SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= cesb0020
         (788 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_Q4JSC0 Cluster: Actin; n=13; Coelomata|Rep: Actin - Ano...   474   e-132
UniRef50_O65314 Cluster: Actin; n=20; Eukaryota|Rep: Actin - Sch...   457   e-127
UniRef50_Q96483 Cluster: Actin-51; n=584; Eukaryota|Rep: Actin-5...   431   e-119
UniRef50_P02581 Cluster: Actin-1; n=1852; Eukaryota|Rep: Actin-1...   417   e-115
UniRef50_P14883 Cluster: Actin-2; n=75; Eukaryota|Rep: Actin-2 -...   410   e-113
UniRef50_Q0VHZ5 Cluster: Actin deviating protein; n=7; Eukaryota...   320   2e-86
UniRef50_UPI000065FC19 Cluster: Homolog of Homo sapiens "Actin, ...   297   2e-79
UniRef50_A4QNT8 Cluster: Si:ch211-241j12.3 protein; n=3; Danio r...   295   6e-79
UniRef50_UPI0000449751 Cluster: PREDICTED: similar to gamma-acti...   287   3e-76
UniRef50_P61163 Cluster: Alpha-centractin; n=356; root|Rep: Alph...   285   1e-75
UniRef50_Q2GY63 Cluster: Putative uncharacterized protein; n=1; ...   277   2e-73
UniRef50_Q0VHZ6 Cluster: Actin deviating protein; n=2; Bolivina ...   277   3e-73
UniRef50_Q9XZB9 Cluster: Actin; n=1; Sterkiella nova|Rep: Actin ...   273   3e-72
UniRef50_A5E2K2 Cluster: Actin; n=5; Saccharomycetales|Rep: Acti...   271   1e-71
UniRef50_UPI00001E426E Cluster: PREDICTED: similar to actin-12; ...   270   3e-71
UniRef50_A2DKQ5 Cluster: Actin 58, putative; n=2; Trichomonas va...   266   3e-70
UniRef50_UPI00005864C8 Cluster: PREDICTED: similar to Actin; n=4...   266   6e-70
UniRef50_Q4CV94 Cluster: Actin 2, putative; n=2; Trypanosoma cru...   264   2e-69
UniRef50_UPI0000F2D825 Cluster: PREDICTED: similar to actin; n=1...   260   2e-68
UniRef50_Q5KB93 Cluster: Actin binding protein, putative; n=3; F...   255   1e-66
UniRef50_UPI0000F2D326 Cluster: PREDICTED: similar to actin; n=1...   253   4e-66
UniRef50_P61160 Cluster: Actin-related protein 2; n=96; Eukaryot...   250   4e-65
UniRef50_Q8TDY3 Cluster: Actin-related protein T2; n=26; Amniota...   245   9e-64
UniRef50_Q9BYD9 Cluster: Actin-related protein M1; n=12; Theria|...   242   6e-63
UniRef50_Q24C02 Cluster: Actin family protein; n=3; Oligohymenop...   239   7e-62
UniRef50_Q0J646 Cluster: Os08g0369300 protein; n=2; Oryza sativa...   233   4e-60
UniRef50_UPI0001554F81 Cluster: PREDICTED: similar to actin; n=1...   233   5e-60
UniRef50_Q7XB26 Cluster: Ubiquitin/actin fusion protein 4; n=1; ...   225   7e-58
UniRef50_UPI0000588EB0 Cluster: PREDICTED: similar to actin; n=1...   224   2e-57
UniRef50_Q9Y615 Cluster: Actin-like protein 7A; n=11; Mammalia|R...   222   9e-57
UniRef50_Q8IS27 Cluster: Actin-related protein 2; n=5; Oligohyme...   218   1e-55
UniRef50_Q4QG59 Cluster: Actin-like protein, putative; n=3; Leis...   216   5e-55
UniRef50_Q75JT2 Cluster: Similar to Drosophila melanogaster (Fru...   214   2e-54
UniRef50_A2FH22 Cluster: Actin family protein; n=1; Trichomonas ...   211   1e-53
UniRef50_A2DBN6 Cluster: Actin family protein; n=1; Trichomonas ...   209   5e-53
UniRef50_Q4N681 Cluster: Actin, putative; n=3; Piroplasmida|Rep:...   209   7e-53
UniRef50_A0E1S8 Cluster: Chromosome undetermined scaffold_73, wh...   208   9e-53
UniRef50_Q55DS6 Cluster: Putative uncharacterized protein; n=1; ...   204   1e-51
UniRef50_Q9Y614 Cluster: Actin-like protein 7B; n=12; Theria|Rep...   204   1e-51
UniRef50_A2FRF9 Cluster: Actin family protein; n=1; Trichomonas ...   204   2e-51
UniRef50_O96819 Cluster: Actin-related protein; n=5; Trypanosoma...   203   3e-51
UniRef50_A7S2B1 Cluster: Predicted protein; n=1; Nematostella ve...   199   6e-50
UniRef50_Q6X960 Cluster: HSD21; n=13; Theria|Rep: HSD21 - Homo s...   198   1e-49
UniRef50_UPI000049A548 Cluster: actin; n=1; Entamoeba histolytic...   197   3e-49
UniRef50_Q4DMP2 Cluster: Actin-related protein 2, putative; n=4;...   196   5e-49
UniRef50_Q38F20 Cluster: Actin-like protein 3, putative; n=1; Tr...   192   6e-48
UniRef50_Q5CSX9 Cluster: Actin; n=2; Cryptosporidium|Rep: Actin ...   190   3e-47
UniRef50_UPI0000E47BC7 Cluster: PREDICTED: similar to ubiquitin/...   189   8e-47
UniRef50_Q6BG22 Cluster: Actin, putative; n=2; Paramecium tetrau...   189   8e-47
UniRef50_UPI0000605B09 Cluster: PREDICTED: similar to actin alph...   188   2e-46
UniRef50_A0CQQ2 Cluster: Chromosome undetermined scaffold_24, wh...   187   3e-46
UniRef50_P32392 Cluster: Actin-related protein 3; n=27; Eukaryot...   186   6e-46
UniRef50_Q55DY5 Cluster: Putative uncharacterized protein; n=1; ...   185   1e-45
UniRef50_Q4SGD5 Cluster: Chromosome 17 SCAF14597, whole genome s...   184   2e-45
UniRef50_A2VD47 Cluster: Zgc:158823 protein; n=3; Eukaryota|Rep:...   182   7e-45
UniRef50_A2ECQ8 Cluster: Actin family protein; n=1; Trichomonas ...   182   1e-44
UniRef50_UPI0000F2DE11 Cluster: PREDICTED: similar to testis-spe...   179   8e-44
UniRef50_P61158 Cluster: Actin-related protein 3; n=107; Eukaryo...   179   8e-44
UniRef50_Q14BL3 Cluster: RIKEN cDNA 4921517D21 gene; n=7; Euther...   178   1e-43
UniRef50_Q19R57 Cluster: Actin-like protein 1; n=2; Trypanosoma ...   175   8e-43
UniRef50_Q383R8 Cluster: Actin-like protein, putative; n=4; Tryp...   174   2e-42
UniRef50_Q8IIQ4 Cluster: Actin, putative; n=7; Apicomplexa|Rep: ...   173   4e-42
UniRef50_UPI00005A3B5D Cluster: PREDICTED: similar to Actin-5C; ...   172   7e-42
UniRef50_Q54UQ7 Cluster: Actin-like protein 6A; n=1; Dictyosteli...   169   9e-41
UniRef50_A2YUL5 Cluster: Putative uncharacterized protein; n=1; ...   168   2e-40
UniRef50_Q4N7N1 Cluster: Actin, putative; n=2; Theileria|Rep: Ac...   165   1e-39
UniRef50_UPI0000D9A391 Cluster: PREDICTED: actin related protein...   162   1e-38
UniRef50_A2DNQ0 Cluster: Actin family protein; n=1; Trichomonas ...   162   1e-38
UniRef50_Q8LKR2 Cluster: Actin-related protein 4; n=7; core eudi...   161   1e-38
UniRef50_UPI0000E23780 Cluster: PREDICTED: hypothetical protein ...   161   2e-38
UniRef50_UPI0000449ED3 Cluster: PREDICTED: similar to RIKEN cDNA...   155   1e-36
UniRef50_UPI00005A2ACF Cluster: PREDICTED: similar to cytoplasmi...   154   3e-36
UniRef50_Q4Q187 Cluster: Actin-like protein, putative; n=3; Leis...   152   8e-36
UniRef50_UPI0000EC9F4D Cluster: HSD21.; n=2; Gallus gallus|Rep: ...   150   3e-35
UniRef50_Q7M3Y6 Cluster: Actin homolog fat, testicular; n=3; Deu...   150   3e-35
UniRef50_Q963K1 Cluster: Actin-3; n=1; Cercomonas sp. ATCC 50318...   147   3e-34
UniRef50_UPI0000499930 Cluster: actin; n=1; Entamoeba histolytic...   146   4e-34
UniRef50_UPI0000F2D272 Cluster: PREDICTED: similar to actin; n=1...   143   5e-33
UniRef50_Q4QF44 Cluster: Actin-related protein 3, putative; n=3;...   138   1e-31
UniRef50_UPI00015B6274 Cluster: PREDICTED: similar to putative m...   138   1e-31
UniRef50_Q9H568 Cluster: Actin-like protein 8; n=10; Eutheria|Re...   138   1e-31
UniRef50_Q6BG23 Cluster: Actin, putative; n=1; Paramecium tetrau...   138   2e-31
UniRef50_Q19R56 Cluster: Actin-like protein 3; n=4; Trypanosoma ...   132   6e-31
UniRef50_O96019 Cluster: Actin-like protein 6A; n=63; Eumetazoa|...   136   8e-31
UniRef50_A2DEE0 Cluster: Actin family protein; n=1; Trichomonas ...   135   1e-30
UniRef50_UPI00004987CF Cluster: actin; n=2; Entamoeba histolytic...   134   2e-30
UniRef50_Q6FRF2 Cluster: Similar to sp|P38696 Saccharomyces cere...   133   4e-30
UniRef50_A2YQV6 Cluster: Putative uncharacterized protein; n=1; ...   132   7e-30
UniRef50_A7AS14 Cluster: Actin, putative; n=1; Babesia bovis|Rep...   130   5e-29
UniRef50_A4RW28 Cluster: Predicted protein; n=2; Ostreococcus|Re...   129   7e-29
UniRef50_Q54JL1 Cluster: Putative uncharacterized protein; n=1; ...   129   9e-29
UniRef50_A2EUM6 Cluster: Actin family protein; n=1; Trichomonas ...   129   9e-29
UniRef50_A3BPG0 Cluster: Putative uncharacterized protein; n=3; ...   128   1e-28
UniRef50_Q9N4N4 Cluster: Putative uncharacterized protein; n=2; ...   128   2e-28
UniRef50_UPI000059FC57 Cluster: PREDICTED: similar to cytoplasmi...   126   5e-28
UniRef50_Q9SRK2 Cluster: Putative actin; n=1; Arabidopsis thalia...   126   5e-28
UniRef50_A7QKV4 Cluster: Chromosome chr8 scaffold_115, whole gen...   125   1e-27
UniRef50_Q8LKR0 Cluster: Actin-related protein 6; n=26; Magnolio...   124   2e-27
UniRef50_Q9Y7X8 Cluster: Actin-like protein Arp5; n=1; Schizosac...   119   1e-25
