 18  ELTDTIGTIKSKIQNEQGHAPELQKIIFSGKILTDDKTVADCKIKEKDFL 67


>UniRef50_A4RK10 Cluster: Putative uncharacterized protein; n=1;
           Magnaporthe grisea|Rep: Putative uncharacterized protein
           - Magnaporthe grisea (Rice blast fungus) (Pyricularia
           grisea)
          Length = 401

 Score = 47.6 bits (108), Expect = 4e-04
 Identities = 21/48 (43%), Positives = 32/48 (66%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKE 748
           VEP+D I  VK KI ++ G  P  Q+LI++GK L+D  T+  Y I+++
Sbjct: 17  VEPTDLISAVKQKISEERGWDPKLQKLIYSGKILKDEETVESYKIEEK 64


>UniRef50_Q7SZF4 Cluster: HLA-B-associated transcript 3; n=5; Danio
           rerio|Rep: HLA-B-associated transcript 3 - Danio rerio
           (Zebrafish) (Brachydanio rerio)
          Length = 1209

 Score = 47.2 bits (107), Expect = 6e-04
 Identities = 22/54 (40%), Positives = 36/54 (66%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VE   T+++ K  I    GIP ++QRLI+ G+ L+D +TL++YN+  +  +HLV
Sbjct: 25  VEAQMTVKDFKEHISPSVGIPVDKQRLIYQGRVLQDEKTLTEYNVDGK-VIHLV 77


>UniRef50_Q4UC28 Cluster: Putative uncharacterized protein; n=1;
           Theileria annulata|Rep: Putative uncharacterized protein
           - Theileria annulata
          Length = 518

 Score = 47.2 bits (107), Expect = 6e-04
 Identities = 21/54 (38%), Positives = 34/54 (62%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           ++ S ++  +KA I+   G P N  RLI+ G+ L+D  TL  YNI  ++T+H+V
Sbjct: 19  MDTSTSVRRIKAFIELYNGSPANSLRLIYRGQLLKDDYTLDSYNITTDNTIHVV 72


>UniRef50_Q0DJQ4 Cluster: Os05g0242100 protein; n=3; Oryza
           sativa|Rep: Os05g0242100 protein - Oryza sativa subsp.
           japonica (Rice)
          Length = 312

 Score = 46.8 bits (106), Expect = 7e-04
 Identities = 20/56 (35%), Positives = 38/56 (67%)
 Frame = +1

Query: 712 ATTKPQHQVEGGFLLDIVVREGTSIFQLLSSKDQPLLIGRDSLFVLNFSFHILDGI 879
           ++ + + +VEGG  L++V+ EG S+ +LL+ KD+ LL+  ++L VLN    I++ +
Sbjct: 195 SSPEAKDKVEGGLFLNVVICEGASVLKLLARKDEALLVRWNTLLVLNLGLDIVNRV 250



 Score = 41.5 bits (93), Expect = 0.028
 Identities = 19/39 (48%), Positives = 29/39 (74%)
 Frame = +1

Query: 775 GTSIFQLLSSKDQPLLIGRDSLFVLNFSFHILDGI*RLD 891
           G +I +LL+SKDQ LLI  ++L VLN  FH+++ + RL+
Sbjct: 19  GAAILELLASKDQSLLIRGNALLVLNLCFHVVNCVRRLN 57



 Score = 41.5 bits (93), Expect = 0.028
 Identities = 20/46 (43%), Positives = 31/46 (67%)
 Frame = +1

Query: 754 LDIVVREGTSIFQLLSSKDQPLLIGRDSLFVLNFSFHILDGI*RLD 891
           L++ V +G S+ +LL+ +D+ LL+  D+L VLN    I+D I RLD
Sbjct: 56  LNLQVSQGASVLELLAGEDEALLVRGDALLVLNLRLLIVDCIRRLD 101



 Score = 41.5 bits (93), Expect = 0.028
 Identities = 19/50 (38%), Positives = 35/50 (70%)
 Frame = +1

Query: 712 ATTKPQHQVEGGFLLDIVVREGTSIFQLLSSKDQPLLIGRDSLFVLNFSF 861
           A+ +P+H+V+ G  L++VVR+G +I +LL+SKD+    G+  +  L++ F
Sbjct: 118 ASPQPKHKVKSGLFLNVVVRQGPTILKLLASKDKD-AAGQGGIHSLSWIF 166


>UniRef50_Q4YYI6 Cluster: Ubiquitin-like protein, putative; n=3;
           Plasmodium (Vinckeia)|Rep: Ubiquitin-like protein,
           putative - Plasmodium berghei
          Length = 1370

 Score = 46.8 bits (106), Expect = 7e-04
 Identities = 20/54 (37%), Positives = 35/54 (64%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           V+ + T E +K  I +K+ +  N  RLI+ G+ L + +T+++YNIQ +  +HLV
Sbjct: 22  VKKNTTTEELKGMISEKKNVDINDIRLIYQGQCLSNTKTIAEYNIQNDHIIHLV 75


>UniRef50_A7ASK4 Cluster: Ubiquitin domain containing protein
           family; n=1; Babesia bovis|Rep: Ubiquitin domain
           containing protein family - Babesia bovis
          Length = 318

 Score = 46.8 bits (106), Expect = 7e-04
 Identities = 23/54 (42%), Positives = 32/54 (59%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VE S TI  +K K  D+ G  P  QRLIF G+ ++D  TL    ++  +T+HLV
Sbjct: 19  VELSMTILELKGKCADRAGATPENQRLIFKGRIVKDEDTLESLKVEDGNTIHLV 72


>UniRef50_Q5KMP1 Cluster: Putative uncharacterized protein; n=1;
           Filobasidiella neoformans|Rep: Putative uncharacterized
           protein - Cryptococcus neoformans (Filobasidiella
           neoformans)
          Length = 396

 Score = 46.8 bits (106), Expect = 7e-04
 Identities = 21/54 (38%), Positives = 32/54 (59%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           V P   +  +K  I  K  +  ++QRLI++GK L+D  T+S Y IQ   T+H+V
Sbjct: 29  VSPDKNVAELKQLIASKCDVEKDRQRLIYSGKVLKDEETISSYKIQNGHTIHMV 82


>UniRef50_O15205 Cluster: Ubiquitin D; n=18; Eutheria|Rep: Ubiquitin
           D - Homo sapiens (Human)
          Length = 165

 Score = 46.8 bits (106), Expect = 7e-04
 Identities = 23/53 (43%), Positives = 33/53 (62%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHL 733
           V  S ++  VKA I+ K GI P  Q +   GK+LEDG+ ++DY I+K + L L
Sbjct: 106 VRRSSSVAQVKAMIETKTGIIPETQIVTCNGKRLEDGKMMADYGIRKGNLLFL 158


>UniRef50_Q6C7B6 Cluster: Similar to sp|P48510 Saccharomyces
           cerevisiae YMR276w DSK2 ubiquitin- like protein; n=1;
           Yarrowia lipolytica|Rep: Similar to sp|P48510
           Saccharomyces cerevisiae YMR276w DSK2 ubiquitin- like
           protein - Yarrowia lipolytica (Candida lipolytica)
          Length = 343

 Score = 46.4 bits (105), Expect = 0.001
 Identities = 21/52 (40%), Positives = 36/52 (69%), Gaps = 1/52 (1%)
 Frame = -2

Query: 882 SDT-IENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           +DT +  VK ++  +  IP  +QRLI++G+ L+DG T+  YNI++  ++HLV
Sbjct: 21  NDTLVSKVKEQMAKELDIPAERQRLIYSGRVLKDGETVGSYNIKEGHSVHLV 72


>UniRef50_A0RUP3 Cluster: Ribosomal protein S27AE; n=1; Cenarchaeum
           symbiosum|Rep: Ribosomal protein S27AE - Cenarchaeum
           symbiosum
          Length = 55

 Score = 46.4 bits (105), Expect = 0.001
 Identities = 24/46 (52%), Positives = 30/46 (65%)
 Frame = -2

Query: 636 VLRFYKVDENGKIHRLRRECTGEQCGAGVFMAVMEDRHYCGKCHST 499
           V RFYK+ E+GK  +LR  C+  +CG G FMA  +DR  CGKC  T
Sbjct: 9   VHRFYKI-EDGKTVKLRHICS--RCGKGFFMAQHKDRRSCGKCGLT 51


>UniRef50_Q9SU29 Cluster: Polyubiquitin-like protein; n=2; core
           eudicotyledons|Rep: Polyubiquitin-like protein -
           Arabidopsis thaliana (Mouse-ear cress)
          Length = 873

 Score = 46.0 bits (104), Expect = 0.001
 Identities = 21/53 (39%), Positives = 37/53 (69%)
 Frame = -2

Query: 888 EPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           E  DT+E +  +I+ K  IP  +QR+I+ GKQL+   +L+ Y+I+++++L LV
Sbjct: 113 EKYDTVEKLHQRIEWKTKIPALEQRVIYKGKQLQRENSLTYYSIEQDASLQLV 165


>UniRef50_Q7XD49 Cluster: Putative uncharacterized protein; n=4;
           Oryza sativa|Rep: Putative uncharacterized protein -
           Oryza sativa subsp. japonica (Rice)
          Length = 280

 Score = 46.0 bits (104), Expect = 0.001
 Identities = 25/51 (49%), Positives = 35/51 (68%), Gaps = 2/51 (3%)
 Frame = -2

Query: 888 EPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLED--GRTLSDYNIQKEST 742
           EPSDT+E+VKAKI+D  GI  +   L + GKQ+++   RTL+DY I   +T
Sbjct: 26  EPSDTVESVKAKIKDMSGITEDFW-LRYDGKQMDEVGSRTLADYGIHDPAT 75


>UniRef50_Q95TI4 Cluster: SD01679p; n=10; Endopterygota|Rep:
           SD01679p - Drosophila melanogaster (Fruit fly)
          Length = 482

 Score = 46.0 bits (104), Expect = 0.001
 Identities = 19/54 (35%), Positives = 34/54 (62%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           +EP   I+NVK  +  + G+ P+  ++IFAGK+L D  T+   ++ ++S LH +
Sbjct: 46  LEPQWDIKNVKELVAPQLGLQPDDLKIIFAGKELSDATTIEQCDLGQQSVLHAI 99


>UniRef50_Q17E87 Cluster: Putative uncharacterized protein; n=1;
           Aedes aegypti|Rep: Putative uncharacterized protein -
           Aedes aegypti (Yellowfever mosquito)
          Length = 1122

 Score = 46.0 bits (104), Expect = 0.001
 Identities = 23/54 (42%), Positives = 31/54 (57%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           V   DT+  +K+KIQ  EGIP NQQ L++  K+L D   + D  +   S L LV
Sbjct: 25  VSDRDTVGYIKSKIQKYEGIPANQQHLLYNHKELSDTTEMKDIPLVNGSRLKLV 78


>UniRef50_Q55K49 Cluster: Putative uncharacterized protein; n=2;
           Filobasidiella neoformans|Rep: Putative uncharacterized
           protein - Cryptococcus neoformans (Filobasidiella
           neoformans)
          Length = 355

 Score = 46.0 bits (104), Expect = 0.001
 Identities = 21/44 (47%), Positives = 31/44 (70%)
 Frame = -2

Query: 864 VKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHL 733
           ++A+IQ K  + P+ QR+ + G+QLED   LS+ NIQ  STLH+
Sbjct: 32  LQAEIQGKHSLQPDFQRMFYQGRQLEDPWLLSECNIQHVSTLHV 75



 Score = 44.4 bits (100), Expect = 0.004
 Identities = 20/53 (37%), Positives = 32/53 (60%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHL 733
           V   D +E+++AKI  KEG+P    +L +    L+DGR L DY ++K S + +
Sbjct: 252 VMADDPVEHLRAKIAWKEGVPLEGLQLCYGRNLLKDGRLLKDYKLRKNSIVRM 304


>UniRef50_Q07371 Cluster: Ubiquitin-like protein 1; n=1;
           Caenorhabditis briggsae|Rep: Ubiquitin-like protein 1 -
           Caenorhabditis briggsae
          Length = 70

