SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= cesb0023
         (852 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_A0MNZ0 Cluster: NADPH oxidoreductase; n=1; Bombyx mori|...    60   5e-08
UniRef50_Q4ZT67 Cluster: Amino acid adenylation; n=15; Bacteria|...    36   1.7  
UniRef50_Q8D2V4 Cluster: Ffh protein; n=1; Wigglesworthia glossi...    35   3.0  

>UniRef50_A0MNZ0 Cluster: NADPH oxidoreductase; n=1; Bombyx
           mori|Rep: NADPH oxidoreductase - Bombyx mori (Silk moth)
          Length = 191

 Score = 60.5 bits (140), Expect = 5e-08
 Identities = 28/38 (73%), Positives = 30/38 (78%)
 Frame = +3

Query: 174 FL*HRWVDVLTAHLVLSGYPKPIDIYNVNAPPTLRYKF 287
           FL  RWVD LTAHLVLSGY  P  +Y+VNAPPT RYKF
Sbjct: 154 FLLLRWVDELTAHLVLSGYWSPRHLYDVNAPPTSRYKF 191


>UniRef50_Q4ZT67 Cluster: Amino acid adenylation; n=15; Bacteria|Rep:
             Amino acid adenylation - Pseudomonas syringae pv. syringae
             (strain B728a)
          Length = 13537

 Score = 35.5 bits (78), Expect = 1.7
 Identities = 19/63 (30%), Positives = 36/63 (57%), Gaps = 2/63 (3%)
 Frame = +3

Query: 450   LVPTSGKKNDVYPLYTMRRSKHPIKHFLKN*SCLN--IEEERLFGLNNIFVILQESHLKL 623
             +VPT G +N  Y +YT   + +P    +++   +N  ++  RLFGL+    +LQ++ L  
Sbjct: 10387 VVPTLGVRNLAYVIYTSGSTGNPKGVMIEHRGLVNYSVDAARLFGLSQSDTVLQQNTLNF 10446

Query: 624   NIS 632
             ++S
Sbjct: 10447 DLS 10449


>UniRef50_Q8D2V4 Cluster: Ffh protein; n=1; Wigglesworthia
           glossinidia endosymbiont of Glossina brevipalpis|Rep:
           Ffh protein - Wigglesworthia glossinidia brevipalpis
          Length = 446

 Score = 34.7 bits (76), Expect = 3.0
 Identities = 19/60 (31%), Positives = 35/60 (58%), Gaps = 2/60 (3%)
 Frame = +3

Query: 564 ERLFGLNNIFVILQESHLKLNISKKYRNKIKLLRLFDKSK--LN*SSIKNIGLLMLITNK 737
           +++ G+ NIF I+ +  +K+N  KK + K K  + FD +   L+ + +K IG +  I N+
Sbjct: 291 KKILGMENIFSIINDVEIKINKYKKEKIKYKKNKKFDLTDFLLHLNQVKKIGGINKIVNQ 350


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 833,296,043
Number of Sequences: 1657284
Number of extensions: 17211798
Number of successful extensions: 35557
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 34282
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 35548
length of database: 575,637,011
effective HSP length: 100
effective length of database: 409,908,611
effective search space used: 75013275813
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).