UniRef50_Q2H0E9 Cluster: Putative uncharacterized protein; n=1; ...   117   3e-25
UniRef50_Q22WQ4 Cluster: Actin family protein; n=1; Tetrahymena ...   113   4e-25
UniRef50_Q7M3B0 Cluster: Actin beta; n=1; Sus scrofa domestica|R...   116   7e-25
UniRef50_Q6C061 Cluster: Actin-related protein 4; n=1; Yarrowia ...   116   9e-25
UniRef50_UPI0000E466A7 Cluster: PREDICTED: similar to actin, alp...   114   3e-24
UniRef50_Q9DFB8 Cluster: Actin; n=1; Scomberomorus maculatus|Rep...   113   5e-24
UniRef50_Q5CKL2 Cluster: BRG1/brm-associated factor 53A; n=2; Cr...   113   6e-24
UniRef50_Q9P7X7 Cluster: Actin-related protein 4; n=1; Schizosac...   113   6e-24
UniRef50_Q9LHH0 Cluster: Actin-like protein; n=11; Magnoliophyta...   111   3e-23
UniRef50_Q8MVN5 Cluster: Cardiac actin-like protein; n=1; Bolten...   111   3e-23
UniRef50_UPI0000F2D271 Cluster: PREDICTED: similar to actin-like...   108   1e-22
UniRef50_Q18PR4 Cluster: Actin-related protein; n=1; Porphyra ye...   108   2e-22
UniRef50_A7RPC3 Cluster: Predicted protein; n=3; Eumetazoa|Rep: ...   107   3e-22
UniRef50_Q4WA13 Cluster: Chromatin remodeling complex subunit (A...   106   5e-22
UniRef50_UPI0000D56C2F Cluster: PREDICTED: similar to Actin-57B;...   105   1e-21
UniRef50_Q7S6X6 Cluster: Actin-like protein arp-6; n=5; Pezizomy...   105   2e-21
UniRef50_UPI0000DD7E8B Cluster: PREDICTED: similar to ARP3 actin...   104   2e-21
UniRef50_A5B4L4 Cluster: Putative uncharacterized protein; n=1; ...   103   5e-21
UniRef50_Q3M0X0 Cluster: Actin6-2; n=3; Paramecium tetraurelia|R...   103   5e-21
UniRef50_Q09849 Cluster: Uncharacterized protein C23D3.09; n=1; ...   103   7e-21
UniRef50_UPI00006C1719 Cluster: PREDICTED: similar to actin, alp...   101   2e-20
UniRef50_UPI0000498A93 Cluster: actin; n=1; Entamoeba histolytic...   101   2e-20
UniRef50_UPI0000E4A0BF Cluster: PREDICTED: similar to Actin-rela...   100   4e-20
UniRef50_Q23FF9 Cluster: Actin family protein; n=2; Tetrahymena ...   100   4e-20
UniRef50_Q6CF37 Cluster: Similar to sp|P53946 Saccharomyces cere...    99   6e-20
UniRef50_Q17GZ9 Cluster: Actin-related protein 5; n=4; Endoptery...    99   1e-19
UniRef50_Q4QF49 Cluster: Actin-like protein, putative; n=2; Leis...    98   2e-19
UniRef50_UPI0000498FDF Cluster: actin; n=1; Entamoeba histolytic...    97   4e-19
UniRef50_Q5C683 Cluster: SJCHGC08418 protein; n=1; Schistosoma j...    97   6e-19
UniRef50_P53946 Cluster: Actin-related protein 5; n=7; Saccharom...    95   1e-18
UniRef50_A7QZ13 Cluster: Chromosome undetermined scaffold_261, w...    95   2e-18
UniRef50_Q6C982 Cluster: Actin-like protein ARP6; n=1; Yarrowia ...    95   2e-18
UniRef50_Q5KAQ4 Cluster: Actin-like protein ARP6; n=1; Filobasid...    95   2e-18
UniRef50_P45890 Cluster: Actin-like protein 13E; n=8; Eumetazoa|...    94   4e-18
UniRef50_Q54E71 Cluster: Putative uncharacterized protein; n=1; ...    93   5e-18
UniRef50_Q6BIA3 Cluster: CA5059|IPF3691 Candida albicans IPF3691...    93   5e-18
UniRef50_UPI0000E46266 Cluster: PREDICTED: similar to actin; n=1...    93   7e-18
UniRef50_Q19R52 Cluster: ALP5; n=6; Trypanosomatidae|Rep: ALP5 -...    93   1e-17
UniRef50_A3M088 Cluster: Vacuolar targeting, actin-related prote...    93   1e-17
UniRef50_P80428 Cluster: Actin-related protein 4; n=4; Saccharom...    93   1e-17
UniRef50_Q6CSB9 Cluster: Actin-related protein 4; n=1; Kluyverom...    93   1e-17
UniRef50_Q5KLG9 Cluster: 53 kDa brg1-associated factor b (Actin-...    91   2e-17
UniRef50_Q9LZY1 Cluster: Actin-like protein; n=4; core eudicotyl...    91   3e-17
UniRef50_Q7QA11 Cluster: ENSANGP00000003921; n=1; Anopheles gamb...    91   3e-17
UniRef50_Q22XS7 Cluster: Actin family protein; n=1; Tetrahymena ...    90   7e-17
UniRef50_Q0IFH2 Cluster: Actin; n=4; Endopterygota|Rep: Actin - ...    89   1e-16
UniRef50_Q0V0G6 Cluster: Putative uncharacterized protein; n=1; ...    88   2e-16
UniRef50_Q6C0A9 Cluster: Yarrowia lipolytica chromosome F of str...    87   5e-16
UniRef50_Q9VEC3 Cluster: Actin-related protein 5; n=1; Drosophil...    87   5e-16
UniRef50_Q7SXV8 Cluster: ARP5 actin-related protein 5 homolog; n...    87   6e-16
UniRef50_Q9GZN1 Cluster: Actin-related protein 6; n=26; Chordata...    86   8e-16
UniRef50_Q5C3R3 Cluster: SJCHGC08022 protein; n=1; Schistosoma j...    85   3e-15
UniRef50_A1C924 Cluster: Actin family protein; n=4; Eurotiomycet...    84   3e-15
UniRef50_Q293V2 Cluster: Actin-related protein 5; n=2; Drosophil...    84   4e-15
UniRef50_Q4P303 Cluster: Putative uncharacterized protein; n=1; ...    83   6e-15
UniRef50_Q9H9F9 Cluster: Actin-related protein 5; n=19; Euteleos...    83   1e-14
UniRef50_Q6BXN0 Cluster: Actin-related protein 4; n=7; Saccharom...    82   1e-14
UniRef50_A7TST0 Cluster: Putative uncharacterized protein; n=1; ...    82   2e-14
UniRef50_Q09443 Cluster: Actin-like protein C08B11.6; n=2; Caeno...    82   2e-14
UniRef50_Q6SQL6 Cluster: Actin; n=1; Pandalus platyceros|Rep: Ac...    81   2e-14
UniRef50_A6R1X8 Cluster: Putative uncharacterized protein; n=1; ...    81   3e-14
UniRef50_Q12406 Cluster: Actin-related protein 7; n=2; Saccharom...    81   3e-14
UniRef50_A6RD01 Cluster: Putative uncharacterized protein; n=1; ...    81   4e-14
UniRef50_UPI0000E477BD Cluster: PREDICTED: similar to uncharacte...    80   5e-14
UniRef50_Q5K9I3 Cluster: Protein-vacuolar targeting-related prot...    80   5e-14
UniRef50_Q4P2E8 Cluster: Actin-related protein 4; n=1; Ustilago ...    80   5e-14
UniRef50_A7RTR6 Cluster: Predicted protein; n=1; Nematostella ve...    79   9e-14
UniRef50_A4S172 Cluster: Predicted protein; n=3; Ostreococcus|Re...    79   1e-13
UniRef50_A5K109 Cluster: Actin, putative; n=4; Plasmodium|Rep: A...    79   1e-13
UniRef50_Q5AXH1 Cluster: Actin-like protein arp6; n=5; Trichocom...    79   1e-13
UniRef50_UPI0000EBF019 Cluster: PREDICTED: similar to ribosomal ...    78   2e-13
UniRef50_Q8ILM5 Cluster: Actin, putative; n=1; Plasmodium falcip...    77   4e-13
UniRef50_UPI00006CBDF1 Cluster: Actin family protein; n=1; Tetra...    75   2e-12
UniRef50_O94241 Cluster: Actin-like protein arp6; n=1; Schizosac...    75   2e-12
UniRef50_Q4QD95 Cluster: Actin-related protein 2, putative; n=3;...    75   2e-12
UniRef50_Q19R70 Cluster: Actin-like protein 3; n=4; Leishmania|R...    72   3e-12
UniRef50_A7TM96 Cluster: Putative uncharacterized protein; n=1; ...    75   3e-12
UniRef50_Q9NZ32 Cluster: Actin-related protein 10; n=40; Eumetaz...    75   3e-12
UniRef50_Q6BML9 Cluster: Actin-like protein ARP6; n=3; Saccharom...    74   5e-12
UniRef50_Q9FKT0 Cluster: Actin-related protein 8; n=23; Magnolio...    72   2e-11
UniRef50_Q75BT7 Cluster: ACR184Cp; n=1; Eremothecium gossypii|Re...    71   3e-11
UniRef50_Q5BXM4 Cluster: SJCHGC05761 protein; n=1; Schistosoma j...    70   8e-11
UniRef50_Q7QTA6 Cluster: GLP_15_20269_21672; n=1; Giardia lambli...    69   1e-10
UniRef50_Q9UTQ7 Cluster: SWI/SNF and RSC complex subunit Arp9; n...    69   1e-10
UniRef50_Q54KZ7 Cluster: Putative uncharacterized protein; n=1; ...    69   2e-10
UniRef50_Q4YVG6 Cluster: Actin, putative; n=7; Plasmodium|Rep: A...    69   2e-10
UniRef50_Q7T3J8 Cluster: Beta actin; n=2; Oncorhynchus|Rep: Beta...    68   2e-10
UniRef50_A7AWQ4 Cluster: Actin, putative; n=1; Babesia bovis|Rep...    68   2e-10
UniRef50_Q6FMT7 Cluster: Similar to sp|Q12406 Saccharomyces cere...    68   2e-10
UniRef50_Q5JWF8 Cluster: Putative uncharacterized protein C20orf...    68   3e-10
UniRef50_Q20329 Cluster: Putative uncharacterized protein; n=2; ...    67   5e-10
UniRef50_Q4P4D4 Cluster: Putative uncharacterized protein; n=1; ...    67   5e-10
UniRef50_Q54JY2 Cluster: Putative uncharacterized protein; n=1; ...    66   7e-10
UniRef50_Q4P230 Cluster: Putative uncharacterized protein; n=1; ...    66   7e-10
UniRef50_A5E5Q2 Cluster: Putative uncharacterized protein; n=1; ...    66   9e-10
UniRef50_Q7SHR0 Cluster: Actin-related protein 4; n=16; Pezizomy...    66   1e-09
UniRef50_Q0J891 Cluster: Os08g0128300 protein; n=5; Oryza sativa...    64   3e-09
UniRef50_Q5CWA5 Cluster: Actin; n=2; Cryptosporidium|Rep: Actin ...    64   3e-09
UniRef50_UPI00006CC3F4 Cluster: Actin family protein; n=1; Tetra...    64   5e-09
UniRef50_Q4UIK3 Cluster: Actin, putative; n=2; Theileria|Rep: Ac...    64   5e-09