 Score = 46.0 bits (104), Expect = 0.001
 Identities = 22/53 (41%), Positives = 36/53 (67%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHL 733
           V  ++ + ++K KI+  EGIP  +QRL+FAG+QLED    SD  +  E+T+++
Sbjct: 15  VAANEDVLSIKQKIEAAEGIPSAEQRLVFAGRQLED----SDCGLDAEATIYV 63


>UniRef50_Q9NIF3 Cluster: Ubiquitin-like fusion protein SonA; n=2;
           Dictyostelium discoideum|Rep: Ubiquitin-like fusion
           protein SonA - Dictyostelium discoideum (Slime mold)
          Length = 523

 Score = 45.6 bits (103), Expect = 0.002
 Identities = 23/54 (42%), Positives = 34/54 (62%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VE   T+ + K  I  K  IP +QQR+I++G+ L+D +TL +  IQ   T+HLV
Sbjct: 18  VELGITVADFKKVIATKCSIPADQQRIIYSGRILKDHQTLDEIKIQDGHTVHLV 71


>UniRef50_Q2HT46 Cluster: HECT; Ubiquitin; n=2; Medicago
           truncatula|Rep: HECT; Ubiquitin - Medicago truncatula
           (Barrel medic)
          Length = 826

 Score = 45.2 bits (102), Expect = 0.002
 Identities = 21/50 (42%), Positives = 32/50 (64%)
 Frame = -2

Query: 879 DTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           DT+E++  +I  K  IP   QRLI+ GKQL+  ++LS   I+ ++ L LV
Sbjct: 66  DTVESILQQISSKTKIPIEYQRLIYNGKQLQQQQSLSQCGIENDANLQLV 115


>UniRef50_Q4H2N4 Cluster: Ci-UHRF2 protein; n=3; Deuterostomia|Rep:
           Ci-UHRF2 protein - Ciona intestinalis (Transparent sea
           squirt)
          Length = 743

 Score = 45.2 bits (102), Expect = 0.002
 Identities = 20/48 (41%), Positives = 32/48 (66%)
 Frame = -2

Query: 873 IENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           IE+++  I +K  + P+ QRL F GKQLEDG +L DY++   + + L+
Sbjct: 25  IEDLRELIMEKFSVEPSLQRLFFRGKQLEDGYSLFDYDVGLNALVQLL 72


>UniRef50_A5AB45 Cluster: Remark: Dsk2p is a nuclear-enriched
           protein; n=2; Ascomycota|Rep: Remark: Dsk2p is a
           nuclear-enriched protein - Aspergillus niger
          Length = 361

 Score = 45.2 bits (102), Expect = 0.002
 Identities = 23/55 (41%), Positives = 35/55 (63%), Gaps = 3/55 (5%)
 Frame = -2

Query: 885 PSDT-IENVKAKIQDKE--GIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           PS T + ++K K+   E    P  +QRLI++G+ L+D  TL+ YNI+   T+HLV
Sbjct: 30  PSSTSVSDLKEKLASSEYADTPAERQRLIYSGRVLKDNETLATYNIKDGHTIHLV 84


>UniRef50_UPI0000E46F9B Cluster: PREDICTED: similar to Chain A,
           Structure Of The Dna Repair Protein Hhr23a isoform 2;
           n=2; Strongylocentrotus purpuratus|Rep: PREDICTED:
           similar to Chain A, Structure Of The Dna Repair Protein
           Hhr23a isoform 2 - Strongylocentrotus purpuratus
          Length = 405

 Score = 44.8 bits (101), Expect = 0.003
 Identities = 22/51 (43%), Positives = 33/51 (64%), Gaps = 2/51 (3%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEG--IPPNQQRLIFAGKQLEDGRTLSDYNIQKES 745
           +E S T+ N+K +I+  +G   P + Q+LI+AGK L D   LS YNI ++S
Sbjct: 17  IEDSATVRNLKDEIEKTQGKDFPASGQKLIYAGKILSDDNPLSSYNIDEKS 67


>UniRef50_A6N155 Cluster: Polyubiquitin containing 7 ubiquitin
           monomers; n=3; Eukaryota|Rep: Polyubiquitin containing 7
           ubiquitin monomers - Oryza sativa subsp. indica (Rice)
          Length = 99

 Score = 44.8 bits (101), Expect = 0.003
 Identities = 23/45 (51%), Positives = 28/45 (62%)
 Frame = -3

Query: 848 KTKRESLPINKG*SLLESSWKMDVPSRTTISRRNPPSTWC*GFVV 714
           +T+R     +   SLL SSW+M  P  TT SRR+PPST C  FVV
Sbjct: 6   RTRRAFPRTSSASSLLASSWRMAGPLLTTTSRRSPPSTLCSAFVV 50


>UniRef50_A0DYM1 Cluster: Chromosome undetermined scaffold_7, whole
           genome shotgun sequence; n=1; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_7,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 1164

 Score = 44.8 bits (101), Expect = 0.003
 Identities = 24/65 (36%), Positives = 30/65 (46%)
 Frame = -2

Query: 876 TIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVXXXXXXXXXXX 697
           T+  +K KI  K  IP N Q L + GK L D   L DYN+Q  S L+L            
Sbjct: 325 TVIQLKQKIYHKLNIPTNVQTLNYGGKLLTDSLLLKDYNVQNNSNLNLTFKLNQLVSHAD 384

Query: 696 XKNYS 682
             NY+
Sbjct: 385 SYNYN 389


>UniRef50_Q2UTN9 Cluster: Nucleotide excision repair factor NEF2;
           n=13; Pezizomycotina|Rep: Nucleotide excision repair
           factor NEF2 - Aspergillus oryzae
          Length = 403

 Score = 44.8 bits (101), Expect = 0.003
 Identities = 19/47 (40%), Positives = 32/47 (68%)
 Frame = -2

Query: 888 EPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKE 748
           EPS+T+  VK KI  ++G    Q +LI++GK L+D + +  YNI+++
Sbjct: 43  EPSETVGQVKEKISKEKGWEVPQLKLIYSGKILQDDKAIESYNIEEK 89


>UniRef50_UPI00015B5086 Cluster: PREDICTED: similar to
           ENSANGP00000011460; n=1; Nasonia vitripennis|Rep:
           PREDICTED: similar to ENSANGP00000011460 - Nasonia
           vitripennis
          Length = 464

 Score = 44.4 bits (100), Expect = 0.004
 Identities = 20/54 (37%), Positives = 33/54 (61%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           ++P   I NVK  +  K GI P+  ++IFAGK+L +   + D ++ ++S LH V
Sbjct: 46  LDPKWDIRNVKEIVAPKMGISPDDIKIIFAGKELHNSTIIEDCDLGQQSILHAV 99


>UniRef50_UPI0001554645 Cluster: PREDICTED: similar to Parkinson
           disease (autosomal recessive, juvenile) 2, parkin,
           partial; n=1; Ornithorhynchus anatinus|Rep: PREDICTED:
           similar to Parkinson disease (autosomal recessive,
           juvenile) 2, parkin, partial - Ornithorhynchus anatinus
          Length = 254

 Score = 44.4 bits (100), Expect = 0.004
 Identities = 18/54 (33%), Positives = 37/54 (68%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           V+   +I  +K  +  ++G+P +Q R+IFAGK+L +  TL + +++++S +H+V
Sbjct: 17  VDSDTSIFELKELVAKQQGVPADQLRVIFAGKELRNDLTLQNCDLEQQSIVHVV 70


>UniRef50_UPI000065FB66 Cluster: E3 ubiquitin-protein ligase UHRF1
           (EC 6.3.2.-) (Ubiquitin-like PHD and RING finger
           domain-containing protein 1) (Ubiquitin-like-containing
           PHD and RING finger domains protein 1) (Inverted CCAAT
           box-binding protein of 90 kDa) (Transcription factor
           ICBP90); n=1; Takifugu rubripes|Rep: E3
           ubiquitin-protein ligase UHRF1 (EC 6.3.2.-)
           (Ubiquitin-like PHD and RING finger domain-containing
           protein 1) (Ubiquitin-like-containing PHD and RING
           finger domains protein 1) (Inverted CCAAT box-binding
           protein of 90 kDa) (Transcription factor ICBP90) -
           Takifugu rubripes
          Length = 842

 Score = 44.4 bits (100), Expect = 0.004
 Identities = 17/48 (35%), Positives = 30/48 (62%)
 Frame = -2

Query: 873 IENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           ++ ++ KI +   + P +QRL + GKQ+EDG T+ DYN+     + L+
Sbjct: 25  VDELRQKIMELFKVEPERQRLFYRGKQMEDGHTIFDYNVGLNDIVQLL 72


>UniRef50_A0E6I1 Cluster: Chromosome undetermined scaffold_8, whole
           genome shotgun sequence; n=2; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_8,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 608

 Score = 44.4 bits (100), Expect = 0.004
 Identities = 20/54 (37%), Positives = 33/54 (61%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           ++ S T+  +K  I+    IP ++QRL+F G+QL +  TL   NI+ +  +HLV
Sbjct: 28  IKQSQTVNELKNLIEIVSSIPSSRQRLLFKGRQLSNEDTLISLNIEDQCVVHLV 81


>UniRef50_Q8SUA1 Cluster: Putative uncharacterized protein
           ECU10_1730; n=1; Encephalitozoon cuniculi|Rep: Putative
           uncharacterized protein ECU10_1730 - Encephalitozoon
           cuniculi
          Length = 275

 Score = 44.4 bits (100), Expect = 0.004
 Identities = 22/51 (43%), Positives = 33/51 (64%), Gaps = 1/51 (1%)
 Frame = -2

Query: 882 SDTIENVKAKIQDKEGIPPNQQRLIFAGKQL-EDGRTLSDYNIQKESTLHL 733
           +D++E++K KIQD  GIP + Q L+F  + L ED + L D  I+ +  LHL
Sbjct: 21  TDSLESLKLKIQDITGIPVDSQVLLFNDRILSEDNKELKDLGIENDCVLHL 71


>UniRef50_Q5CR28 Cluster: DSK2 like protein with a ubiquitin domain,
           2 STI1 motifs and a UBA domain at its C-terminus; n=2;
           Cryptosporidium|Rep: DSK2 like protein with a ubiquitin
           domain, 2 STI1 motifs and a UBA domain at its C-terminus
           - Cryptosporidium parvum Iowa II
          Length = 402

 Score = 44.0 bits (99), Expect = 0.005
 Identities = 21/53 (39%), Positives = 34/53 (64%), Gaps = 1/53 (1%)
 Frame = -2

Query: 885 PSDTI-ENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           P +TI +++K KI +   IP +QQRLI+ G+ L+D  +L    ++   T+HLV
Sbjct: 71  PRNTIVKDLKDKISEPSNIPSSQQRLIYKGRILKDSDSLDGMKVESGHTMHLV 123


>UniRef50_Q55DZ2 Cluster: Putative uncharacterized protein; n=1;
            Dictyostelium discoideum AX4|Rep: Putative
            uncharacterized protein - Dictyostelium discoideum AX4
          Length = 2337

 Score = 44.0 bits (99), Expect = 0.005
 Identities = 20/56 (35%), Positives = 35/56 (62%), Gaps = 2/56 (3%)
 Frame = -2

Query: 891  VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRT--LSDYNIQKESTLHLV 730
            V    TI  ++  I D++G+PP+ QRL +  KQ++   T  L +++I  ++TL+LV
Sbjct: 1532 VSDETTIGELQQMIMDRDGLPPSSQRLFYLNKQIDSNATMKLKEFSIVNKATLNLV 1587


>UniRef50_Q54L35 Cluster: Putative uncharacterized protein; n=1;
           Dictyostelium discoideum AX4|Rep: Putative
           uncharacterized protein - Dictyostelium discoideum AX4
          Length = 80

 Score = 44.0 bits (99), Expect = 0.005
 Identities = 22/53 (41%), Positives = 33/53 (62%)
 Frame = -2

Query: 888 EPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           + +D IE +K  I+  EGI P +Q+LIF GK L+D  TL    I+  ST+ ++
Sbjct: 19  DETDKIELIKNSIRIMEGINPQEQKLIFDGKVLKDTSTLKSCGIKDGSTISVL 71


>UniRef50_A7STF8 Cluster: Predicted protein; n=1; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 263

