SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= cesb0021
         (602 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_UPI0000D55CCD Cluster: PREDICTED: similar to CG2931-PA;...    44   0.004
UniRef50_UPI0000519B2B Cluster: PREDICTED: similar to CG2931-PA ...    39   0.10 
UniRef50_Q0SF15 Cluster: Putative uncharacterized protein; n=1; ...    37   0.32 
UniRef50_Q2GXV2 Cluster: Putative uncharacterized protein; n=1; ...    33   5.2  
UniRef50_A6PQU6 Cluster: Putative uncharacterized protein; n=1; ...    33   6.9  
UniRef50_A5PAN9 Cluster: Resolvase; n=2; Erythrobacter sp. SD-21...    32   9.1  
UniRef50_Q9FM63 Cluster: Genomic DNA, chromosome 5, P1 clone:MDF...    32   9.1  
UniRef50_Q22040 Cluster: Putative uncharacterized protein SSSD1....    32   9.1  

>UniRef50_UPI0000D55CCD Cluster: PREDICTED: similar to CG2931-PA;
           n=1; Tribolium castaneum|Rep: PREDICTED: similar to
           CG2931-PA - Tribolium castaneum
          Length = 294

 Score = 43.6 bits (98), Expect = 0.004
 Identities = 25/60 (41%), Positives = 37/60 (61%)
 Frame = +2

Query: 164 SSKFQQMQDEMSRFEAEISGGTGRAVIGSGTWDAVQARLERVAPMQAPPEPSPSIMAPYE 343
           S+KF+QM+DEMSRFEAEISG T    + S ++ +    L        PP P+P ++ P++
Sbjct: 3   SNKFRQMEDEMSRFEAEISGQT----LMSNSYSSAYG-LPNFG--NIPPPPTPPLLIPHQ 55


>UniRef50_UPI0000519B2B Cluster: PREDICTED: similar to CG2931-PA
           isoform 1; n=2; Apocrita|Rep: PREDICTED: similar to
           CG2931-PA isoform 1 - Apis mellifera
          Length = 326

 Score = 38.7 bits (86), Expect = 0.10
 Identities = 21/43 (48%), Positives = 29/43 (67%), Gaps = 4/43 (9%)
 Frame = +2

Query: 170 KFQQMQDEMSRFEAEISG----GTGRAVIGSGTWDAVQARLER 286
           K +QM+DEM+RFEAEI G       R VIG+ T++ V  +LE+
Sbjct: 4   KLRQMEDEMNRFEAEIGGQLVTPIVRPVIGANTYNQVARQLEQ 46


>UniRef50_Q0SF15 Cluster: Putative uncharacterized protein; n=1;
           Rhodococcus sp. RHA1|Rep: Putative uncharacterized
           protein - Rhodococcus sp. (strain RHA1)
          Length = 413

 Score = 37.1 bits (82), Expect = 0.32
 Identities = 18/41 (43%), Positives = 24/41 (58%)
 Frame = +2

Query: 215 ISGGTGRAVIGSGTWDAVQARLERVAPMQAPPEPSPSIMAP 337
           +SGGT R     GTW +   + ER AP  A P P+P++ AP
Sbjct: 115 VSGGTSRD--HQGTWVSRSVQKERQAPEAAAPAPAPTVAAP 153


>UniRef50_Q2GXV2 Cluster: Putative uncharacterized protein; n=1;
           Chaetomium globosum|Rep: Putative uncharacterized
           protein - Chaetomium globosum (Soil fungus)
          Length = 980

 Score = 33.1 bits (72), Expect = 5.2
 Identities = 17/39 (43%), Positives = 23/39 (58%), Gaps = 2/39 (5%)
 Frame = +1

Query: 232 TCSDRIWHMGCRASPSRTGGSNAGPT--RTQPFDHGTIR 342
           T + RIW  G R +PS TG S +  T  RT+PF  G ++
Sbjct: 340 TPATRIWWAGSRGTPSWTGCSPSSRTAWRTRPFGSGAVK 378


>UniRef50_A6PQU6 Cluster: Putative uncharacterized protein; n=1;
           Victivallis vadensis ATCC BAA-548|Rep: Putative
           uncharacterized protein - Victivallis vadensis ATCC
           BAA-548
          Length = 709

 Score = 32.7 bits (71), Expect = 6.9
 Identities = 23/68 (33%), Positives = 36/68 (52%), Gaps = 4/68 (5%)
 Frame = +2

Query: 152 IMEESSKFQQMQDEMSRFEAEISGGTGRAVIGSGTW-DAVQA---RLERVAPMQAPPEPS 319
           + E +  FQ+M+ E+ ++     G   +A IG G W D+  A   R+E +AP Q  PE  
Sbjct: 116 VSEAAQNFQEMRAELRKYAPLRVGILIQASIGHGYWRDSPPADFTRMETLAPDQ--PEAL 173

Query: 320 PSIMAPYE 343
             I+ PY+
Sbjct: 174 THIVCPYD 181


>UniRef50_A5PAN9 Cluster: Resolvase; n=2; Erythrobacter sp.
           SD-21|Rep: Resolvase - Erythrobacter sp. SD-21
          Length = 554

 Score = 32.3 bits (70), Expect = 9.1
 Identities = 19/45 (42%), Positives = 24/45 (53%), Gaps = 2/45 (4%)
 Frame = +2

Query: 206 EAEISGGTGRAVIGSGTWDAVQARLE--RVAPMQAPPEPSPSIMA 334
           + EI  G   A+I   TWD VQA+LE       QA    SPS++A
Sbjct: 249 KGEIFEGQHAAIIDRETWDRVQAQLEANTQGEQQASTASSPSLLA 293


>UniRef50_Q9FM63 Cluster: Genomic DNA, chromosome 5, P1 clone:MDF20;
           n=1; Arabidopsis thaliana|Rep: Genomic DNA, chromosome
           5, P1 clone:MDF20 - Arabidopsis thaliana (Mouse-ear
           cress)
          Length = 175

 Score = 32.3 bits (70), Expect = 9.1
 Identities = 13/44 (29%), Positives = 23/44 (52%)
 Frame = +2

Query: 206 EAEISGGTGRAVIGSGTWDAVQARLERVAPMQAPPEPSPSIMAP 337
           E   + G   +++G+  + + + RL+R +P   PP PSP    P
Sbjct: 32  ECNCNSGACNSLVGATYYPSCKPRLQRYSPYGNPPPPSPQYSPP 75


>UniRef50_Q22040 Cluster: Putative uncharacterized protein SSSD1.1;
           n=2; Caenorhabditis|Rep: Putative uncharacterized
           protein SSSD1.1 - Caenorhabditis elegans
          Length = 636

 Score = 32.3 bits (70), Expect = 9.1
 Identities = 13/34 (38%), Positives = 20/34 (58%)
 Frame = -3

Query: 342 SYGAMIEGLGSGGACIGATRSRRACTASHVPDPI 241
           SY   IE + + G+    T +RR+CT+ H PD +
Sbjct: 370 SYRVSIESVNAKGSTNSTTYNRRSCTSLHAPDKL 403


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 540,219,428
Number of Sequences: 1657284
Number of extensions: 10253770
Number of successful extensions: 31736
Number of sequences better than 10.0: 8
Number of HSP's better than 10.0 without gapping: 30223
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 31711
length of database: 575,637,011
effective HSP length: 97
effective length of database: 414,880,463
effective search space used: 42732687689
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).