UniRef50_A2D880 Cluster: Actin family protein; n=1; Trichomonas ...    63   7e-09
UniRef50_A4RLB1 Cluster: Putative uncharacterized protein; n=1; ...    63   7e-09
UniRef50_Q3M0W2 Cluster: Actin 4-2; n=3; Paramecium tetraurelia|...    62   1e-08
UniRef50_A3FQE6 Cluster: Putative uncharacterized protein; n=2; ...    62   2e-08
UniRef50_A3FQH9 Cluster: Actin-like protein, putative; n=2; Cryp...    61   4e-08
UniRef50_A0D9D5 Cluster: Chromosome undetermined scaffold_42, wh...    61   4e-08
UniRef50_A1CCH7 Cluster: Chromatin remodeling complex subunit (A...    60   6e-08
UniRef50_UPI00015B5EE4 Cluster: PREDICTED: similar to Actin-rela...    60   8e-08
UniRef50_UPI0000D55EE2 Cluster: PREDICTED: similar to actin-rela...    59   1e-07
UniRef50_A6RD74 Cluster: Putative uncharacterized protein; n=1; ...    59   1e-07
UniRef50_Q4UF64 Cluster: Actin-related protein, putative; n=2; T...    58   2e-07
UniRef50_Q3M0Y1 Cluster: Actin7-2; n=2; Paramecium tetraurelia|R...    58   3e-07
UniRef50_A7AQU0 Cluster: Actin-related, putative; n=1; Babesia b...    57   4e-07
UniRef50_Q5CS19 Cluster: Actin-like protein; n=2; Cryptosporidiu...    56   1e-06
UniRef50_A2DKB8 Cluster: Actin family protein; n=1; Trichomonas ...    56   1e-06
UniRef50_A2G7Z1 Cluster: Actin family protein; n=1; Trichomonas ...    55   2e-06
UniRef50_A0BG81 Cluster: Chromosome undetermined scaffold_105, w...    55   2e-06
UniRef50_A2E0F7 Cluster: Actin family protein; n=1; Trichomonas ...    55   2e-06
UniRef50_Q6CJF4 Cluster: Actin-like protein ARP6; n=2; Saccharom...    54   3e-06
UniRef50_Q4DEE4 Cluster: Actin-like protein, putative; n=4; Tryp...    54   5e-06
UniRef50_Q5KH55 Cluster: Putative uncharacterized protein; n=2; ...    54   5e-06
UniRef50_UPI0000E80C06 Cluster: PREDICTED: hypothetical protein;...    53   7e-06
UniRef50_Q3M0X1 Cluster: Actin-like protein 1-1; n=3; Paramecium...    53   9e-06
UniRef50_Q00UL2 Cluster: Alpha amylase 1; n=3; Ostreococcus|Rep:...    52   2e-05
UniRef50_A2DVJ3 Cluster: Actin family protein; n=1; Trichomonas ...    51   3e-05
UniRef50_Q10CH7 Cluster: Actin-related protein 7, putative, expr...    51   4e-05
UniRef50_Q0UJ41 Cluster: Putative uncharacterized protein; n=1; ...    50   7e-05
UniRef50_A7EG89 Cluster: Putative uncharacterized protein; n=2; ...    50   9e-05
UniRef50_Q38C43 Cluster: Actin-like protein, putative; n=4; Tryp...    40   1e-04
UniRef50_A7AQB8 Cluster: Actin-related protein, putative; n=1; B...    48   3e-04
UniRef50_A4RYY1 Cluster: Predicted protein; n=2; Ostreococcus|Re...    48   4e-04
UniRef50_UPI0000499D03 Cluster: actin; n=1; Entamoeba histolytic...    47   5e-04
UniRef50_Q29173 Cluster: Cytoplasmic beta-actin; n=1; Sus scrofa...    47   5e-04
UniRef50_Q6CPA7 Cluster: Kluyveromyces lactis strain NRRL Y-1140...    47   5e-04
UniRef50_Q0IEG8 Cluster: Actin-related protein 8; n=5; Endoptery...    47   5e-04
UniRef50_Q2IL23 Cluster: Putative uncharacterized protein; n=1; ...    46   8e-04
UniRef50_A7DLY9 Cluster: Putative uncharacterized protein precur...    45   0.002
UniRef50_Q8GFF2 Cluster: Putative uncharacterized protein; n=1; ...    45   0.002
UniRef50_Q5TQV1 Cluster: ENSANGP00000028454; n=1; Anopheles gamb...    45   0.002
UniRef50_Q5AP59 Cluster: Actin-like protein ARP6; n=2; Saccharom...    45   0.002
UniRef50_A5CAW6 Cluster: Putative uncharacterized protein; n=1; ...    44   0.004
UniRef50_Q8IBQ9 Cluster: Putative uncharacterized protein PF07_0...    44   0.004
UniRef50_Q54JV5 Cluster: Putative uncharacterized protein; n=1; ...    44   0.004
UniRef50_A5KC80 Cluster: Putative uncharacterized protein; n=1; ...    44   0.004
UniRef50_A4S826 Cluster: Predicted protein; n=1; Ostreococcus lu...    44   0.006
UniRef50_A7RTR2 Cluster: Predicted protein; n=1; Nematostella ve...    44   0.006
UniRef50_Q0J6K8 Cluster: Os08g0300300 protein; n=1; Oryza sativa...    43   0.008
UniRef50_A3LE40 Cluster: Glycerol kinase; n=1; Pseudomonas aerug...    43   0.010
UniRef50_Q7RLT3 Cluster: Unnamed protein product; n=2; Plasmodiu...    43   0.010
UniRef50_Q02817 Cluster: Mucin-2 precursor; n=56; cellular organ...    43   0.010
UniRef50_Q5KBY2 Cluster: RNA polymerase II transcription factor,...    42   0.013
UniRef50_UPI00006CDDA1 Cluster: hypothetical protein TTHERM_0029...    42   0.018
UniRef50_UPI000023E43C Cluster: hypothetical protein FG04385.1; ...    42   0.018
UniRef50_Q8SRZ3 Cluster: ACTIN-RELATED PROTEIN; n=1; Encephalito...    42   0.018
UniRef50_Q2H309 Cluster: Putative uncharacterized protein; n=1; ...    42   0.018
UniRef50_Q12509 Cluster: Actin-like protein ARP6; n=4; Saccharom...    42   0.018
UniRef50_Q7M3Y5 Cluster: Actin; n=1; Aplysia californica|Rep: Ac...    42   0.023
UniRef50_A0BR70 Cluster: Chromosome undetermined scaffold_122, w...    42   0.023
UniRef50_O94873 Cluster: TBK1-binding protein 1; n=20; Amniota|R...    42   0.023
UniRef50_UPI0000498B53 Cluster: actin; n=1; Entamoeba histolytic...    41   0.041
UniRef50_UPI0000DA2CC2 Cluster: PREDICTED: hypothetical protein;...    40   0.094
UniRef50_Q5LKH0 Cluster: Putative uncharacterized protein; n=1; ...    40   0.094
UniRef50_Q5CSJ5 Cluster: ARP3 actin related protein; n=2; Crypto...    40   0.094
UniRef50_Q4JK70 Cluster: Group 15 allergen protein; n=3; Dermato...    40   0.094
UniRef50_Q0H7S7 Cluster: Actin; n=29; Sordariomycetes|Rep: Actin...    40   0.094
UniRef50_A4EAZ9 Cluster: Putative uncharacterized protein; n=3; ...    39   0.12 
UniRef50_Q9VR49 Cluster: CG3047-PA; n=3; Drosophila melanogaster...    39   0.12 
UniRef50_Q61Q33 Cluster: Putative uncharacterized protein CBG072...    39   0.12 
UniRef50_Q4Q2G7 Cluster: Actin-like protein, putative; n=3; Leis...    39   0.12 
UniRef50_P59797 Cluster: Selenoprotein V; n=6; Eutheria|Rep: Sel...    39   0.12 
UniRef50_A0VF81 Cluster: Putative uncharacterized protein; n=4; ...    39   0.16 
UniRef50_Q4UGE2 Cluster: Actin-related protein, putative; n=2; T...    39   0.16 
UniRef50_UPI0000F30951 Cluster: UPI0000F30951 related cluster; n...    38   0.22 
UniRef50_Q98274 Cluster: MC107L; n=1; Molluscum contagiosum viru...    38   0.22 
UniRef50_Q3W4Q6 Cluster: Similar to Uncharacterized protein cons...    38   0.22 
UniRef50_Q6YWA5 Cluster: Putative uncharacterized protein P0501E...    38   0.22 
UniRef50_Q0IRQ7 Cluster: Os11g0605900 protein; n=1; Oryza sativa...    38   0.22 
UniRef50_Q0V4N1 Cluster: Predicted protein; n=1; Phaeosphaeria n...    38   0.22 
UniRef50_Q3JP14 Cluster: Putative uncharacterized protein; n=9; ...    38   0.29 
UniRef50_A4XC59 Cluster: NLP/P60 protein precursor; n=2; Salinis...    38   0.29 
UniRef50_Q0DW21 Cluster: Os03g0101400 protein; n=1; Oryza sativa...    38   0.29 
UniRef50_Q8IHC1 Cluster: AT15066p; n=7; Sophophora|Rep: AT15066p...    38   0.29 
UniRef50_Q4E633 Cluster: Actin-like protein, putative; n=4; Tryp...    38   0.29 
UniRef50_A2EKB2 Cluster: Serine/threonine-protein kinase C, puta...    38   0.29 
UniRef50_Q8SS30 Cluster: ACTIN-LIKE 53kDa PROTEIN; n=1; Encephal...    38   0.29 
UniRef50_A4WK20 Cluster: Metallophosphoesterase precursor; n=4; ...    38   0.29 
UniRef50_P10637 Cluster: Microtubule-associated protein tau; n=2...    38   0.29 
UniRef50_Q83NJ5 Cluster: Putative integral membrane protein; n=2...    38   0.38 
UniRef50_Q3JQG4 Cluster: Putative uncharacterized protein; n=1; ...    38   0.38 
UniRef50_A5P0Z0 Cluster: Xylose isomerase domain protein TIM bar...    38   0.38 
UniRef50_A0U399 Cluster: Putative uncharacterized protein; n=1; ...    38   0.38 
UniRef50_Q55GF8 Cluster: Putative uncharacterized protein; n=1; ...    38   0.38 
UniRef50_Q9US07 Cluster: Probable actin-related protein 8; n=1; ...    38   0.38 
UniRef50_Q6A866 Cluster: Putative uncharacterized protein; n=1; ...    37   0.50 
UniRef50_Q08TA4 Cluster: Fibrillar collagen chain FAp1 alpha; n=...    37   0.50 
UniRef50_A6W7I0 Cluster: Putative uncharacterized protein; n=1; ...    37   0.50 
UniRef50_A1GDI9 Cluster: Putative uncharacterized protein; n=1; ...    37   0.50 
UniRef50_A0VE96 Cluster: Putative uncharacterized protein; n=1; ...    37   0.50 
UniRef50_A0QRP2 Cluster: Putative uncharacterized protein; n=1; ...    37   0.50 
UniRef50_Q7PZX4 Cluster: ENSANGP00000014145; n=1; Anopheles gamb...    37   0.50 