 Score = 44.0 bits (99), Expect = 0.005
 Identities = 23/52 (44%), Positives = 29/52 (55%)
 Frame = -2

Query: 885 PSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           P  TI  VK  I+ K G P +QQRL+F G+ L D  T     I   +TLHL+
Sbjct: 19  PKHTIIEVKYLIEAKGGYPKDQQRLVFNGQVLSDEDTFEKVGIFAGATLHLI 70


>UniRef50_A5K4E9 Cluster: Ubiquitin domain containing protein; n=6;
           Plasmodium|Rep: Ubiquitin domain containing protein -
           Plasmodium vivax
          Length = 394

 Score = 44.0 bits (99), Expect = 0.005
 Identities = 22/54 (40%), Positives = 30/54 (55%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VEP  T+  +K K  +   IP   QR+IF GK L+D   L+ Y +    T+HLV
Sbjct: 19  VEPEITVLELKQKCAEHVDIPVECQRIIFKGKILKDKEPLTTYGVSDGITMHLV 72


>UniRef50_Q15646 Cluster: 59 kDa 2'-5'-oligoadenylate
           synthetase-like protein; n=17; Eutheria|Rep: 59 kDa
           2'-5'-oligoadenylate synthetase-like protein - Homo
           sapiens (Human)
          Length = 514

 Score = 44.0 bits (99), Expect = 0.005
 Identities = 21/53 (39%), Positives = 32/53 (60%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHL 733
           + P+  I  +K +I+D++G+P  QQ+L F G+ L+D   L  Y IQ   TL L
Sbjct: 450 INPNSFILGLKQQIEDQQGLPKKQQQLEFQGQVLQDWLGLGIYGIQDSDTLIL 502


>UniRef50_UPI0000E495BE Cluster: PREDICTED: similar to
           polyubiquitin; n=1; Strongylocentrotus purpuratus|Rep:
           PREDICTED: similar to polyubiquitin - Strongylocentrotus
           purpuratus
          Length = 329

 Score = 43.6 bits (98), Expect = 0.007
 Identities = 18/36 (50%), Positives = 27/36 (75%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLED 784
           V P+D ++++K K+Q+K  I P+QQRL F GK L+D
Sbjct: 284 VRPTDKVKDLKVKVQEKLKIAPSQQRLQFQGKMLDD 319



 Score = 37.9 bits (84), Expect = 0.34
 Identities = 18/46 (39%), Positives = 28/46 (60%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQ 754
           V P+DT++++K KIQ+K  I P+QQRL F         T+ + + Q
Sbjct: 79  VRPTDTVKDLKVKIQEKLKIAPSQQRLQFQSLSRAQSYTMDNEHDQ 124


>UniRef50_UPI0000D55C1D Cluster: PREDICTED: similar to
           HLA-B-associated transcript 3 isoform 1; n=1; Tribolium
           castaneum|Rep: PREDICTED: similar to HLA-B-associated
           transcript 3 isoform 1 - Tribolium castaneum
          Length = 1149

 Score = 43.6 bits (98), Expect = 0.007
 Identities = 21/54 (38%), Positives = 31/54 (57%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           V+   T+E  K KI D   IP   QR+I+ G+ L+D   L DY++  +  +HLV
Sbjct: 18  VDDDITVEQFKTKIADTVNIPAETQRIIYCGRVLQDEAKLGDYDVNGK-VVHLV 70


>UniRef50_Q9YHD3 Cluster: Scythe; n=6; Xenopus|Rep: Scythe - Xenopus
           laevis (African clawed frog)
          Length = 1135

 Score = 43.6 bits (98), Expect = 0.007
 Identities = 20/54 (37%), Positives = 34/54 (62%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VE   ++++ KA I    GI P +QRLI+ G+ L++ + L +YN+  +  +HLV
Sbjct: 23  VETEISVKDFKAHISSDVGISPEKQRLIYQGRVLQEDKKLKEYNVDGK-VIHLV 75


>UniRef50_A7RYS4 Cluster: Predicted protein; n=1; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 1151

 Score = 43.6 bits (98), Expect = 0.007
 Identities = 21/49 (42%), Positives = 30/49 (61%)
 Frame = -2

Query: 876 TIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           T+E  K +I D  GIP  +QRLIF GK L+D + L ++ +     +HLV
Sbjct: 22  TVEEFKKEIADTVGIPAERQRLIFKGKVLQDEKKLKEFEVD-GCVVHLV 69


>UniRef50_A2FA32 Cluster: Ubiquitin family protein; n=11;
           Trichomonas vaginalis G3|Rep: Ubiquitin family protein -
           Trichomonas vaginalis G3
          Length = 539

 Score = 43.6 bits (98), Expect = 0.007
 Identities = 22/51 (43%), Positives = 34/51 (66%), Gaps = 1/51 (1%)
 Frame = -2

Query: 882 SDTIENVKAKIQDKEGIPPNQQRLIFAGKQ-LEDGRTLSDYNIQKESTLHL 733
           + T+ ++K  I D EGI P  Q L + G++ LED   L DY+IQ++ST++L
Sbjct: 298 NSTVFDLKLLICDSEGIFPRDQDLYYGGERHLEDNFKLIDYDIQRDSTIYL 348



 Score = 36.3 bits (80), Expect = 1.0
 Identities = 17/44 (38%), Positives = 25/44 (56%)
 Frame = -2

Query: 876 TIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKES 745
           T+E +K K   K G P   Q + + G  ++D RTL+ Y IQ+ S
Sbjct: 218 TVEKLKEKFYSKTGWPIKYQTMTYNGIIMDDNRTLNYYKIQRGS 261


>UniRef50_A0E2Q5 Cluster: Chromosome undetermined scaffold_75, whole
           genome shotgun sequence; n=1; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_75,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 544

 Score = 43.6 bits (98), Expect = 0.007
 Identities = 18/40 (45%), Positives = 28/40 (70%)
 Frame = -2

Query: 882 SDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDY 763
           SD I  +K  +Q KEGI P+QQ++I+ G+ L+D   L+D+
Sbjct: 253 SDNILKIKKLVQQKEGIDPSQQKIIYYGRVLQDFEKLNDF 292


>UniRef50_Q4PG40 Cluster: Putative uncharacterized protein; n=1;
           Ustilago maydis|Rep: Putative uncharacterized protein -
           Ustilago maydis (Smut fungus)
          Length = 422

 Score = 43.6 bits (98), Expect = 0.007
 Identities = 20/55 (36%), Positives = 33/55 (60%), Gaps = 1/55 (1%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQ-DKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           +    T+  +K  I+  K  +P + QRLI+AGK L+D   LS Y ++  +T+H+V
Sbjct: 27  ITSDQTVRQLKEAIEKQKPDVPADAQRLIYAGKVLKDEEALSVYKVKDGNTIHMV 81


>UniRef50_Q54TK0 Cluster: Putative uncharacterized protein; n=1;
           Dictyostelium discoideum AX4|Rep: Putative
           uncharacterized protein - Dictyostelium discoideum AX4
          Length = 96

 Score = 43.2 bits (97), Expect = 0.009
 Identities = 18/43 (41%), Positives = 27/43 (62%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDY 763
           V+P+D I+ +K+KI +  G P  Q     AG  ++DG T+SDY
Sbjct: 16  VQPTDKIQEIKSKINELNGTPVEQIHPYIAGHAMKDGTTISDY 58


>UniRef50_Q6MVN0 Cluster: Related to ubiquitin-like protein DSK2;
           n=6; Pezizomycotina|Rep: Related to ubiquitin-like
           protein DSK2 - Neurospora crassa
          Length = 431

 Score = 43.2 bits (97), Expect = 0.009
 Identities = 21/56 (37%), Positives = 35/56 (62%), Gaps = 2/56 (3%)
 Frame = -2

Query: 891 VEPSDTIENVKAKI--QDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           +  S T+  +K  +  ++ E I P QQRLI++GK ++D   LS Y I+  +T+H+V
Sbjct: 29  IAESATVLQLKTLLAGEEYENISPEQQRLIYSGKVMKDDEVLSFYKIKHMNTVHMV 84


>UniRef50_Q6M029 Cluster: 30S ribosomal protein S27ae; n=6;
           Euryarchaeota|Rep: 30S ribosomal protein S27ae -
           Methanococcus maripaludis
          Length = 67

 Score = 43.2 bits (97), Expect = 0.009
 Identities = 23/51 (45%), Positives = 33/51 (64%)
 Frame = -2

Query: 627 FYKVDENGKIHRLRRECTGEQCGAGVFMAVMEDRHYCGKCHSTMVFKDDDK 475
           +YKV+ N  + RL++ C   +CGAGVFMA   +R  CGKC   M +K ++K
Sbjct: 16  YYKVEGN-TVERLKKVCP--KCGAGVFMAEHLNRFACGKC-GYMEYKKNEK 62


>UniRef50_UPI0001554DB9 Cluster: PREDICTED: similar to inhibitor of
           kappa light polypeptide gene enhancer in B-cells, kinase
           complex-associated protein; n=1; Ornithorhynchus
           anatinus|Rep: PREDICTED: similar to inhibitor of kappa
           light polypeptide gene enhancer in B-cells, kinase
           complex-associated protein - Ornithorhynchus anatinus
          Length = 234

 Score = 42.7 bits (96), Expect = 0.012
 Identities = 20/48 (41%), Positives = 33/48 (68%), Gaps = 1/48 (2%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDY-NIQK 751
           V  +D++  V+  IQ+K G+PP  Q +I  GK+LE G+T+++Y  +QK
Sbjct: 175 VRRTDSVAAVQKMIQEKTGVPPQFQVVICNGKRLEAGKTMAEYGTLQK 222


>UniRef50_UPI0000D554E4 Cluster: PREDICTED: similar to CG16941-PA;
           n=1; Tribolium castaneum|Rep: PREDICTED: similar to
           CG16941-PA - Tribolium castaneum
          Length = 759

 Score = 42.7 bits (96), Expect = 0.012
 Identities = 17/50 (34%), Positives = 33/50 (66%)
 Frame = -2

Query: 882 SDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHL 733
           S+++ ++K+KIQ++  +PP +Q+L + G   +D  TL+ YNI   + + L
Sbjct: 700 SESVSSIKSKIQEETNMPPAKQKLFYDGMFFKDSNTLAYYNIITGAVIQL 749


>UniRef50_Q53MR5 Cluster: Ubiquitin family, putative; n=2; Oryza
           sativa (japonica cultivar-group)|Rep: Ubiquitin family,
           putative - Oryza sativa subsp. japonica (Rice)
          Length = 353

 Score = 42.7 bits (96), Expect = 0.012
 Identities = 20/54 (37%), Positives = 35/54 (64%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           V+ SD + +VK +I+ KEGI  + Q L++AG+ L D + LS+  +  +  LH++
Sbjct: 169 VKKSDIVADVKLQIELKEGIHLDNQILMYAGRHLGDSQILSECGLSDDHILHVL 222


>UniRef50_O60260 Cluster: Parkin; n=71; Eumetazoa|Rep: Parkin - Homo
           sapiens (Human)
          Length = 465

 Score = 42.7 bits (96), Expect = 0.012
 Identities = 17/54 (31%), Positives = 36/54 (66%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           V+   +I  +K  +  ++G+P +Q R+IFAGK+L +  T+ + ++ ++S +H+V
Sbjct: 17  VDSDTSIFQLKEVVAKRQGVPADQLRVIFAGKELRNDWTVQNCDLDQQSIVHIV 70


>UniRef50_UPI0000D557CB Cluster: PREDICTED: similar to
           ubiquitin-like, containing PHD and RING finger domains,
           1; n=1; Tribolium castaneum|Rep: PREDICTED: similar to
           ubiquitin-like, containing PHD and RING finger domains,
           1 - Tribolium castaneum
          Length = 715

 Score = 42.3 bits (95), Expect = 0.016
 Identities = 19/54 (35%), Positives = 35/54 (64%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           V  + +I+ ++A IQ+K     N+Q+L + GKQL +G T++DY+I+    + L+
Sbjct: 21  VSKTTSIKKLQAMIQNKLKTEINRQKLYYRGKQLIEGHTIADYDIKLNDVIQLL 74