UniRef50_Q4UGT7 Cluster: Actin-related protein, putative; n=2; T...    37   0.50 
UniRef50_A7SX06 Cluster: Predicted protein; n=1; Nematostella ve...    37   0.50 
UniRef50_A2G2R2 Cluster: Putative uncharacterized protein; n=1; ...    37   0.50 
UniRef50_Q9H7N4 Cluster: Splicing factor, arginine/serine-rich 1...    37   0.50 
UniRef50_UPI000155C786 Cluster: PREDICTED: similar to LNXp80; n=...    37   0.66 
UniRef50_Q6NE59 Cluster: MamK protein; n=3; Magnetospirillum|Rep...    37   0.66 
UniRef50_A5NU64 Cluster: LigA precursor; n=1; Methylobacterium s...    37   0.66 
UniRef50_Q9LT74 Cluster: Similarity to late embryogenesis abunda...    37   0.66 
UniRef50_Q55F22 Cluster: Putative uncharacterized protein; n=4; ...    37   0.66 
UniRef50_Q4V615 Cluster: IP07937p; n=1; Drosophila melanogaster|...    37   0.66 
UniRef50_Q19R66 Cluster: ALP6; n=4; Leishmania|Rep: ALP6 - Leish...    37   0.66 
UniRef50_Q5A0C8 Cluster: Putative uncharacterized protein; n=1; ...    37   0.66 
UniRef50_A7ERX5 Cluster: Predicted protein; n=1; Sclerotinia scl...    37   0.66 
UniRef50_P29191 Cluster: Protein A5; n=30; Orthopoxvirus|Rep: Pr...    37   0.66 
UniRef50_Q4SZA4 Cluster: Chromosome undetermined SCAF11741, whol...    36   0.88 
UniRef50_Q825Z2 Cluster: Putative proline-rich protein; n=2; Str...    36   0.88 
UniRef50_Q3JV80 Cluster: Putative uncharacterized protein; n=1; ...    36   0.88 
UniRef50_A3RT84 Cluster: Transcriptional regulator, TetR family;...    36   0.88 
UniRef50_Q0DBZ5 Cluster: Os06g0504100 protein; n=3; Oryza sativa...    36   0.88 
UniRef50_Q54D31 Cluster: Putative uncharacterized protein; n=1; ...    36   0.88 
UniRef50_A7LPD3 Cluster: Putative uncharacterized protein; n=4; ...    36   0.88 
UniRef50_Q6QXJ8 Cluster: ORF55; n=1; Agrotis segetum granuloviru...    36   1.2  
UniRef50_Q30BN4 Cluster: Putative uncharacterized protein; n=1; ...    36   1.2  
UniRef50_A7IVQ2 Cluster: Putative uncharacterized protein B027L;...    36   1.2  
UniRef50_Q9FC63 Cluster: Putative acyltransferase; n=1; Streptom...    36   1.2  
UniRef50_Q1IQY9 Cluster: Putative uncharacterized protein precur...    36   1.2  
UniRef50_A7HI44 Cluster: LigA; n=1; Anaeromyxobacter sp. Fw109-5...    36   1.2  
UniRef50_A0TRJ4 Cluster: Putative uncharacterized protein; n=2; ...    36   1.2  
UniRef50_Q54U48 Cluster: Putative uncharacterized protein; n=1; ...    36   1.2  
UniRef50_Q29GH8 Cluster: GA13417-PA; n=5; Endopterygota|Rep: GA1...    36   1.2  
UniRef50_Q754D5 Cluster: AFR135Wp; n=2; Saccharomycetaceae|Rep: ...    36   1.2  
UniRef50_Q750V5 Cluster: AGL166Wp; n=1; Eremothecium gossypii|Re...    36   1.2  
UniRef50_O10341 Cluster: Uncharacterized 29.3 kDa protein; n=7; ...    36   1.2  
UniRef50_P60372 Cluster: Keratin-associated protein 10-4; n=18; ...    36   1.2  
UniRef50_Q9BRD0 Cluster: BUD13 homolog; n=14; Mammalia|Rep: BUD1...    36   1.2  
UniRef50_Q3J2R6 Cluster: Putative uncharacterized protein; n=1; ...    36   1.5  
UniRef50_Q0SFR9 Cluster: Possible esterase; n=1; Rhodococcus sp....    36   1.5  
UniRef50_P72068 Cluster: Putative uncharacterized protein; n=1; ...    36   1.5  
UniRef50_A7CXR3 Cluster: ABC transporter related; n=1; Opitutace...    36   1.5  
UniRef50_A0UN46 Cluster: Putative uncharacterized protein; n=1; ...    36   1.5  
UniRef50_A4S6G3 Cluster: Predicted protein; n=2; Eukaryota|Rep: ...    36   1.5  
UniRef50_A3BCX8 Cluster: Putative uncharacterized protein; n=5; ...    36   1.5  
UniRef50_A2DC70 Cluster: Putative uncharacterized protein; n=1; ...    36   1.5  
UniRef50_Q7S8X5 Cluster: Putative uncharacterized protein NCU088...    36   1.5  
UniRef50_Q6CA98 Cluster: Similar to sp|Q12386 Saccharomyces cere...    36   1.5  
UniRef50_Q2HCT3 Cluster: Putative uncharacterized protein; n=1; ...    36   1.5  
UniRef50_Q2H4U8 Cluster: Putative uncharacterized protein; n=1; ...    36   1.5  
UniRef50_Q99109 Cluster: Repellent protein 1 precursor [Contains...    36   1.5  
UniRef50_Q9FPQ6 Cluster: Vegetative cell wall protein gp1 precur...    36   1.5  
UniRef50_P14918 Cluster: Extensin precursor; n=15; Eukaryota|Rep...    36   1.5  
UniRef50_A4FTD5 Cluster: Putative uncharacterized protein; n=1; ...    35   2.0  
UniRef50_Q3JV89 Cluster: Putative uncharacterized protein; n=6; ...    35   2.0  
UniRef50_Q2J6K8 Cluster: Putative uncharacterized protein; n=1; ...    35   2.0  
UniRef50_Q3WG61 Cluster: Erythronolide synthase; n=1; Frankia sp...    35   2.0  
UniRef50_A0TBD3 Cluster: Putative uncharacterized protein; n=5; ...    35   2.0  
UniRef50_A0LTI3 Cluster: Glycoside hydrolase, family 9; n=1; Aci...    35   2.0  
UniRef50_Q9LSW2 Cluster: Actin-like protein; n=4; Magnoliophyta|...    35   2.0  
UniRef50_Q00ZS2 Cluster: 3'(2'), 5'-BISPHOSPHATE NUCLEOTIDASE-li...    35   2.0  
UniRef50_A7R0I2 Cluster: Chromosome undetermined scaffold_309, w...    35   2.0  
UniRef50_A3BLQ9 Cluster: Putative uncharacterized protein; n=1; ...    35   2.0  
UniRef50_Q9VZ49 Cluster: CG2145-PA; n=4; Diptera|Rep: CG2145-PA ...    35   2.0  
UniRef50_Q54MZ1 Cluster: Putative uncharacterized protein; n=1; ...    35   2.0  
UniRef50_Q9NRR4 Cluster: Ribonuclease 3; n=59; Eumetazoa|Rep: Ri...    35   2.0  
UniRef50_P40602 Cluster: Anter-specific proline-rich protein APG...    35   2.0  
UniRef50_Q82RN1 Cluster: Putative uncharacterized protein; n=1; ...    35   2.7  
UniRef50_Q5F4W8 Cluster: Putative uncharacterized protein; n=1; ...    35   2.7  
UniRef50_Q3JVM0 Cluster: Putative uncharacterized protein; n=2; ...    35   2.7  
UniRef50_Q3JKV8 Cluster: Putative uncharacterized protein; n=3; ...    35   2.7  
UniRef50_Q095J6 Cluster: Putative uncharacterized protein; n=1; ...    35   2.7  
UniRef50_Q092V7 Cluster: Putative uncharacterized protein; n=1; ...    35   2.7  
UniRef50_A7KGZ6 Cluster: NapR1; n=1; Streptomyces aculeolatus|Re...    35   2.7  
UniRef50_A5V089 Cluster: Extracellular solute-binding protein, f...    35   2.7  
UniRef50_A5NZ34 Cluster: LigA; n=1; Methylobacterium sp. 4-46|Re...    35   2.7  
UniRef50_A5CQA6 Cluster: Putative uncharacterized protein; n=1; ...    35   2.7  
UniRef50_A4XBY0 Cluster: Putative uncharacterized protein; n=1; ...    35   2.7  
UniRef50_A4T5H7 Cluster: Putative uncharacterized protein; n=1; ...    35   2.7  
UniRef50_A0TYA6 Cluster: Putative uncharacterized protein precur...    35   2.7  
UniRef50_Q9C684 Cluster: Proline-rich protein, putative; n=1; Ar...    35   2.7  
UniRef50_Q41805 Cluster: Extensin-like protein precursor; n=15; ...    35   2.7  
UniRef50_Q0J6H5 Cluster: Os08g0320200 protein; n=2; Liliopsida|R...    35   2.7  
UniRef50_Q0IZF3 Cluster: Os09g0572500 protein; n=2; Oryza sativa...    35   2.7  
UniRef50_A7R0E9 Cluster: Chromosome undetermined scaffold_306, w...    35   2.7  
UniRef50_A7QNX2 Cluster: Chromosome chr1 scaffold_135, whole gen...    35   2.7  
UniRef50_A2ZU80 Cluster: Putative uncharacterized protein; n=2; ...    35   2.7  
UniRef50_Q8I450 Cluster: Actin-related protein, putative; n=5; P...    35   2.7  
UniRef50_Q54Y16 Cluster: Putative uncharacterized protein; n=1; ...    35   2.7  
UniRef50_Q5B5Q9 Cluster: Putative uncharacterized protein; n=1; ...    35   2.7  
UniRef50_Q4WD71 Cluster: MFS allantoate transporter, putative; n...    35   2.7  
UniRef50_Q4P820 Cluster: Putative uncharacterized protein; n=1; ...    35   2.7  
UniRef50_O28258 Cluster: Rod shape-determining protein; n=1; Arc...    35   2.7  
UniRef50_Q9C5S0 Cluster: Classical arabinogalactan protein 9 pre...    35   2.7  
UniRef50_UPI000038254E Cluster: COG1876: D-alanyl-D-alanine carb...    34   3.5  
UniRef50_UPI0000EB024C Cluster: UPI0000EB024C related cluster; n...    34   3.5  
UniRef50_Q4TAS2 Cluster: Chromosome undetermined SCAF7262, whole...    34   3.5  
UniRef50_Q4T9M1 Cluster: Chromosome undetermined SCAF7535, whole...    34   3.5  
UniRef50_Q4RNW9 Cluster: Chromosome 10 SCAF15009, whole genome s...    34   3.5  
UniRef50_Q9AAN3 Cluster: Putative uncharacterized protein; n=1; ...    34   3.5  
UniRef50_Q6MDK9 Cluster: Putative 60 kDa cysteine-rich outer mem...    34   3.5  
UniRef50_Q62EW6 Cluster: DNA-binding response regulator, LuxR fa...    34   3.5  
UniRef50_Q603P4 Cluster: Putative uncharacterized protein; n=1; ...    34   3.5  
UniRef50_Q5P371 Cluster: Sensory box histidine kinase/response r...    34   3.5  