>UniRef50_Q10S80 Cluster: Ubiquitin family protein, expressed; n=15;
           Magnoliophyta|Rep: Ubiquitin family protein, expressed -
           Oryza sativa subsp. japonica (Rice)
          Length = 534

 Score = 42.3 bits (95), Expect = 0.016
 Identities = 17/44 (38%), Positives = 30/44 (68%)
 Frame = -2

Query: 861 KAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           KA + +   +P  QQRLI+ G+ L+D +TL+ Y ++ + T+H+V
Sbjct: 42  KAIVAESCDVPAPQQRLIYKGRILKDEQTLASYGVETDHTIHMV 85


>UniRef50_A2EN73 Cluster: Ubiquitin family protein; n=1; Trichomonas
           vaginalis G3|Rep: Ubiquitin family protein - Trichomonas
           vaginalis G3
          Length = 198

 Score = 42.3 bits (95), Expect = 0.016
 Identities = 19/47 (40%), Positives = 31/47 (65%)
 Frame = -2

Query: 873 IENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHL 733
           ++ +K  I D +GI  +QQRL+F G Q+E+ + L DY+I+    +HL
Sbjct: 146 VKQLKKMIFDIDGIAIDQQRLLFRGIQIENDKLLKDYDIRDLCVIHL 192


>UniRef50_Q553G0 Cluster: Putative uncharacterized protein; n=2;
           Dictyostelium discoideum|Rep: Putative uncharacterized
           protein - Dictyostelium discoideum AX4
          Length = 184

 Score = 41.9 bits (94), Expect = 0.021
 Identities = 20/46 (43%), Positives = 30/46 (65%), Gaps = 1/46 (2%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAG-KQLEDGRTLSDYNI 757
           V PSDT E++K KI+     P +QQRL+ +  K++E+G T+ D  I
Sbjct: 17  VNPSDTTEDIKRKIEKHTDTPFDQQRLLLSNKKRMEEGSTIEDSGI 62


>UniRef50_P91052 Cluster: Putative uncharacterized protein; n=2;
           Caenorhabditis elegans|Rep: Putative uncharacterized
           protein - Caenorhabditis elegans
          Length = 244

 Score = 41.9 bits (94), Expect = 0.021
 Identities = 23/53 (43%), Positives = 29/53 (54%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHL 733
           V  SDTI  VK  I     +  +  R++   K LED  TL+ YNIQ+ STL L
Sbjct: 189 VRGSDTIRQVKLTINSLANVDISSFRMVLRDKVLEDDHTLAYYNIQEGSTLGL 241


>UniRef50_A2DY94 Cluster: Ubiquitin family protein; n=1; Trichomonas
           vaginalis G3|Rep: Ubiquitin family protein - Trichomonas
           vaginalis G3
          Length = 330

 Score = 41.9 bits (94), Expect = 0.021
 Identities = 17/46 (36%), Positives = 30/46 (65%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQ 754
           VEP+ TI  +K  + +K  + P   +LI++ K L+D +T+++ NIQ
Sbjct: 17  VEPTTTIAELKVLVSEKANVAPEGIKLIYSAKFLDDSKTIAESNIQ 62


>UniRef50_A0BIE9 Cluster: Chromosome undetermined scaffold_11, whole
           genome shotgun sequence; n=2; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_11,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 869

 Score = 41.9 bits (94), Expect = 0.021
 Identities = 19/54 (35%), Positives = 35/54 (64%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           ++   TI ++K +I +K  +P ++QRLIF GK L D + L++   + + T+HL+
Sbjct: 31  IQTQITIADLKKEIFEKSQVPIDRQRLIFLGKALLDNQKLNEIIKEDDQTIHLM 84


>UniRef50_Q0U9Z4 Cluster: Predicted protein; n=1; Phaeosphaeria
           nodorum|Rep: Predicted protein - Phaeosphaeria nodorum
           (Septoria nodorum)
          Length = 289

 Score = 41.9 bits (94), Expect = 0.021
 Identities = 21/51 (41%), Positives = 33/51 (64%), Gaps = 2/51 (3%)
 Frame = -2

Query: 876 TIENVKAKIQDKE--GIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           T+ ++KAK+   E   +P  +QRLI++G+ L+D  TLS   I+   T+HLV
Sbjct: 36  TVADLKAKLSASEYADVPAERQRLIYSGRVLKDHDTLSSVKIKDGHTVHLV 86


>UniRef50_UPI0001509B75 Cluster: Ubiquitin family protein; n=1;
           Tetrahymena thermophila SB210|Rep: Ubiquitin family
           protein - Tetrahymena thermophila SB210
          Length = 1021

 Score = 41.5 bits (93), Expect = 0.028
 Identities = 18/50 (36%), Positives = 36/50 (72%), Gaps = 2/50 (4%)
 Frame = -2

Query: 873 IENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDY--NIQKESTLHLV 730
           I++++ K+Q+  G+P ++QR+I  G+QL D +T+ DY  + ++ + +HLV
Sbjct: 41  IKDLRIKVQEVSGVPADRQRMICMGQQLIDTKTVGDYAKDPEQPNWIHLV 90


>UniRef50_UPI00004985B5 Cluster: hypothetical protein 103.t00036;
           n=3; Entamoeba histolytica HM-1:IMSS|Rep: hypothetical
           protein 103.t00036 - Entamoeba histolytica HM-1:IMSS
          Length = 237

 Score = 41.5 bits (93), Expect = 0.028
 Identities = 21/48 (43%), Positives = 27/48 (56%)
 Frame = -2

Query: 876 TIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHL 733
           TI  VK  ++   GIP  QQR ++  KQLED  TL D     +S +HL
Sbjct: 82  TISQVKRLVKSITGIPLEQQRFLYVRKQLEDQNTLLDCVTTNKSFIHL 129


>UniRef50_Q10NT3 Cluster: Expressed protein; n=3; Oryza sativa|Rep:
           Expressed protein - Oryza sativa subsp. japonica (Rice)
          Length = 139

 Score = 41.5 bits (93), Expect = 0.028
 Identities = 17/36 (47%), Positives = 24/36 (66%)
 Frame = -2

Query: 837 GIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           GI P  QR +F  +QL+D ++L+D NI   ST+H V
Sbjct: 3   GIHPRDQRFVFNARQLDDNQSLADCNITHNSTIHFV 38


>UniRef50_Q8I2T2 Cluster: Ubiquitin-like protein, putative; n=2;
           Plasmodium|Rep: Ubiquitin-like protein, putative -
           Plasmodium falciparum (isolate 3D7)
          Length = 1542

 Score = 41.5 bits (93), Expect = 0.028
 Identities = 21/54 (38%), Positives = 32/54 (59%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           V+    IE +K+ I +K  +  N  RLI+ G+ L + + L DYNIQ +  +HLV
Sbjct: 24  VKDDMNIEELKSIIAEKRNVNINDIRLIYQGQCLLNEKKLYDYNIQNDHIIHLV 77


>UniRef50_Q54QA5 Cluster: Putative uncharacterized protein; n=1;
           Dictyostelium discoideum AX4|Rep: Putative
           uncharacterized protein - Dictyostelium discoideum AX4
          Length = 836

 Score = 41.5 bits (93), Expect = 0.028
 Identities = 21/48 (43%), Positives = 28/48 (58%)
 Frame = -2

Query: 876 TIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHL 733
           T+  +K  I+ K  I    QR+I+ GK L D +TL  YNI+   TLHL
Sbjct: 23  TVPELKKLIEAKSSISIPLQRVIYKGKVLRDDKTLQFYNIEDGVTLHL 70


>UniRef50_A5K6T6 Cluster: Ubiquitin-like protein, putative; n=1;
           Plasmodium vivax|Rep: Ubiquitin-like protein, putative -
           Plasmodium vivax
          Length = 1441

 Score = 41.5 bits (93), Expect = 0.028
 Identities = 18/54 (33%), Positives = 33/54 (61%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           V+   + E +K  I +++ +     RLI+ G+ L + ++++DYNIQ E  +HLV
Sbjct: 23  VKGETSAEEIKNTIAERKSVDKQDIRLIYQGQCLANEKSVADYNIQNEHIIHLV 76


>UniRef50_A2G7G2 Cluster: Ubiquitin family protein; n=1; Trichomonas
           vaginalis G3|Rep: Ubiquitin family protein - Trichomonas
           vaginalis G3
          Length = 356

 Score = 41.5 bits (93), Expect = 0.028
 Identities = 21/48 (43%), Positives = 29/48 (60%)
 Frame = -2

Query: 873 IENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           ++  K  IQ++EG P  + RLIFAGKQLE    L DY ++    + LV
Sbjct: 121 VKYFKYLIQEQEGTPVEKIRLIFAGKQLEAEIKLKDYGVKYGDKIQLV 168



 Score = 40.7 bits (91), Expect = 0.049
 Identities = 19/54 (35%), Positives = 35/54 (64%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VE  +T+  +K+ +Q++ GI   +QRLIF  K+++    + DY I+ E+ ++LV
Sbjct: 32  VELINTLNYLKSLVQEQTGIKIEKQRLIFNMKEMKADIPIKDYGIKNENIIYLV 85


>UniRef50_A2F4J1 Cluster: Ubiquitin family protein; n=1; Trichomonas
           vaginalis G3|Rep: Ubiquitin family protein - Trichomonas
           vaginalis G3
          Length = 325

 Score = 41.5 bits (93), Expect = 0.028
 Identities = 21/50 (42%), Positives = 30/50 (60%)
 Frame = -2

Query: 882 SDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHL 733
           SDTI ++K +I  K G+ P QQRL+F GK L D  ++  Y      T++L
Sbjct: 28  SDTILSIKERITTKTGLFPRQQRLVFQGKVLVDELSVGFYTSLNCPTMYL 77


>UniRef50_UPI0000F2EC07 Cluster: PREDICTED: similar to interferon
           stimulated gene 17, partial; n=1; Monodelphis
           domestica|Rep: PREDICTED: similar to interferon
           stimulated gene 17, partial - Monodelphis domestica
          Length = 154

 Score = 41.1 bits (92), Expect = 0.037
 Identities = 18/53 (33%), Positives = 30/53 (56%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHL 733
           ++ S T+  +K  +Q+KEG+  +Q  L F GK +ED   L DY +    T+ +
Sbjct: 94  IQLSQTVAQLKKMLQEKEGVSVSQFWLSFDGKPMEDNEYLGDYGLSPLCTIQM 146


>UniRef50_UPI0000DB7798 Cluster: PREDICTED: similar to
           ubiquitin-like, containing PHD and RING finger domains,
           1; n=1; Apis mellifera|Rep: PREDICTED: similar to
           ubiquitin-like, containing PHD and RING finger domains,
           1 - Apis mellifera
          Length = 568

 Score = 40.7 bits (91), Expect = 0.049
 Identities = 19/48 (39%), Positives = 29/48 (60%)
 Frame = -2

Query: 873 IENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           +E+ K +I+ +  I  + QRL F GKQLE+G  L DYN+     + L+
Sbjct: 24  VEDFKHEIEKELHIKADLQRLFFRGKQLENGYKLYDYNVNLNDVIQLM 71


>UniRef50_UPI000058738C Cluster: PREDICTED: hypothetical protein;
           n=1; Strongylocentrotus purpuratus|Rep: PREDICTED:
           hypothetical protein - Strongylocentrotus purpuratus
          Length = 152

 Score = 40.7 bits (91), Expect = 0.049
 Identities = 19/50 (38%), Positives = 31/50 (62%)
 Frame = -2

Query: 879 DTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           ++I +VK  +  +  +P + QRL+F GK L DG++L  Y I   + +HLV
Sbjct: 23  ESIVSVKRMVAREFDVPVHLQRLVFRGKTLADGQSLDFYKIGPGTKIHLV 72


>UniRef50_A2EDJ2 Cluster: Ribosomal protein S27a, putative; n=5;
           Trichomonas vaginalis G3|Rep: Ribosomal protein S27a,
           putative - Trichomonas vaginalis G3
          Length = 134

 Score = 40.7 bits (91), Expect = 0.049
 Identities = 19/50 (38%), Positives = 30/50 (60%), Gaps = 1/50 (2%)
 Frame = -2

Query: 642 LAVLRFYKVDENGKIHRLRRECTGEQCGAGVFMAVMED-RHYCGKCHSTM 496
           L +L+ +K+ ++G +   R+EC    C  G F+A  +D R YCG CH T+
Sbjct: 78  LKILKLFKIGKDGSVEAQRKECP--HC-KGCFLAKHKDGRQYCGNCHYTV 124


>UniRef50_A4RL24 Cluster: Putative uncharacterized protein; n=1;
           Magnaporthe grisea|Rep: Putative uncharacterized protein
           - Magnaporthe grisea (Rice blast fungus) (Pyricularia
           grisea)
          Length = 418

 Score = 40.7 bits (91), Expect = 0.049
 Identities = 21/53 (39%), Positives = 35/53 (66%), Gaps = 2/53 (3%)
 Frame = -2

Query: 882 SDTIENVKAKI--QDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           S T+ ++K K+  +D E IP   QRLI++G+ +++   LS Y I+  +T+HLV
Sbjct: 37  SATVLDLKQKLAGEDLENIPVEHQRLIYSGRVMKNTDLLSVYKIKDGNTVHLV 89


>UniRef50_A7DS39 Cluster: Ribosomal protein S27a; n=1; Candidatus
           Nitrosopumilus maritimus SCM1|Rep: Ribosomal protein
           S27a - Candidatus Nitrosopumilus maritimus SCM1
          Length = 57

 Score = 40.7 bits (91), Expect = 0.049
 Identities = 18/46 (39%), Positives = 31/46 (67%)
 Frame = -2

Query: 636 VLRFYKVDENGKIHRLRRECTGEQCGAGVFMAVMEDRHYCGKCHST 499
           V  ++KVD + K+ R+++ C+  +CG G +M+  +DR+ CGKC  T
Sbjct: 11  VYAYFKVDGD-KVSRIKKVCS--RCGKGTYMSEHKDRNTCGKCGLT 53


>UniRef50_Q19KS6 Cluster: Ubiquitin-like protein 4B; n=1;
           Monodelphis domestica|Rep: Ubiquitin-like protein 4B -
           Monodelphis domestica (Short-tailed gray opossum)
          Length = 181

 Score = 40.7 bits (91), Expect = 0.049
 Identities = 19/54 (35%), Positives = 32/54 (59%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           V  ++ +  +K  +  +  +P  QQRL+F G+ L D + LSDY I   STL+++
Sbjct: 17  VSENEKVFMLKRLVSKQLHVPEKQQRLLFRGQVLADNKRLSDYCIGPNSTLNVI 70


>UniRef50_UPI000051618B Cluster: PREDICTED: similar to CG7215-PA,
           isoform A; n=2; Apocrita|Rep: PREDICTED: similar to
           CG7215-PA, isoform A - Apis mellifera
          Length = 150

 Score = 40.3 bits (90), Expect = 0.064
 Identities = 23/55 (41%), Positives = 31/55 (56%), Gaps = 1/55 (1%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDY-NIQKESTLHLV 730
           + PSDT+  +K K+ D  GI    QRL+  GK L D   LS Y  I+  S L+L+
Sbjct: 17  ITPSDTVLQLKHKVSDLLGIDVPHQRLLLTGKALADENPLSFYPGIKDGSKLNLL 71


>UniRef50_Q5J4W3 Cluster: Parkin; n=3; Tetraodontidae|Rep: Parkin -
           Fugu rubripes (Japanese pufferfish) (Takifugu rubripes)
          Length = 482

 Score = 40.3 bits (90), Expect = 0.064
 Identities = 14/49 (28%), Positives = 33/49 (67%)
 Frame = -2

Query: 876 TIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           T+  +K  +  ++G+ P+  R++FAG++L+   TL   ++ ++ST+H++
Sbjct: 22  TVAELKEVVGQQQGVQPDLLRVLFAGRELKSTSTLQGCDLPEQSTVHII 70


>UniRef50_Q7XCL2 Cluster: Ubiquitin family protein, expressed; n=6;
           Oryza sativa|Rep: Ubiquitin family protein, expressed -
           Oryza sativa subsp. japonica (Rice)
          Length = 575

 Score = 40.3 bits (90), Expect = 0.064
 Identities = 17/49 (34%), Positives = 29/49 (59%)
 Frame = -2

Query: 876 TIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           T+   K  +     +P  QQRLI+ G+ L+D +TL  Y ++ + T+H+V
Sbjct: 51  TVGAFKEVVAGSCDVPAAQQRLIYKGRILKDEQTLESYGVETDHTIHMV 99


>UniRef50_Q2QU13 Cluster: Ubiquitin family protein, expressed; n=3;
           Oryza sativa|Rep: Ubiquitin family protein, expressed -
           Oryza sativa subsp. japonica (Rice)
          Length = 302

 Score = 40.3 bits (90), Expect = 0.064
 Identities = 19/49 (38%), Positives = 29/49 (59%)
 Frame = -2

Query: 876 TIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           T+  +K  +  +EGIP   QRL FAG +L+D      Y+I + ST+ L+
Sbjct: 22  TVRRIKEYVLRQEGIPVESQRLFFAGAELDDDGDTERYSILQGSTVLLL 70


>UniRef50_A3BRN9 Cluster: Putative uncharacterized protein; n=3;
           Oryza sativa|Rep: Putative uncharacterized protein -
           Oryza sativa subsp. japonica (Rice)
          Length = 710

 Score = 40.3 bits (90), Expect = 0.064
 Identities = 21/45 (46%), Positives = 27/45 (60%)
 Frame = -2

Query: 864 VKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           +K KI    GI   QQRLI  G+ L+D   LS Y+++   TLHLV
Sbjct: 138 LKEKIATVTGILSEQQRLICRGRVLKDDELLSAYHVEDGHTLHLV 182


>UniRef50_A2XN69 Cluster: Putative uncharacterized protein; n=2;
           Oryza sativa|Rep: Putative uncharacterized protein -
           Oryza sativa subsp. indica (Rice)
          Length = 300

 Score = 40.3 bits (90), Expect = 0.064
 Identities = 20/49 (40%), Positives = 30/49 (61%), Gaps = 1/49 (2%)
 Frame = -2

Query: 876 TIENVKAKIQDKEGIPPNQQRLIFAGKQLEDG-RTLSDYNIQKESTLHL 733
           T+  VK  +  +E I    QRL FAG+ L+D  RTL+DY ++ +S + L
Sbjct: 23  TVAQVKGMVMARERIAVAMQRLFFAGRCLDDDHRTLADYGVRHDSVVFL 71


>UniRef50_Q554E9 Cluster: Putative uncharacterized protein; n=2;
           Dictyostelium discoideum|Rep: Putative uncharacterized
           protein - Dictyostelium discoideum AX4
          Length = 684

 Score = 40.3 bits (90), Expect = 0.064
 Identities = 17/53 (32%), Positives = 32/53 (60%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHL 733
           V P+D +E +  K+ ++  +   Q  L+FAG+ ++   T+  + I+KE T+HL
Sbjct: 16  VNPADKVEVLIKKVCERTSMSEYQFNLVFAGEPMDVQATIGSHGIKKEGTIHL 68


>UniRef50_Q54LV1 Cluster: RepC-binding protein A; n=2; Dictyostelium
           discoideum|Rep: RepC-binding protein A - Dictyostelium
           discoideum AX4
          Length = 342

 Score = 40.3 bits (90), Expect = 0.064
 Identities = 19/40 (47%), Positives = 25/40 (62%)
 Frame = -2

Query: 876 TIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNI 757
           T+  +K  I +K    P+ Q LI++GK LED RTL  YNI
Sbjct: 22  TVAELKNLISEKHNQTPSWQTLIYSGKILEDKRTLESYNI 61


>UniRef50_A7T1V0 Cluster: Predicted protein; n=1; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 74

 Score = 40.3 bits (90), Expect = 0.064
 Identities = 16/49 (32%), Positives = 30/49 (61%)
 Frame = -2

Query: 876 TIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           +I  +K ++  ++ + P   R+IFAG++L+D  TL D  I  +S +H +
Sbjct: 26  SIRQLKEELGRQQSVDPRGIRIIFAGRELKDSTTLQDCEIPNQSIIHAI 74


>UniRef50_Q5KN72 Cluster: Uv excision repair protein rhp23,
           putative; n=2; Filobasidiella neoformans|Rep: Uv
           excision repair protein rhp23, putative - Cryptococcus
           neoformans (Filobasidiella neoformans)
          Length = 406

 Score = 40.3 bits (90), Expect = 0.064
 Identities = 17/50 (34%), Positives = 31/50 (62%)
 Frame = -2

Query: 888 EPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTL 739
           + SDT+ ++K KIQ+ +  P   Q+LI++GK L D  ++    I+++  L
Sbjct: 19  QDSDTVADLKKKIQETQTFPVENQKLIYSGKILNDASSVESLKIKEKDFL 68


>UniRef50_A1CUI4 Cluster: Ubiquitin-like protein DskB, putative;
           n=8; Eurotiomycetidae|Rep: Ubiquitin-like protein DskB,
           putative - Aspergillus clavatus
          Length = 476

 Score = 40.3 bits (90), Expect = 0.064
 Identities = 20/53 (37%), Positives = 32/53 (60%), Gaps = 2/53 (3%)
 Frame = -2

Query: 882 SDTIENVKAKIQDKE--GIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           S  +  +K K+   E    P  +QRLI++G+ L+D  TL+ Y I++  T+HLV
Sbjct: 32  STQVVELKRKLSAPEYADTPAERQRLIYSGRVLKDNETLATYKIKEGHTIHLV 84


>UniRef50_Q0P460 Cluster: Zgc:153389; n=3; Danio rerio|Rep:
           Zgc:153389 - Danio rerio (Zebrafish) (Brachydanio rerio)
          Length = 156

 Score = 39.9 bits (89), Expect = 0.085
 Identities = 20/49 (40%), Positives = 31/49 (63%)
 Frame = -2

Query: 876 TIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           T++  K  I     I  ++QRLI+ GK L+D RTL++YN+  +  +HLV
Sbjct: 28  TVKQFKEHIAASVEISVDKQRLIYQGKVLQDERTLTEYNVDGK-VIHLV 75


>UniRef50_A7QUN3 Cluster: Chromosome chr10 scaffold_179, whole
           genome shotgun sequence; n=2; Vitis vinifera|Rep:
           Chromosome chr10 scaffold_179, whole genome shotgun
           sequence - Vitis vinifera (Grape)
          Length = 284

 Score = 39.9 bits (89), Expect = 0.085
 Identities = 17/46 (36%), Positives = 28/46 (60%)
 Frame = -2

Query: 876 TIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTL 739
           T+  +K KI + EGIP N+  L + G++L+D R+L D  +   S +
Sbjct: 138 TVGRLKEKIHEMEGIPVNRMVLYWRGRELQDSRSLRDCELSDRSEI 183



 Score = 35.9 bits (79), Expect = 1.4
 Identities = 15/36 (41%), Positives = 22/36 (61%)
 Frame = -2

Query: 879 DTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTL 772
           DT+  +K K+Q   GIP ++Q L F G  L+D R +
Sbjct: 21  DTVLEIKEKVQKYHGIPASRQTLFFNGHLLQDNRDI 56


>UniRef50_A2Q1T1 Cluster: Ubiquitin; n=1; Medicago truncatula|Rep:
           Ubiquitin - Medicago truncatula (Barrel medic)
          Length = 674

 Score = 39.9 bits (89), Expect = 0.085
 Identities = 23/54 (42%), Positives = 31/54 (57%), Gaps = 3/54 (5%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQD---KEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTL 739
           V PSD+I  VK  I+D   K+  P  QQ LI  GK L+D  TL+D  + ++  L
Sbjct: 564 VHPSDSIMAVKTTIEDIQGKDNYPCRQQLLIHNGKVLKDETTLADNEVSEDGFL 617


>UniRef50_Q7QWK0 Cluster: GLP_538_1417_1800; n=1; Giardia lamblia
           ATCC 50803|Rep: GLP_538_1417_1800 - Giardia lamblia ATCC
           50803
          Length = 127

 Score = 39.9 bits (89), Expect = 0.085
 Identities = 18/53 (33%), Positives = 34/53 (64%), Gaps = 1/53 (1%)
 Frame = -2