UniRef50_Q3JSB3 Cluster: Putative uncharacterized protein; n=2; ...    34   3.5  
UniRef50_Q1YN48 Cluster: Regulatory protein soxS; n=2; Alphaprot...    34   3.5  
UniRef50_Q0YKA3 Cluster: Putative uncharacterized protein precur...    34   3.5  
UniRef50_A6W5H3 Cluster: Metal dependent phosphohydrolase; n=1; ...    34   3.5  
UniRef50_A5V3Z1 Cluster: Peptidase M23B precursor; n=1; Sphingom...    34   3.5  
UniRef50_A5USV4 Cluster: Putative uncharacterized protein; n=2; ...    34   3.5  
UniRef50_A4T977 Cluster: Putative uncharacterized protein; n=1; ...    34   3.5  
UniRef50_A2VSW6 Cluster: Outer membrane autotransporter barrel; ...    34   3.5  
UniRef50_A0TAE1 Cluster: Putative uncharacterized protein precur...    34   3.5  
UniRef50_A0LSH8 Cluster: Glycoside hydrolase, family 6 precursor...    34   3.5  
UniRef50_A0GTK0 Cluster: Putative uncharacterized protein precur...    34   3.5  
UniRef50_A0GJL5 Cluster: Putative uncharacterized protein precur...    34   3.5  
UniRef50_Q6V5D4 Cluster: Pollen coat oleosin-glycine rich protei...    34   3.5  
UniRef50_Q6I549 Cluster: Putative uncharacterized protein OSJNBa...    34   3.5  
UniRef50_Q5JJM4 Cluster: Peptidylprolyl cis-trans isomerase-like...    34   3.5  
UniRef50_A7NX50 Cluster: Chromosome chr5 scaffold_2, whole genom...    34   3.5  
UniRef50_Q7RR61 Cluster: Actin-like 6; n=3; Plasmodium (Vinckeia...    34   3.5  
UniRef50_Q55GD8 Cluster: Putative uncharacterized protein; n=1; ...    34   3.5  
UniRef50_Q4UAS1 Cluster: Theileria-specific sub-telomeric protei...    34   3.5  
UniRef50_Q17IC5 Cluster: Putative uncharacterized protein; n=3; ...    34   3.5  
UniRef50_A2DM41 Cluster: Putative uncharacterized protein; n=1; ...    34   3.5  
UniRef50_Q2KGX4 Cluster: Putative uncharacterized protein; n=1; ...    34   3.5  
UniRef50_A6QWU5 Cluster: Predicted protein; n=10; Pezizomycotina...    34   3.5  
UniRef50_A5E7E0 Cluster: Predicted protein; n=1; Lodderomyces el...    34   3.5  
UniRef50_P93329 Cluster: Early nodulin 20 precursor; n=2; Medica...    34   3.5  
UniRef50_Q7TQM5 Cluster: Keratinocyte proline-rich protein; n=4;...    34   3.5  
UniRef50_Q9ZT17 Cluster: Classical arabinogalactan protein 3 pre...    34   3.5  
UniRef50_UPI000155C72E Cluster: PREDICTED: similar to hCG1811042...    34   4.7  
UniRef50_UPI0000E48EFF Cluster: PREDICTED: hypothetical protein,...    34   4.7  
UniRef50_Q5NXI9 Cluster: Putative uncharacterized protein; n=1; ...    34   4.7  
UniRef50_Q1Q000 Cluster: Putative uncharacterized protein; n=3; ...    34   4.7  
UniRef50_Q0RHG8 Cluster: Putative serine/threonine protein kinas...    34   4.7  
UniRef50_A4X6R3 Cluster: Protein kinase; n=2; Salinispora|Rep: P...    34   4.7  
UniRef50_A0TYQ8 Cluster: Cobalamin (Vitamin B12) biosynthesis Cb...    34   4.7  
UniRef50_Q9SN46 Cluster: Extensin-like protein; n=4; Magnoliophy...    34   4.7  
UniRef50_Q9LJ64 Cluster: Extensin protein-like; n=8; Eukaryota|R...    34   4.7  
UniRef50_Q0ISC2 Cluster: Os11g0538400 protein; n=1; Oryza sativa...    34   4.7  
UniRef50_Q9VVG2 Cluster: CG13731-PA; n=1; Drosophila melanogaste...    34   4.7  
UniRef50_Q9N3I1 Cluster: Putative uncharacterized protein; n=1; ...    34   4.7  
UniRef50_Q95QF5 Cluster: Putative uncharacterized protein; n=3; ...    34   4.7  
UniRef50_Q61Q32 Cluster: Putative uncharacterized protein CBG072...    34   4.7  
UniRef50_Q61GF0 Cluster: Putative uncharacterized protein CBG112...    34   4.7  
UniRef50_Q5WNQ1 Cluster: Putative uncharacterized protein CBG079...    34   4.7  
UniRef50_Q54WQ8 Cluster: Putative uncharacterized protein; n=2; ...    34   4.7  
UniRef50_A0MQA5 Cluster: Aspartic protease 7; n=1; Toxoplasma go...    34   4.7  
UniRef50_Q2GQ27 Cluster: Putative uncharacterized protein; n=1; ...    34   4.7  
UniRef50_Q0C7P7 Cluster: Predicted protein; n=1; Aspergillus ter...    34   4.7  
UniRef50_A2QRU4 Cluster: Similarity to hypothetical protein EAA5...    34   4.7  
UniRef50_Q5NW24 Cluster: Alkaline serine protease; n=2; Archaea|...    34   4.7  
UniRef50_Q9M9X4 Cluster: Nuclear transcription factor Y subunit ...    34   4.7  
UniRef50_P08640 Cluster: Mucin-like protein 1 precursor; n=6; Sa...    34   4.7  
UniRef50_UPI00015B4CAB Cluster: PREDICTED: hypothetical protein;...    33   6.2  
UniRef50_UPI0001554838 Cluster: PREDICTED: similar to solute car...    33   6.2  
UniRef50_Q4SUJ7 Cluster: Chromosome undetermined SCAF13899, whol...    33   6.2  
UniRef50_Q73WE2 Cluster: Putative uncharacterized protein; n=1; ...    33   6.2  
UniRef50_Q51815 Cluster: Esterase D; n=1; Cellvibrio japonicus|R...    33   6.2  
UniRef50_Q0LE04 Cluster: PT repeat precursor; n=2; Herpetosiphon...    33   6.2  
UniRef50_Q08MP9 Cluster: Gspii_e N-terminal domain family; n=1; ...    33   6.2  
UniRef50_Q06WK5 Cluster: Dermatan-binding protein PA5541; n=4; P...    33   6.2  
UniRef50_A7HA47 Cluster: LigA; n=2; Proteobacteria|Rep: LigA - A...    33   6.2  
UniRef50_A6GHF8 Cluster: Putative uncharacterized protein; n=1; ...    33   6.2  
UniRef50_A5UTV9 Cluster: Protein kinase; n=2; Roseiflexus|Rep: P...    33   6.2  
UniRef50_A1TL16 Cluster: Putative uncharacterized protein; n=1; ...    33   6.2  
UniRef50_A0TR77 Cluster: Putative uncharacterized protein; n=1; ...    33   6.2  
UniRef50_A0LSH9 Cluster: Cellulose-binding, family II precursor;...    33   6.2  
UniRef50_Q94JZ6 Cluster: Protein kinase-like protein; n=12; Magn...    33   6.2  
UniRef50_Q8S9B6 Cluster: PR-1 like protein; n=1; Volvox carteri ...    33   6.2  
UniRef50_Q7XU10 Cluster: OSJNBa0091D06.5 protein; n=3; Oryza sat...    33   6.2  
UniRef50_Q6K296 Cluster: Putative uncharacterized protein B1080A...    33   6.2  
UniRef50_Q00X46 Cluster: Chromosome 13 contig 1, DNA sequence; n...    33   6.2  
UniRef50_Q7QJS8 Cluster: ENSANGP00000020719; n=1; Anopheles gamb...    33   6.2  
UniRef50_O77242 Cluster: Mucin-like protein; n=1; Heterodera gly...    33   6.2  
UniRef50_A7RY28 Cluster: Predicted protein; n=1; Nematostella ve...    33   6.2  
UniRef50_A5KAY0 Cluster: Actin-related protein, putative; n=1; P...    33   6.2  
UniRef50_A2FYS8 Cluster: Actin family protein; n=1; Trichomonas ...    33   6.2  
UniRef50_Q8WWQ4 Cluster: Mucin 5; n=5; Catarrhini|Rep: Mucin 5 -...    33   6.2  
UniRef50_Q4P0G7 Cluster: Putative uncharacterized protein; n=1; ...    33   6.2  
UniRef50_Q1ZZ39 Cluster: Activating transcription factor 2; n=3;...    33   6.2  
UniRef50_Q0V4Z4 Cluster: Predicted protein; n=1; Phaeosphaeria n...    33   6.2  
UniRef50_A4RKY6 Cluster: Putative uncharacterized protein; n=1; ...    33   6.2  
UniRef50_A4QTL3 Cluster: Putative uncharacterized protein; n=1; ...    33   6.2  
UniRef50_UPI0000E4955A Cluster: PREDICTED: hypothetical protein;...    33   8.2  
UniRef50_UPI0000E254E7 Cluster: PREDICTED: similar to putative c...    33   8.2  
UniRef50_UPI0000382FC2 Cluster: COG1530: Ribonucleases G and E; ...    33   8.2  
UniRef50_UPI000023D465 Cluster: hypothetical protein FG10402.1; ...    33   8.2  
UniRef50_Q62B57 Cluster: Putative uncharacterized protein; n=1; ...    33   8.2  
UniRef50_Q3JPQ2 Cluster: Putative uncharacterized protein; n=2; ...    33   8.2  
UniRef50_Q2LUJ1 Cluster: Hypothetical exported protein; n=1; Syn...    33   8.2  
UniRef50_Q2JMC8 Cluster: TonB family protein; n=2; Synechococcus...    33   8.2  
UniRef50_Q2JHT0 Cluster: Putative S-layer protein; n=2; Synechoc...    33   8.2  
UniRef50_Q2JGK6 Cluster: Secretion protein HlyD precursor; n=1; ...    33   8.2  
UniRef50_Q3WHX0 Cluster: Putative uncharacterized protein; n=1; ...    33   8.2  
UniRef50_Q3WGW2 Cluster: Cell divisionFtsK/SpoIIIE protein; n=1;...    33   8.2  
UniRef50_A7IGV4 Cluster: ABC transporter related; n=2; Proteobac...    33   8.2  
UniRef50_A7H9N7 Cluster: Heavy metal translocating P-type ATPase...    33   8.2  
UniRef50_A5TVB3 Cluster: AT family autotransporter; n=5; cellula...    33   8.2  
UniRef50_A1SGB7 Cluster: Glycosyl transferase, family 2 precurso...    33   8.2  
UniRef50_A0UM83 Cluster: LigA; n=1; Burkholderia multivorans ATC...    33   8.2  
UniRef50_A0UIE3 Cluster: Putative uncharacterized protein; n=1; ...    33   8.2  
UniRef50_A0U273 Cluster: Putative uncharacterized protein; n=3; ...    33   8.2  