Query: 885 PSDTIENVKAKIQDK-EGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           P+D++ +++ ++     G   + QR +FAG+ L++ +TL DY+I + S L LV
Sbjct: 18  PADSLTSIRQRLLAVYSGHVVDSQRFVFAGRTLDEAKTLGDYSIGESSVLDLV 70


>UniRef50_A7AVL0 Cluster: Ubiquitin family domain containing
           protein; n=1; Babesia bovis|Rep: Ubiquitin family domain
           containing protein - Babesia bovis
          Length = 507

 Score = 39.9 bits (89), Expect = 0.085
 Identities = 19/54 (35%), Positives = 27/54 (50%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           V     I  VK  I     I P   +LIF G+ L D RT+  Y++   ST+H++
Sbjct: 21  VRDDGKISEVKGLIAGHCDISPRDMKLIFKGQLLVDDRTIGSYDVANGSTIHII 74


>UniRef50_A2G7U9 Cluster: Ubiquitin family protein; n=1; Trichomonas
           vaginalis G3|Rep: Ubiquitin family protein - Trichomonas
           vaginalis G3
          Length = 341

 Score = 39.9 bits (89), Expect = 0.085
 Identities = 18/50 (36%), Positives = 29/50 (58%)
 Frame = -2

Query: 882 SDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHL 733
           SDT+E +K  +  + GIP NQQ L F    L++  T+S   ++  S ++L
Sbjct: 209 SDTVEKLKRNLVQRTGIPINQQLLYFKSDILKNDSTISSLKLENRSRVYL 258


>UniRef50_A2DZ98 Cluster: Ubiquitin family protein; n=1; Trichomonas
           vaginalis G3|Rep: Ubiquitin family protein - Trichomonas
           vaginalis G3
          Length = 271

 Score = 39.9 bits (89), Expect = 0.085
 Identities = 18/44 (40%), Positives = 27/44 (61%), Gaps = 1/44 (2%)
 Frame = -2

Query: 885 PSD-TIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNI 757
           P D T++++K    D   IP    +LIF GK L++G  +S+YNI
Sbjct: 26  PKDITVDSLKVLASDFTNIPVENMKLIFCGKSLKNGTKISEYNI 69


>UniRef50_A0DJC7 Cluster: Chromosome undetermined scaffold_53, whole
           genome shotgun sequence; n=1; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_53,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 442

 Score = 39.9 bits (89), Expect = 0.085
 Identities = 21/49 (42%), Positives = 29/49 (59%)
 Frame = -2

Query: 879 DTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHL 733
           D +E +   IQ KEGIPP +Q+L    K L+    ++   I+K STLHL
Sbjct: 97  DYLEQITDYIQQKEGIPPKRQKLYLGPKILD---KINSKTIKKNSTLHL 142



 Score = 34.7 bits (76), Expect = 3.2
 Identities = 17/50 (34%), Positives = 28/50 (56%)
 Frame = -2

Query: 882 SDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHL 733
           ++ + ++K K+  +   P + Q LIF  + L+D   L DY IQK S + L
Sbjct: 166 NECVRDIKFKLLQEYEYPFHSQLLIFKNRLLKDDFKLHDYKIQKHSVILL 215


>UniRef50_A7QS28 Cluster: Chromosome undetermined scaffold_155,
           whole genome shotgun sequence; n=1; Vitis vinifera|Rep:
           Chromosome undetermined scaffold_155, whole genome
           shotgun sequence - Vitis vinifera (Grape)
          Length = 744

 Score = 39.5 bits (88), Expect = 0.11
 Identities = 19/48 (39%), Positives = 30/48 (62%)
 Frame = -2

Query: 873 IENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           + ++K +I    G+  +QQRLI  GK L+D + L  Y+++   TLHLV
Sbjct: 39  VPDLKQQIATVTGVLSDQQRLICRGKVLKDDQRLCAYHVEDGHTLHLV 86


>UniRef50_Q56J89 Cluster: RAD23B-like protein; n=1; Adineta
           ricciae|Rep: RAD23B-like protein - Adineta ricciae
          Length = 244

 Score = 39.5 bits (88), Expect = 0.11
 Identities = 24/56 (42%), Positives = 35/56 (62%), Gaps = 3/56 (5%)
 Frame = -2

Query: 888 EPSDTIENVKAKI--QD-KEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           E SDT+  +K KI  +D K+    +  +LIF+GK LED +TL  Y+I  +S L +V
Sbjct: 18  ELSDTVRTIKEKIAAKDLKDKYEADAVKLIFSGKILEDSKTLEFYSITSDSFLVVV 73


>UniRef50_Q386A3 Cluster: Ubiquitin-like protein, putative; n=1;
           Trypanosoma brucei|Rep: Ubiquitin-like protein, putative
           - Trypanosoma brucei
          Length = 620

 Score = 39.5 bits (88), Expect = 0.11
 Identities = 18/54 (33%), Positives = 34/54 (62%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           V+  + +E ++ +I ++ G PP Q RLI  G+ ++  R LS + +Q  +T+H+V
Sbjct: 19  VDVEEGVEGLRRRIGERLGAPPEQLRLIHMGQLIDGSRPLSSF-LQDGTTVHVV 71


>UniRef50_A2E296 Cluster: Ubiquitin family protein; n=1; Trichomonas
           vaginalis G3|Rep: Ubiquitin family protein - Trichomonas
           vaginalis G3
          Length = 405

 Score = 39.5 bits (88), Expect = 0.11
 Identities = 20/52 (38%), Positives = 29/52 (55%)
 Frame = -2

Query: 885 PSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           P  TI  +K KI  +  +   + RLI++GK L D  T+S YNI     +H+V
Sbjct: 20  PELTIAQLKQKIAAERNLDATKIRLIYSGKILADTNTISFYNIPDGHAVHMV 71


>UniRef50_A7FA67 Cluster: Putative uncharacterized protein; n=1;
           Botryotinia fuckeliana B05.10|Rep: Putative
           uncharacterized protein - Botryotinia fuckeliana B05.10
          Length = 392

 Score = 39.5 bits (88), Expect = 0.11
 Identities = 24/49 (48%), Positives = 28/49 (57%)
 Frame = -2

Query: 876 TIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           TI  +K  I +KEGI  + QR IF GK L D  TL D +     TLHLV
Sbjct: 170 TIGALKNHIMNKEGIATDHQRFIFGGKVLRDHDTLGDID---GITLHLV 215


>UniRef50_Q96PU4 Cluster: E3 ubiquitin-protein ligase UHRF2; n=26;
           Euteleostomi|Rep: E3 ubiquitin-protein ligase UHRF2 -
           Homo sapiens (Human)
          Length = 802

 Score = 39.5 bits (88), Expect = 0.11
 Identities = 18/49 (36%), Positives = 29/49 (59%)
 Frame = -2

Query: 876 TIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           TIE ++ ++     + P  QRL + GKQLE+G TL DY++     + L+
Sbjct: 24  TIEELRERVWALFDVRPECQRLFYRGKQLENGYTLFDYDVGLNDIIQLL 72


>UniRef50_UPI0000DB7150 Cluster: PREDICTED: similar to
           HLA-B-associated transcript 3; n=1; Apis mellifera|Rep:
           PREDICTED: similar to HLA-B-associated transcript 3 -
           Apis mellifera
          Length = 461

 Score = 39.1 bits (87), Expect = 0.15
 Identities = 17/49 (34%), Positives = 30/49 (61%)
 Frame = -2

Query: 876 TIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           T+   K  I +   +P + QRLI+ G+ L+D + L+DY++  +  +HLV
Sbjct: 24  TVRGFKEYIAETVAVPADSQRLIYCGRVLQDEKKLNDYDVNGK-VIHLV 71


>UniRef50_A7QF39 Cluster: Chromosome chr16 scaffold_86, whole genome
           shotgun sequence; n=2; Vitis vinifera|Rep: Chromosome
           chr16 scaffold_86, whole genome shotgun sequence - Vitis
           vinifera (Grape)
          Length = 529

 Score = 39.1 bits (87), Expect = 0.15
 Identities = 20/52 (38%), Positives = 31/52 (59%), Gaps = 1/52 (1%)
 Frame = -2

Query: 882 SDTIENVKAKIQDKEGIPPNQQRLIFAGKQL-EDGRTLSDYNIQKESTLHLV 730
           SD+I +VK KIQ  +G     Q+L+F G++L  +   + DY +   + LHLV
Sbjct: 52  SDSIASVKRKIQTFKGSFVKMQKLVFEGRELARNNSRVQDYGVTDGNVLHLV 103


>UniRef50_A7P609 Cluster: Chromosome chr4 scaffold_6, whole genome
           shotgun sequence; n=1; Vitis vinifera|Rep: Chromosome
           chr4 scaffold_6, whole genome shotgun sequence - Vitis
           vinifera (Grape)
          Length = 573

 Score = 39.1 bits (87), Expect = 0.15
 Identities = 19/45 (42%), Positives = 28/45 (62%)
 Frame = -2

Query: 864 VKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           +K +I    G+   QQRLI  G+ L+D + LS Y+++   TLHLV
Sbjct: 49  LKEQIASVTGVLSEQQRLICRGRVLKDDQLLSAYHVEDGHTLHLV 93


>UniRef50_Q86Q31 Cluster: Scythe-like protein; n=1; Hydra
           vulgaris|Rep: Scythe-like protein - Hydra attenuata
           (Hydra) (Hydra vulgaris)
          Length = 140

 Score = 39.1 bits (87), Expect = 0.15
 Identities = 19/49 (38%), Positives = 29/49 (59%)
 Frame = -2

Query: 876 TIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           T+++ K  I     IP N+QR+IF GK L+D R + +Y +     +HLV
Sbjct: 23  TVKDFKELISQDVNIPVNKQRIIFKGKVLQDERKILEYGVD-GCVVHLV 70


>UniRef50_Q4T7D6 Cluster: Chromosome undetermined SCAF8128, whole
           genome shotgun sequence; n=2; Coelomata|Rep: Chromosome
           undetermined SCAF8128, whole genome shotgun sequence -
           Tetraodon nigroviridis (Green puffer)
          Length = 320

 Score = 38.7 bits (86), Expect = 0.20
 Identities = 17/52 (32%), Positives = 32/52 (61%), Gaps = 3/52 (5%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQ---DKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKES 745
           ++P  T++ +K KI+    K+  P + Q+LI+AGK L+D   + +Y I + +
Sbjct: 17  IDPEQTVKALKEKIEAERGKDNFPVSGQKLIYAGKILQDDTPIKEYKIDERN 68


>UniRef50_Q9ZT95 Cluster: Putative ubiquitin-like protein; n=2;
           Arabidopsis thaliana|Rep: Putative ubiquitin-like
           protein - Arabidopsis thaliana (Mouse-ear cress)
          Length = 270

 Score = 38.7 bits (86), Expect = 0.20
 Identities = 21/53 (39%), Positives = 30/53 (56%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHL 733
           ++  +T+  +K KI+  +GIP ++Q L   GK LED     DY I  ES L L
Sbjct: 17  IDFGETVLEIKEKIEKSQGIPVSKQILYLDGKALEDDLHKIDYMILFESRLLL 69


>UniRef50_Q0KIL5 Cluster: Putative uncharacterized protein; n=1;
           Solanum demissum|Rep: Putative uncharacterized protein -
           Solanum demissum (Wild potato)
          Length = 135

 Score = 38.7 bits (86), Expect = 0.20
 Identities = 22/48 (45%), Positives = 31/48 (64%), Gaps = 1/48 (2%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFA-GKQLEDGRTLSDYNIQK 751
           V+P +TI  VKA IQ+++ IP  +QRL+   GK L D +TL    I+K
Sbjct: 15  VDPGNTIVVVKAYIQEEKHIPFKKQRLLSKDGKDLSDAQTLFALGIKK 62


>UniRef50_Q9VWD9 Cluster: CG14224-PA; n=4; Endopterygota|Rep:
           CG14224-PA - Drosophila melanogaster (Fruit fly)
          Length = 547

 Score = 38.7 bits (86), Expect = 0.20
 Identities = 21/54 (38%), Positives = 30/54 (55%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           V+    I++ K  +  K    P Q  LIFAGK ++D  TL  +NI+   T+HLV
Sbjct: 24  VDEDSGIKDFKILVAQKFEAEPEQLVLIFAGKIMKDTDTLQMHNIKDNLTVHLV 77