>UniRef50_Q4JSC0 Cluster: Actin; n=13; Coelomata|Rep: Actin -
           Anopheles gambiae (African malaria mosquito)
          Length = 376

 Score =  474 bits (1169), Expect = e-132
 Identities = 220/236 (93%), Positives = 229/236 (97%)
 Frame = +1

Query: 76  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 255
           MCD++  ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMG KD+YVGDEAQ
Sbjct: 1   MCDDDAGALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGNKDAYVGDEAQ 60

Query: 256 SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKM 435
           SKRGILTLKYPIEHGI+TNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPK+NREKM
Sbjct: 61  SKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKSNREKM 120

Query: 436 TQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLD 615
           TQIMFETF  PA+YVAIQAVLSLYASGRTTG+VLDSGDGVSHTVPIYEGYALPHAILR+D
Sbjct: 121 TQIMFETFAAPAVYVAIQAVLSLYASGRTTGVVLDSGDGVSHTVPIYEGYALPHAILRMD 180

Query: 616 LAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSS 783
           LAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEM  AA+SSS
Sbjct: 181 LAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMQAAAASSS 236


>UniRef50_O65314 Cluster: Actin; n=20; Eukaryota|Rep: Actin -
           Scherffelia dubia
          Length = 378

 Score =  457 bits (1127), Expect = e-127
 Identities = 215/233 (92%), Positives = 224/233 (96%)
 Frame = +1

Query: 82  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 261
           D EV+ALV DNGSGM KAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKD+YVGDEAQSK
Sbjct: 5   DGEVSALVCDNGSGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDEAQSK 64

Query: 262 RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQ 441
           RGILTLKYPIEHG+V+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQ
Sbjct: 65  RGILTLKYPIEHGVVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQ 124

Query: 442 IMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLA 621
           IMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAI+RLDLA
Sbjct: 125 IMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAIMRLDLA 184

Query: 622 GRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSS 780
           GRDLTD LM IL ERGY+FTTTAEREIVRDIKEKLCYVALD+EQEMA + +SS
Sbjct: 185 GRDLTDNLMTILMERGYNFTTTAEREIVRDIKEKLCYVALDYEQEMANSLTSS 237


>UniRef50_Q96483 Cluster: Actin-51; n=584; Eukaryota|Rep: Actin-51 -
           Solanum lycopersicum (Tomato) (Lycopersicon esculentum)
          Length = 336

 Score =  431 bits (1061), Expect = e-119
 Identities = 204/218 (93%), Positives = 210/218 (96%)
 Frame = +1

Query: 133 AGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTN 312
           AGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKD+Y GDEAQSKRGILTLKYPIEHGIV+N
Sbjct: 1   AGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYDGDEAQSKRGILTLKYPIEHGIVSN 60

Query: 313 WDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQA 492
           WDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN PAMYVAIQA
Sbjct: 61  WDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNVPAMYVAIQA 120

Query: 493 VLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGY 672
           VLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTD LMKILTERGY
Sbjct: 121 VLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDNLMKILTERGY 180

Query: 673 SFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL 786
            FTTTAEREIVRD+KEKL YVALD+EQE+ TA SSSS+
Sbjct: 181 MFTTTAEREIVRDMKEKLAYVALDYEQEIETARSSSSI 218


>UniRef50_P02581 Cluster: Actin-1; n=1852; Eukaryota|Rep: Actin-1 -
           Glycine max (Soybean)
          Length = 377

 Score =  417 bits (1027), Expect = e-115
 Identities = 194/234 (82%), Positives = 215/234 (91%)
 Frame = +1

Query: 85  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKR 264
           E++  LV DNG+GM KAG AGDDAPRAVFPSIVGRPRH  V+VGMGQKD+YVGDEAQ +R
Sbjct: 5   EDIQPLVCDNGTGMVKAGLAGDDAPRAVFPSIVGRPRHTXVVVGMGQKDAYVGDEAQVQR 64

Query: 265 GILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQI 444
           GILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPK NREKM ++
Sbjct: 65  GILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKYNREKMXRV 124

Query: 445 MFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAG 624
           MFETF  PA+ VA+ AVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAG
Sbjct: 125 MFETFGAPAVCVAVLAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAG 184

Query: 625 RDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL 786
           RDLTD+LMKILT+RGYSFTT+A+R IVRD+KEKL Y+ALD EQE+ T+ +SSS+
Sbjct: 185 RDLTDFLMKILTQRGYSFTTSAQRGIVRDMKEKLAYIALDCEQELETSETSSSV 238


>UniRef50_P14883 Cluster: Actin-2; n=75; Eukaryota|Rep: Actin-2 -
           Plasmodium falciparum
          Length = 376

 Score =  410 bits (1009), Expect = e-113
 Identities = 186/232 (80%), Positives = 210/232 (90%)
 Frame = +1

Query: 85  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKR 264
           EE  ALVVDNGSGM K+G AGDDAP+ VFPSIVGRP+   +M+GM QK+ YVGDEAQ+KR
Sbjct: 3   EEAVALVVDNGSGMVKSGLAGDDAPKCVFPSIVGRPKMPNIMIGMEQKECYVGDEAQNKR 62

Query: 265 GILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQI 444
           GILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRV+PEEHPVLLTEAPLNPK NREKMTQI
Sbjct: 63  GILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVSPEEHPVLLTEAPLNPKTNREKMTQI 122

Query: 445 MFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAG 624
           MFETF+ PAMYV+IQA+LSLYASGRTTGIVLDSGDGVSHTVPIYEGY LPHAI R+D+AG
Sbjct: 123 MFETFDVPAMYVSIQAILSLYASGRTTGIVLDSGDGVSHTVPIYEGYVLPHAINRIDMAG 182

Query: 625 RDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSS 780
           RDLT ++MK  TERG++FTTTAEREIVRDIKEKLCY+A+D+++E+  +   S
Sbjct: 183 RDLTYHMMKWFTERGHTFTTTAEREIVRDIKEKLCYIAMDYDEELKRSEEHS 234


>UniRef50_Q0VHZ5 Cluster: Actin deviating protein; n=7;
           Eukaryota|Rep: Actin deviating protein - Bolivina sp.
           isolate 615
          Length = 360

 Score =  320 bits (787), Expect = 2e-86
 Identities = 144/205 (70%), Positives = 174/205 (84%)
 Frame = +1

Query: 145 GDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDM 324
           GDDAPRAVFP+I GR R  GVMVGM QK+ YVGDEAQSKRGIL+L++PI HGI T+WDD+
Sbjct: 1   GDDAPRAVFPAITGRRRRNGVMVGMAQKNCYVGDEAQSKRGILSLRWPIVHGISTSWDDV 60

Query: 325 EKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL 504
           E+IW HTFY ELR+ PEEHP+L+TE PLNPKANR+KMTQIMFETFNTPA Y AIQ+VLSL
Sbjct: 61  EEIWRHTFYQELRIQPEEHPILMTEPPLNPKANRQKMTQIMFETFNTPAFYTAIQSVLSL 120