>UniRef50_Q0W6G3 Cluster: 30S ribosomal protein S27AE; n=2;
           Euryarchaeota|Rep: 30S ribosomal protein S27AE -
           Uncultured methanogenic archaeon RC-I
          Length = 44

 Score = 38.7 bits (86), Expect = 0.20
 Identities = 20/42 (47%), Positives = 27/42 (64%)
 Frame = -2

Query: 624 YKVDENGKIHRLRRECTGEQCGAGVFMAVMEDRHYCGKCHST 499
           Y+V ++GK+ R  + C   +CG GVFMA  +DR  CGKC  T
Sbjct: 2   YEV-KDGKVSRKGQTCP--RCGDGVFMAAHKDRVSCGKCGYT 40


>UniRef50_O74803 Cluster: UV excision repair protein rhp23; n=1;
           Schizosaccharomyces pombe|Rep: UV excision repair
           protein rhp23 - Schizosaccharomyces pombe (Fission
           yeast)
          Length = 368

 Score = 38.7 bits (86), Expect = 0.20
 Identities = 17/46 (36%), Positives = 32/46 (69%), Gaps = 1/46 (2%)
 Frame = -2

Query: 882 SDT-IENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKE 748
           +DT I  +K KIQ ++     +Q+LI++G+ L D +T+ +YNI+++
Sbjct: 20  ADTKISELKEKIQTQQNYEVERQKLIYSGRILADDKTVGEYNIKEQ 65


>UniRef50_UPI000023F381 Cluster: hypothetical protein FG08156.1;
           n=1; Gibberella zeae PH-1|Rep: hypothetical protein
           FG08156.1 - Gibberella zeae PH-1
          Length = 424

 Score = 38.3 bits (85), Expect = 0.26
 Identities = 15/42 (35%), Positives = 27/42 (64%)
 Frame = -2

Query: 882 SDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNI 757
           +DT+   KA+ + KE +P +  R  +  +QLED  TL++Y++
Sbjct: 216 ADTVAEFKARFEAKEKVPADLLRFTYGRRQLEDHETLAEYHL 257


>UniRef50_Q4RRW6 Cluster: Chromosome 7 SCAF15001, whole genome
           shotgun sequence; n=2; Tetraodontidae|Rep: Chromosome 7
           SCAF15001, whole genome shotgun sequence - Tetraodon
           nigroviridis (Green puffer)
          Length = 280

 Score = 38.3 bits (85), Expect = 0.26
 Identities = 16/54 (29%), Positives = 30/54 (55%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           V  +DT+  +K ++Q  EG+  + QR  F+G+ L D   L   NI ++  + ++
Sbjct: 223 VRSTDTVGMMKRRLQSHEGVAASTQRWFFSGRPLTDRLRLDQLNISRDYVVQVI 276


>UniRef50_Q9FY57 Cluster: Putative uncharacterized protein T5K6_70;
           n=1; Arabidopsis thaliana|Rep: Putative uncharacterized
           protein T5K6_70 - Arabidopsis thaliana (Mouse-ear cress)
          Length = 352

 Score = 38.3 bits (85), Expect = 0.26
 Identities = 20/55 (36%), Positives = 36/55 (65%), Gaps = 1/55 (1%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQ-RLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VE +  + ++K  I    G+ P +Q RL+F G+ L++ + LSDY++++  TL+LV
Sbjct: 27  VERTIPVRDLKQDICYYCGVSPERQPRLLFRGRVLKNDQRLSDYHVEEGHTLYLV 81


>UniRef50_Q5JNE7 Cluster: Putative uncharacterized protein
           P0435H01.36; n=3; Oryza sativa|Rep: Putative
           uncharacterized protein P0435H01.36 - Oryza sativa
           subsp. japonica (Rice)
          Length = 314

 Score = 38.3 bits (85), Expect = 0.26
 Identities = 19/49 (38%), Positives = 29/49 (59%), Gaps = 1/49 (2%)
 Frame = -2

Query: 876 TIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGR-TLSDYNIQKESTLHL 733
           T+  VK  +  +E I    QRL FAG+ L+D   TL+DY ++ +S + L
Sbjct: 23  TVAQVKGMVMARERIAVAMQRLFFAGRCLDDDHSTLADYGVRHDSVVFL 71


>UniRef50_A2EJ41 Cluster: Ubiquitin family protein; n=1; Trichomonas
           vaginalis G3|Rep: Ubiquitin family protein - Trichomonas
           vaginalis G3
          Length = 277

 Score = 38.3 bits (85), Expect = 0.26
 Identities = 18/45 (40%), Positives = 30/45 (66%)
 Frame = -2

Query: 864 VKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           +K  IQ  +GI  +QQRLIF G  +++G +L  ++IQ  S +++V
Sbjct: 230 LKYIIQQTKGISVSQQRLIFDGTYIDNGSSLMSHDIQNGSIIYVV 274


>UniRef50_Q8N7F7 Cluster: Ubiquitin-like protein 4B; n=9;
           Eutheria|Rep: Ubiquitin-like protein 4B - Homo sapiens
           (Human)
          Length = 174

 Score = 38.3 bits (85), Expect = 0.26
 Identities = 16/54 (29%), Positives = 32/54 (59%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           V   +++  +K  +  +  +P  QQ L+F G+ LED + LSDY I   ++++++
Sbjct: 17  VSGQESVATLKRLVSRRLKVPEEQQHLLFRGQLLEDDKHLSDYCIGPNASINVI 70


>UniRef50_Q15459 Cluster: Splicing factor 3 subunit 1; n=43;
           Coelomata|Rep: Splicing factor 3 subunit 1 - Homo
           sapiens (Human)
          Length = 793

 Score = 38.3 bits (85), Expect = 0.26
 Identities = 15/50 (30%), Positives = 30/50 (60%)
 Frame = -2

Query: 882 SDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHL 733
           +D +  +K KI +  G+P  +Q+L + G  ++D  +L+ YN+   + +HL
Sbjct: 734 TDQVSVIKVKIHEATGMPAGKQKLQYEGIFIKDSNSLAYYNMANGAVIHL 783


>UniRef50_P54725 Cluster: UV excision repair protein RAD23 homolog
           A; n=21; Eutheria|Rep: UV excision repair protein RAD23
           homolog A - Homo sapiens (Human)
          Length = 363

 Score = 38.3 bits (85), Expect = 0.26
 Identities = 19/52 (36%), Positives = 33/52 (63%), Gaps = 3/52 (5%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEG---IPPNQQRLIFAGKQLEDGRTLSDYNIQKES 745
           +EP +T++ +K KI+ ++G    P   Q+LI+AGK L D   + DY I +++
Sbjct: 19  MEPDETVKVLKEKIEAEKGRDAFPVAGQKLIYAGKILSDDVPIRDYRIDEKN 70


>UniRef50_UPI00015B5080 Cluster: PREDICTED: similar to NP95; n=1;
           Nasonia vitripennis|Rep: PREDICTED: similar to NP95 -
           Nasonia vitripennis
          Length = 740

 Score = 37.9 bits (84), Expect = 0.34
 Identities = 19/48 (39%), Positives = 29/48 (60%)
 Frame = -2

Query: 873 IENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           I  +KA I+++ GI   +Q L F GK LED  TL DY+I   + + ++
Sbjct: 24  IAALKADIEEEFGIKKAKQGLFFRGKHLEDDCTLYDYSININNVIQVL 71


>UniRef50_Q8LF25 Cluster: DNA-damage inducible protein DDI1-like;
           n=7; Magnoliophyta|Rep: DNA-damage inducible protein
           DDI1-like - Arabidopsis thaliana (Mouse-ear cress)
          Length = 414

 Score = 37.9 bits (84), Expect = 0.34
 Identities = 15/54 (27%), Positives = 33/54 (61%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           V+  +T+ENVKA ++ +  +P  QQ+L++ G ++ +   LS   ++ +  L ++
Sbjct: 17  VDSQETVENVKALLEVESNVPIQQQQLLYNGNEMGNSDKLSALGVKDDDLLMMM 70


>UniRef50_P91055 Cluster: Putative uncharacterized protein; n=1;
           Caenorhabditis elegans|Rep: Putative uncharacterized
           protein - Caenorhabditis elegans
          Length = 592

 Score = 37.9 bits (84), Expect = 0.34
 Identities = 18/50 (36%), Positives = 30/50 (60%)
 Frame = -2

Query: 882 SDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHL 733
           SDTI ++K +I     +  +  R++  GK LED  +L+ YNIQ+ + + L
Sbjct: 215 SDTIRHIKLRINSLAKVDISSFRMVLRGKLLEDHHSLAYYNIQEGALIWL 264


>UniRef50_A0BMS1 Cluster: Chromosome undetermined scaffold_117,
           whole genome shotgun sequence; n=1; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_117,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 1189

 Score = 37.9 bits (84), Expect = 0.34
 Identities = 22/65 (33%), Positives = 30/65 (46%)
 Frame = -2

Query: 876 TIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVXXXXXXXXXXX 697
           T+  +K KI  K  IP   Q+L + GK L++  TL DY IQ  S + L            
Sbjct: 339 TVLELKQKIYHKLNIPTTFQQLHYVGKVLDNTGTLQDYGIQNLSNIILTFKALDSYPFQQ 398

Query: 696 XKNYS 682
             NY+
Sbjct: 399 SYNYN 403


>UniRef50_Q4PEX0 Cluster: Putative uncharacterized protein; n=1;
           Ustilago maydis|Rep: Putative uncharacterized protein -
           Ustilago maydis (Smut fungus)
          Length = 462

 Score = 37.9 bits (84), Expect = 0.34
 Identities = 19/54 (35%), Positives = 33/54 (61%), Gaps = 1/54 (1%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGR-TLSDYNIQKESTLHL 733
           V+ S  IEN++A ++    IP +QQ+L+  G+ L+D + TL+   +Q +  L L
Sbjct: 16  VDASIEIENLRALLEVDSNIPADQQQLLHGGRPLDDAKATLASCGVQNDDLLLL 69


>UniRef50_Q10169 Cluster: Deubiquitination-protection protein dph1;
           n=1; Schizosaccharomyces pombe|Rep:
           Deubiquitination-protection protein dph1 -
           Schizosaccharomyces pombe (Fission yeast)
          Length = 354

 Score = 37.9 bits (84), Expect = 0.34
 Identities = 19/54 (35%), Positives = 30/54 (55%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           V+   ++  +K  I     I   +QRLI+AG+ L+D  +L  Y IQ   ++HLV
Sbjct: 20  VDSESSVLALKEAIAPVADIEKERQRLIYAGRVLKDEESLKTYKIQDGHSIHLV 73


>UniRef50_UPI0000498B1D Cluster: ubiquitin-like protein; n=1;
           Entamoeba histolytica HM-1:IMSS|Rep: ubiquitin-like
           protein - Entamoeba histolytica HM-1:IMSS
          Length = 327

 Score = 37.5 bits (83), Expect = 0.45
 Identities = 20/49 (40%), Positives = 28/49 (57%)
 Frame = -2

Query: 876 TIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           T+  +K KI +++     + RLIFAG+ L+D   LS   I    TLHLV
Sbjct: 27  TVSGIKEKIHNQQP-DVGEFRLIFAGRVLKDDEVLSTLGINNNVTLHLV 74


>UniRef50_Q015S3 Cluster: Ubiquitin-conjugating enzyme 9 homolog;
           n=1; Ostreococcus tauri|Rep: Ubiquitin-conjugating
           enzyme 9 homolog - Ostreococcus tauri
          Length = 353

 Score = 37.5 bits (83), Expect = 0.45
 Identities = 14/33 (42%), Positives = 24/33 (72%)
 Frame = +1

Query: 781 SIFQLLSSKDQPLLIGRDSLFVLNFSFHILDGI 879
           ++ +LL+ +DQ LLI RD L +L+   H++DG+
Sbjct: 144 AVLELLTREDQTLLIRRDPLLILDLRLHVVDGV 176


>UniRef50_O03991 Cluster: RAD23 protein, isoform II; n=1; Daucus
           carota|Rep: RAD23 protein, isoform II - Daucus carota
           (Carrot)
          Length = 379