Query: 505 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTT 684
           YASGRTTGIV+DSG  V++TVP+YEG+ LP+++ +L L G  +T+YLMKIL  + YSFTT
Sbjct: 121 YASGRTTGIVVDSGYDVTYTVPVYEGHCLPYSVSKLALGGNHVTEYLMKILNNKSYSFTT 180

Query: 685 TAEREIVRDIKEKLCYVALDFEQEM 759
           +AERE V  IKE LCY +L+F ++M
Sbjct: 181 SAERERVNYIKETLCYTSLNFNEDM 205


>UniRef50_UPI000065FC19 Cluster: Homolog of Homo sapiens "Actin,
           cytoplasmic 2; n=1; Takifugu rubripes|Rep: Homolog of
           Homo sapiens "Actin, cytoplasmic 2 - Takifugu rubripes
          Length = 396

 Score =  297 bits (729), Expect = 2e-79
 Identities = 132/226 (58%), Positives = 177/226 (78%)
 Frame = +1

Query: 100 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTL 279
           +V+D GSG  KAGFA +D P  VFP+I+G P+++ +M G  ++++Y+G EAQ  RG+L L
Sbjct: 2   IVLDTGSGFMKAGFADEDLPNVVFPTIIGMPKYEEIMNGRAERETYIGHEAQHMRGVLAL 61

Query: 280 KYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETF 459
           K+PI++GI+ NWD+MEKIWHHTF  ++RV PE+HPVLLTEA +NP  NR +M +IMFE F
Sbjct: 62  KHPIKNGIIQNWDEMEKIWHHTFL-QMRVDPEDHPVLLTEAAMNPLENRRRMVEIMFECF 120

Query: 460 NTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTD 639
           N P  YVA+QAVLSLYASGR+TG+V DSGDGVSH+VP+++G+ LPHA+ R  LAG D+T 
Sbjct: 121 NVPFTYVAMQAVLSLYASGRSTGVVFDSGDGVSHSVPVFDGHYLPHAVQRFPLAGVDVTL 180

Query: 640 YLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASS 777
           +L+K+L E+G    TTAE EIVR++KEK C VAL++E E+    SS
Sbjct: 181 HLIKLLQEQGVCMRTTAEVEIVREMKEKCCRVALNYEAELCAGGSS 226


>UniRef50_A4QNT8 Cluster: Si:ch211-241j12.3 protein; n=3; Danio
           rerio|Rep: Si:ch211-241j12.3 protein - Danio rerio
           (Zebrafish) (Brachydanio rerio)
          Length = 389

 Score =  295 bits (725), Expect = 6e-79
 Identities = 131/225 (58%), Positives = 176/225 (78%)
 Frame = +1

Query: 100 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTL 279
           +V+D+GSG+ KAGFA  D P AVFP+++GRP+++ VM     ++ YVG +AQ  RG+LTL
Sbjct: 25  IVLDSGSGLMKAGFADQDLPAAVFPTVIGRPKYEEVMNSCVDRELYVGHDAQHMRGVLTL 84

Query: 280 KYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETF 459
           +YPI HG+V+NWD+ME +W H F   L  APE+HPVLLTEA LNP  NR++M ++MFE F
Sbjct: 85  RYPIRHGVVSNWDEMEMLWTHAF-QLLSAAPEDHPVLLTEAALNPLQNRQRMVELMFEAF 143

Query: 460 NTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTD 639
           + P  +VA+QAVL+LYASGRTTG+VLDSGDGVSH+VP++EGY LPHA+ RLDLAG D+T 
Sbjct: 144 SVPLTFVAVQAVLALYASGRTTGVVLDSGDGVSHSVPVFEGYCLPHAVQRLDLAGADVTL 203

Query: 640 YLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAAS 774
            L K+L E G    T+AE EIVR++KE+ C+V++D+E EM ++ S
Sbjct: 204 QLQKLLLESGVCLRTSAELEIVREMKERCCFVSVDYEAEMKSSES 248


>UniRef50_UPI0000449751 Cluster: PREDICTED: similar to gamma-actin;
           n=3; Amniota|Rep: PREDICTED: similar to gamma-actin -
           Gallus gallus
          Length = 377

 Score =  287 bits (703), Expect = 3e-76
 Identities = 130/215 (60%), Positives = 169/215 (78%)
 Frame = +1

Query: 100 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTL 279
           +V DNGSG CKAG +G+ APR+V P+IVG P+   VM+GM  +D YVG+EAQSKRGIL+L
Sbjct: 12  VVFDNGSGQCKAGLSGEQAPRSVIPTIVGYPKFTFVMIGMEHRDWYVGEEAQSKRGILSL 71

Query: 280 KYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETF 459
            YP+E+G+VT+WD+MEKIW + + +EL V P E PVLLTE PLNP ++REKM ++MFE+F
Sbjct: 72  TYPMENGVVTSWDNMEKIWRYLYEHELGVKPSEGPVLLTETPLNPPSHREKMAELMFESF 131

Query: 460 NTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTD 639
             PA+YVA+Q + +L+A  RTTG+VLDSGDGV+ TVPI+ G  L   + RLD AGR +T 
Sbjct: 132 QVPALYVALQGLAALHACARTTGMVLDSGDGVTVTVPIHGGSCLLQGVTRLDFAGRGITK 191

Query: 640 YLMKILTERGYSFTTTAEREIVRDIKEKLCYVALD 744
           YL ++L E G+SF +  E+EIVRD+KEKLCYVALD
Sbjct: 192 YLARLLMEIGHSFVSATEKEIVRDMKEKLCYVALD 226


>UniRef50_P61163 Cluster: Alpha-centractin; n=356; root|Rep:
           Alpha-centractin - Homo sapiens (Human)
          Length = 376

 Score =  285 bits (698), Expect = 1e-75
 Identities = 120/220 (54%), Positives = 178/220 (80%), Gaps = 1/220 (0%)
 Frame = +1

Query: 100 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTL 279
           +V+DNGSG+ KAGFAGD  P+  FP+ VGRP+H  VM G  + D ++G +A+  RG+L++
Sbjct: 12  VVIDNGSGVIKAGFAGDQIPKYCFPNYVGRPKHVRVMAGALEGDIFIGPKAEEHRGLLSI 71

Query: 280 KYPIEHGIVTNWDDMEKIWHHTFY-NELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 456
           +YP+EHGIV +W+DME+IW + +  ++L+   EEHPVLLTEAPLNP+ NRE+  ++ FET
Sbjct: 72  RYPMEHGIVKDWNDMERIWQYVYSKDQLQTFSEEHPVLLTEAPLNPRKNRERAAEVFFET 131

Query: 457 FNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 636
           FN PA+++++QAVLSLYA+GRTTG+VLDSGDGV+H VPIYEG+A+PH+I+R+D+AGRD++
Sbjct: 132 FNVPALFISMQAVLSLYATGRTTGVVLDSGDGVTHAVPIYEGFAMPHSIMRIDIAGRDVS 191

Query: 637 DYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQE 756
            +L   L + GY F +++E EIV+ IKE+ CY++++ +++
Sbjct: 192 RFLRLYLRKEGYDFHSSSEFEIVKAIKERACYLSINPQKD 231


>UniRef50_Q2GY63 Cluster: Putative uncharacterized protein; n=1;
           Chaetomium globosum|Rep: Putative uncharacterized
           protein - Chaetomium globosum (Soil fungus)
          Length = 350

 Score =  277 bits (680), Expect = 2e-73
 Identities = 125/221 (56%), Positives = 174/221 (78%), Gaps = 1/221 (0%)
 Frame = +1

Query: 97  ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK-RGIL 273
           A+V+DNGSG  +AG++G+  P+  FPS VGRP+H  V+ G  + + +VG +A ++ RG+L
Sbjct: 9   AVVLDNGSGNIRAGYSGESEPKVNFPSWVGRPKHLRVLAGALEGEVFVGKKAAAELRGLL 68

Query: 274 TLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFE 453
            ++YP+EHGIVT+WDDMEKIW H  Y+EL+   E+HP+LLTE PLNP++NR+   QI+FE
Sbjct: 69  KIRYPLEHGIVTDWDDMEKIWSHV-YSELKCDAEQHPLLLTEPPLNPRSNRDTAAQILFE 127

Query: 454 TFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDL 633
           TFN PA++ +IQAVLSLYASGRTTG+VLD GDGVSH VP+Y+G+ +P++I R+D+AGRD+
Sbjct: 128 TFNVPALHTSIQAVLSLYASGRTTGVVLDVGDGVSHAVPVYQGFTVPNSIRRMDVAGRDV 187

Query: 634 TDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQE 756
           T+++  +L + GY F T+AE+EIVR IKE   YVA D  +E
Sbjct: 188 TEHMQTLLRKSGYVFHTSAEKEIVRMIKETTSYVARDPRKE 228


>UniRef50_Q0VHZ6 Cluster: Actin deviating protein; n=2; Bolivina sp.
           isolate 615|Rep: Actin deviating protein - Bolivina sp.
           isolate 615
          Length = 387

 Score =  277 bits (678), Expect = 3e-73
 Identities = 132/231 (57%), Positives = 170/231 (73%), Gaps = 20/231 (8%)
 Frame = +1

Query: 145 GDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDM 324
           G DAPRAVFP+IVG  +H+G+ VGM QK  YVGDEAQSKRGIL L +P++ G+V NWDDM
Sbjct: 1   GVDAPRAVFPTIVGTLKHRGIFVGMAQKSYYVGDEAQSKRGILKLMHPMQRGVVKNWDDM 60

Query: 325 EKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL 504
           EKIWHHT Y+ELRV PEEHP+L+T+ P   K +REKM QIMFETF+TP  YV + ++L+L
Sbjct: 61  EKIWHHTLYHELRVQPEEHPILMTDTPFASKMDREKMAQIMFETFDTPKFYVTLGSLLAL 120

Query: 505 YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTT 684
            ASGR +GIVL SG  V++TVPIYE   L HA+ ++++ G DLTD+L+KI++ERGYSFTT
Sbjct: 121 NASGRRSGIVLQSGGSVTYTVPIYEEKPLLHALQKVEIGGMDLTDHLLKIMSERGYSFTT 180

Query: 685 TAEREI--------------------VRDIKEKLCYVALDFEQEMATAASS 777
           TAEREI                    V+DIKEK+CYV+ D+ +++  +  S
Sbjct: 181 TAEREIAELFSACAFTEAILVVHAMQVKDIKEKMCYVSADYAKDLKASEQS 231


>UniRef50_Q9XZB9 Cluster: Actin; n=1; Sterkiella nova|Rep: Actin -
           Oxytricha nova
          Length = 374