 Score = 37.5 bits (83), Expect = 0.45
 Identities = 20/53 (37%), Positives = 31/53 (58%), Gaps = 3/53 (5%)
 Frame = -2

Query: 888 EPSDTIENVKAKIQD---KEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTL 739
           +P+DT+  +K  I+D   K+  P  QQ LI  GK L+D  TL++  I ++  L
Sbjct: 18  QPNDTVMAIKKNIEDLQGKDNYPCGQQLLIHNGKVLKDESTLAESKISEDGFL 70


>UniRef50_Q8IAZ4 Cluster: Putative uncharacterized protein
           PF08_0067; n=1; Plasmodium falciparum 3D7|Rep: Putative
           uncharacterized protein PF08_0067 - Plasmodium
           falciparum (isolate 3D7)
          Length = 364

 Score = 37.5 bits (83), Expect = 0.45
 Identities = 18/54 (33%), Positives = 33/54 (61%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           +E  D I+N+K KI++  GIP   Q +++  K+LE+  T+   NI K+  + ++
Sbjct: 88  MEEKDNIKNIKKKIEEIYGIPLTLQEILYDNKKLENNITIQ--NIIKDKQIKIL 139


>UniRef50_Q7PRQ2 Cluster: ENSANGP00000017457; n=1; Anopheles gambiae
           str. PEST|Rep: ENSANGP00000017457 - Anopheles gambiae
           str. PEST
          Length = 300

 Score = 37.5 bits (83), Expect = 0.45
 Identities = 17/43 (39%), Positives = 27/43 (62%), Gaps = 2/43 (4%)
 Frame = -2

Query: 879 DTIENVKAKIQDKEGI--PPNQQRLIFAGKQLEDGRTLSDYNI 757
           DT+  +K K+  + G+  P ++QRLI+ GK +ED   LS Y +
Sbjct: 22  DTVRTLKEKLHAESGLAYPVDRQRLIYLGKIMEDDHLLSQYKL 64


>UniRef50_O44820 Cluster: Putative uncharacterized protein; n=2;
           Caenorhabditis elegans|Rep: Putative uncharacterized
           protein - Caenorhabditis elegans
          Length = 197

 Score = 37.5 bits (83), Expect = 0.45
 Identities = 23/53 (43%), Positives = 31/53 (58%), Gaps = 3/53 (5%)
 Frame = -2

Query: 882 SDTIENVKAKIQDKEGIPPNQQRLIFAGKQLE---DGRTLSDYNIQKESTLHL 733
           SDT+ +VKAKI +K  I PN Q+L+     L+   D  TL D + +  STL L
Sbjct: 121 SDTMASVKAKIWEKLRILPNTQKLLLENWDLDLFSDHSTLFDNSFENGSTLRL 173


>UniRef50_A6S9G3 Cluster: Putative uncharacterized protein; n=2;
           Sclerotiniaceae|Rep: Putative uncharacterized protein -
           Botryotinia fuckeliana B05.10
          Length = 206

 Score = 37.5 bits (83), Expect = 0.45
 Identities = 16/51 (31%), Positives = 32/51 (62%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTL 739
           + P+ +I N+K  + +KEGIP ++ RL++  K + D + L D   ++E+ +
Sbjct: 80  LSPNTSILNLKESLSEKEGIPVDKLRLLYNKKPVGDAKVLKDVIGEEETKI 130


>UniRef50_A6S7C5 Cluster: Predicted protein; n=2;
           Sclerotiniaceae|Rep: Predicted protein - Botryotinia
           fuckeliana B05.10
          Length = 169

 Score = 37.5 bits (83), Expect = 0.45
 Identities = 18/52 (34%), Positives = 30/52 (57%), Gaps = 1/52 (1%)
 Frame = -2

Query: 885 PSDT-IENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHL 733
           P DT I N+   +  +   P +  RL+ AG+ L+   TL+  NI ++ST+H+
Sbjct: 39  PEDTTISNLAHLLSIRTSSPSSTLRLVHAGRHLQPSSTLTSNNITRDSTIHV 90


>UniRef50_Q8WUN7 Cluster: Ubiquitin domain-containing protein 2;
           n=43; Eukaryota|Rep: Ubiquitin domain-containing protein
           2 - Homo sapiens (Human)
          Length = 234

 Score = 37.5 bits (83), Expect = 0.45
 Identities = 15/54 (27%), Positives = 29/54 (53%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           V  +DT+ ++K ++   EG+ P  QR  F+G+ L D     +  I K+  + ++
Sbjct: 168 VRSTDTVFHMKRRLHAAEGVEPGSQRWFFSGRPLTDKMKFEELKIPKDYVVQVI 221


>UniRef50_Q3ECA5 Cluster: Uncharacterized protein At1g79650.3; n=2;
           Arabidopsis thaliana|Rep: Uncharacterized protein
           At1g79650.3 - Arabidopsis thaliana (Mouse-ear cress)
          Length = 351

 Score = 37.1 bits (82), Expect = 0.60
 Identities = 23/54 (42%), Positives = 30/54 (55%), Gaps = 3/54 (5%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEG---IPPNQQRLIFAGKQLEDGRTLSDYNIQKESTL 739
           V PSDTI  VK  I+D +G    P  QQ LI  GK L+D  +L +  + +E  L
Sbjct: 17  VLPSDTIMAVKKNIEDSQGKDNYPCGQQLLIHNGKVLKDETSLVENKVTEEGFL 70


>UniRef50_Q173F1 Cluster: Ubiquilin 1,2; n=5; Neoptera|Rep:
           Ubiquilin 1,2 - Aedes aegypti (Yellowfever mosquito)
          Length = 505

 Score = 37.1 bits (82), Expect = 0.60
 Identities = 19/54 (35%), Positives = 32/54 (59%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           +E    I+ ++A + ++    P+   LIFAGK ++D  TL  +NI+   T+HLV
Sbjct: 25  IEEDAEIKELRATVAEQFESDPDLVCLIFAGKIMKDTDTLKTHNIKDGLTVHLV 78


>UniRef50_A7RES3 Cluster: Predicted protein; n=3; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 762

 Score = 37.1 bits (82), Expect = 0.60
 Identities = 17/50 (34%), Positives = 29/50 (58%)
 Frame = -2

Query: 882 SDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHL 733
           +D +  +KAKI +  G+P  +Q+L   G  ++D  +L+ YN    ST+ L
Sbjct: 703 TDQVSVIKAKIHETIGMPAGKQKLQLGGIFIKDSNSLAYYNFGPASTVQL 752


>UniRef50_A0CBZ8 Cluster: Chromosome undetermined scaffold_166,
           whole genome shotgun sequence; n=1; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_166,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 351

 Score = 37.1 bits (82), Expect = 0.60
 Identities = 20/51 (39%), Positives = 29/51 (56%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTL 739
           VE SDTI +VK KI   +     QQ+L+  G  L+D  T+++  IQ+   L
Sbjct: 17  VEGSDTISDVKEKIFQVKQFEVGQQKLLRKGTLLDDKTTIAELGIQENEFL 67


>UniRef50_Q6C8W3 Cluster: Similar to sp|O74803 Schizosaccharomyces
           pombe UV excision repair protein rhp23; n=1; Yarrowia
           lipolytica|Rep: Similar to sp|O74803 Schizosaccharomyces
           pombe UV excision repair protein rhp23 - Yarrowia
           lipolytica (Candida lipolytica)
          Length = 359

 Score = 37.1 bits (82), Expect = 0.60
 Identities = 15/49 (30%), Positives = 31/49 (63%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKES 745
           VEPSDT+E +K K  + +      Q++I++GK L +  ++   N+++++
Sbjct: 17  VEPSDTVETLKTKNAEGKDYGVGDQKMIYSGKILANTTSIESLNLKEDA 65


>UniRef50_Q5KCT4 Cluster: Putative uncharacterized protein; n=1;
           Filobasidiella neoformans|Rep: Putative uncharacterized
           protein - Cryptococcus neoformans (Filobasidiella
           neoformans)
          Length = 319

 Score = 37.1 bits (82), Expect = 0.60
 Identities = 18/53 (33%), Positives = 32/53 (60%), Gaps = 2/53 (3%)
 Frame = -2

Query: 882 SDTIENVKAKI-QDKEGIP-PNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           +DT+ ++K  I +     P P+ QRL+  GK L D + L +Y ++  +T+HL+
Sbjct: 130 TDTVSDLKTIISKSSASAPAPDAQRLLLKGKALTDTKLLKEYALESGATVHLI 182


>UniRef50_Q8TVD7 Cluster: 30S ribosomal protein S27ae; n=21;
           Euryarchaeota|Rep: 30S ribosomal protein S27ae -
           Methanopyrus kandleri
          Length = 60

 Score = 37.1 bits (82), Expect = 0.60
 Identities = 21/49 (42%), Positives = 30/49 (61%)
 Frame = -2

Query: 630 RFYKVDENGKIHRLRRECTGEQCGAGVFMAVMEDRHYCGKCHSTMVFKD 484
           + Y+V ++GK+ R    C   +CG GVFMA   +R+ CG+C  T  FKD
Sbjct: 8   KLYEV-KDGKVERKNPFCP--RCGPGVFMADHGNRYACGRCGYT-EFKD 52


>UniRef50_P32628 Cluster: UV excision repair protein RAD23; n=4;
           Saccharomycetales|Rep: UV excision repair protein RAD23
           - Saccharomyces cerevisiae (Baker's yeast)
          Length = 398

 Score = 37.1 bits (82), Expect = 0.60
 Identities = 16/46 (34%), Positives = 29/46 (63%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQ 754
           +EPS+TI   K K+        +Q +LI++GK L+D +T+S+  ++
Sbjct: 18  LEPSNTILETKTKLAQSISCEESQIKLIYSGKVLQDSKTVSECGLK 63


>UniRef50_Q54JB0 Cluster: Putative uncharacterized protein; n=1;
           Dictyostelium discoideum AX4|Rep: Putative
           uncharacterized protein - Dictyostelium discoideum AX4
          Length = 450

 Score = 36.7 bits (81), Expect = 0.79
 Identities = 16/46 (34%), Positives = 30/46 (65%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQ 754
           ++P  T+E++K +++ +  I  N Q L   GK L++ + LSDY+I+
Sbjct: 18  LQPDQTVEDLKRRVEFETTILVNNQVLTLDGKVLDNEKKLSDYSIK 63


>UniRef50_Q174A3 Cluster: Ubiquitin conjugating enzyme 7 interacting
            protein; n=2; Culicidae|Rep: Ubiquitin conjugating enzyme
            7 interacting protein - Aedes aegypti (Yellowfever
            mosquito)
          Length = 1829

 Score = 36.7 bits (81), Expect = 0.79
 Identities = 20/42 (47%), Positives = 26/42 (61%), Gaps = 1/42 (2%)
 Frame = -2

Query: 876  TIENVKAKIQDKEGIPPNQQRLIFAGKQL-EDGRTLSDYNIQ 754
            T+  +K KI    GIP   QR I+  +QL E+ RTLS+Y IQ
Sbjct: 1236 TLLQLKEKINKDFGIPAQVQRWIYKDRQLCEEHRTLSEYGIQ 1277


>UniRef50_A6ND44 Cluster: Uncharacterized protein UBQLN4; n=2; Homo
           sapiens|Rep: Uncharacterized protein UBQLN4 - Homo
           sapiens (Human)
          Length = 226

 Score = 36.7 bits (81), Expect = 0.79
 Identities = 19/49 (38%), Positives = 30/49 (61%)
 Frame = -2

Query: 876 TIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           +++  K +I  +     +Q  LIFAGK L+DG TL+ + I+   T+HLV
Sbjct: 33  SVKEFKEEISRRFKAQQDQLVLIFAGKILKDGDTLNQHGIKDGLTVHLV 81


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 807,639,041
Number of Sequences: 1657284
Number of extensions: 15807666
Number of successful extensions: 39417
Number of sequences better than 10.0: 294
Number of HSP's better than 10.0 without gapping: 37814
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 39389
length of database: 575,637,011
effective HSP length: 100
effective length of database: 409,908,611
effective search space used: 80342087756
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).