 Score =  273 bits (670), Expect = 3e-72
 Identities = 113/233 (48%), Positives = 169/233 (72%)
 Frame = +1

Query: 85  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKR 264
           E    +V+DNGSG  KAGF G+D P  V  ++VGRP++Q  ++G+  KD ++G++A  KR
Sbjct: 2   ESSKTIVIDNGSGFVKAGFVGEDGPSVVLRNLVGRPKNQNAIIGVEAKDEFIGEDAYLKR 61

Query: 265 GILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQI 444
           G+L   YP++HGI+ +WDDMEK+W+H F  EL+V   EHP L++E+PL P+  RE+  Q+
Sbjct: 62  GVLKFSYPVQHGIIKDWDDMEKVWNHLFSYELKVDSSEHPFLISESPLTPEFIREQTVQM 121

Query: 445 MFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAG 624
           MFETFN P++Y+AI A L L++ G+TTGIV D GD  +H VP+ +G+ +P    R+ LAG
Sbjct: 122 MFETFNVPSLYMAISAALQLHSIGKTTGIVCDIGDSATHAVPVKDGFVIPDTSSRIQLAG 181

Query: 625 RDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSS 783
           +DLT ++ K+L ERGY+FT++ E +IV D+KEK+C+VALD+ + + T+   S+
Sbjct: 182 KDLTSFMAKVLRERGYNFTSSDELQIVSDMKEKICFVALDYVETLKTSQEGST 234


>UniRef50_A5E2K2 Cluster: Actin; n=5; Saccharomycetales|Rep: Actin -
           Lodderomyces elongisporus (Yeast) (Saccharomyces
           elongisporus)
          Length = 417

 Score =  271 bits (665), Expect = 1e-71
 Identities = 126/227 (55%), Positives = 165/227 (72%), Gaps = 12/227 (5%)
 Frame = +1

Query: 100 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGM-----------GQKDSYVGD 246
           +VVDNG G  KAGFAG++ PR    SI+GRP++Q +M G               D +VGD
Sbjct: 10  VVVDNGLGTLKAGFAGEEKPRTYASSIIGRPKYQKLMAGSLTSSTSGSTIASDTDLFVGD 69

Query: 247 EAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANR 426
            AQ  RG+L L YP+EHGIVT W DME IW H F  +L++ PE+HP+L+TEAPLNP++NR
Sbjct: 70  AAQKNRGLLRLNYPVEHGIVTKWSDMEIIWDHMFTQDLKIKPEDHPLLITEAPLNPRSNR 129

Query: 427 EKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAIL 606
           EKM Q+MFE FN P MY++IQAVL+LYASGRTTG+V+DSGDGVSH VP+YEG+ALP +I 
Sbjct: 130 EKMCQVMFEQFNVPCMYISIQAVLALYASGRTTGVVVDSGDGVSHIVPVYEGFALPPSIQ 189

Query: 607 RLDLAGRDLTDYL-MKILTERGYSFTTTAEREIVRDIKEKLCYVALD 744
           R+D+AGRD+T +L   I    G +  ++AE E+VR +KE  C+++ D
Sbjct: 190 RMDVAGRDVTSHLSYNIRRMTGVALQSSAELEVVRLMKESCCFISKD 236


>UniRef50_UPI00001E426E Cluster: PREDICTED: similar to actin-12;
           n=11; Eutheria|Rep: PREDICTED: similar to actin-12 - Mus
           musculus
          Length = 372

 Score =  270 bits (661), Expect = 3e-71
 Identities = 119/231 (51%), Positives = 170/231 (73%)
 Frame = +1

Query: 88  EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRG 267
           E   LV D GSG  K GF+G  AP+AVFP+I+G+ +H  V+ G+G++D ++G E Q+ R 
Sbjct: 2   EKTPLVCDYGSGFSKVGFSGTQAPQAVFPTILGKMKHTNVLEGLGEQDWFIGAETQTNRT 61

Query: 268 ILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIM 447
            L + YPI  G +TNWD++EKIWH++FY+ L++APE+HP+L+TEAPL  K  + +MTQI+
Sbjct: 62  ELNMYYPISRGAITNWDNVEKIWHYSFYHSLQIAPEQHPILITEAPLTSKEAKSRMTQIL 121

Query: 448 FETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGR 627
           FETFN PA+Y A QAVLSL ASGRT+G  ++SGDG+++ VP+  GY L  +  +LD+AG+
Sbjct: 122 FETFNFPALYTANQAVLSLIASGRTSGTAIESGDGMTYFVPVMNGYPLHLSTTKLDIAGQ 181

Query: 628 DLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSS 780
           DLT YLMK+L++ G    T A+ E +RD+K+K  YVALD+  EM+  ++ S
Sbjct: 182 DLTLYLMKLLSDNGNVLETIADLEYIRDLKDKYSYVALDYNMEMSKTSAPS 232


>UniRef50_A2DKQ5 Cluster: Actin 58, putative; n=2; Trichomonas
           vaginalis G3|Rep: Actin 58, putative - Trichomonas
           vaginalis G3
          Length = 373

 Score =  266 bits (653), Expect = 3e-70
 Identities = 120/219 (54%), Positives = 163/219 (74%)
 Frame = +1

Query: 100 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTL 279
           +V+DNG+G+ KAGFAG +AP++VFP+I+G P+    MVG   KD +VG EA  K  +L L
Sbjct: 6   IVIDNGTGLTKAGFAGAEAPKSVFPTIIGSPKSNMQMVGGQNKDFFVGFEAVQKSDLLVL 65

Query: 280 KYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETF 459
           + PIE+G ++NWDD+EKIWHHTFYNEL VAPEEHPV+L E P++P+ NREK  Q+MFETF
Sbjct: 66  RQPIENGTISNWDDIEKIWHHTFYNELLVAPEEHPVILAEKPMSPRMNREKKIQMMFETF 125

Query: 460 NTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTD 639
           N    Y+ +QAVL+L++ G TTG+V D+G+GVS TVPIYE Y LPHAI+R  ++G D+T 
Sbjct: 126 NVSGFYLGMQAVLALFSIGCTTGVVWDAGEGVSFTVPIYEAYGLPHAIMRSTISGADITK 185

Query: 640 YLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQE 756
           +L K L +RG +   + + E  + +KEK+C V  DF+ E
Sbjct: 186 HLQKTLLDRGVN-PESIKLEDCKVLKEKICSVMYDFQAE 223


>UniRef50_UPI00005864C8 Cluster: PREDICTED: similar to Actin; n=4;
           Strongylocentrotus purpuratus|Rep: PREDICTED: similar to
           Actin - Strongylocentrotus purpuratus
          Length = 383

 Score =  266 bits (651), Expect = 6e-70
 Identities = 126/227 (55%), Positives = 165/227 (72%)
 Frame = +1

Query: 82  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 261
           D+    +VVDNGSG  +AGFAG    RA FPS +GR +   V    G++++++G+     
Sbjct: 6   DDGPDPVVVDNGSGTIQAGFAGGKTCRATFPSCIGRSKKSHVD---GKREAFIGEAIYKH 62

Query: 262 RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQ 441
           R +L + YPIEHGIV +W+DMEKIWH+ F  +L V   EHPVL+TE P NP  NR+KM Q
Sbjct: 63  REVLGINYPIEHGIVKDWEDMEKIWHYLFDVDLMVDTTEHPVLMTEPPGNPMYNRQKMAQ 122

Query: 442 IMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLA 621
           IMFETF  PA YVA  A+LSLY+SGR +G V+++G GV+ T+ +YEGY L  A  R  LA
Sbjct: 123 IMFETFQIPAFYVANPALLSLYSSGRVSGFVIETGAGVTQTLAVYEGYCLEAATHRTGLA 182

Query: 622 GRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMA 762
           GR++T YLM++L ++GYSF+TTAEREIVR+IKE+ CYVA DFE+EMA
Sbjct: 183 GREMTHYLMRLLNKKGYSFSTTAEREIVREIKERCCYVAEDFEREMA 229


>UniRef50_Q4CV94 Cluster: Actin 2, putative; n=2; Trypanosoma
           cruzi|Rep: Actin 2, putative - Trypanosoma cruzi
          Length = 392

 Score =  264 bits (647), Expect = 2e-69
 Identities = 123/229 (53%), Positives = 168/229 (73%), Gaps = 1/229 (0%)
 Frame = +1

Query: 85  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKR 264
           +E  A+V+DNGSG  K GFAG++ PR VFPS+ G   +         +  YVGDEA  ++
Sbjct: 7   DEEPAVVLDNGSGNIKCGFAGEEIPRCVFPSVTGVSMNTRSSGSSSSQRVYVGDEALQEK 66

Query: 265 GILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQI 444
           G L   YP+EHGIV++WD ME++W H  Y +LRV PE   VLLTEAPLNP +NREKM + 
Sbjct: 67  G-LRYFYPMEHGIVSDWDQMERVWRHA-YEQLRVPPERQAVLLTEAPLNPISNREKMAET 124

Query: 445 MFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAG 624
           +FE+F  PA++V IQAVL+LY+SGRT G+VLDSGDGV+H VP++EG  +P ++ RL+LAG
Sbjct: 125 LFESFGVPALHVQIQAVLTLYSSGRTDGLVLDSGDGVTHLVPVFEGQTMPQSVRRLELAG 184

Query: 625 RDLTDYLMKILT-ERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATA 768
           RDLT+++M++L+ E    FTT+A+RE+ R +KE LCY+ L FE+E+  A
Sbjct: 185 RDLTEWMMELLSDELDRPFTTSADREVARRVKESLCYIPLFFEEELQAA 233


>UniRef50_UPI0000F2D825 Cluster: PREDICTED: similar to actin; n=1;
           Monodelphis domestica|Rep: PREDICTED: similar to actin -
           Monodelphis domestica
          Length = 416

 Score =  260 bits (638), Expect = 2e-68
 Identities = 118/224 (52%), Positives = 161/224 (71%)
 Frame = +1

Query: 88  EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRG 267
           E   ++ D GS   K G+ G+ +PR VFPS +G  R Q +  GM  +D+++G+E   K  
Sbjct: 48  ESLPVIFDGGSRYFKVGYGGEYSPRFVFPSAIGHYRWQNIKSGMDLRDTFIGNEVIEKWA 107

Query: 268 ILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIM 447
            L +KYPIEHGI+ NWDDMEKIWHH+FYN L V PE+HP+L+TE    PKAN+EK+ ++M
Sbjct: 108 NLLVKYPIEHGIIVNWDDMEKIWHHSFYNVLHVDPEKHPLLVTEHLFTPKANKEKLIEVM 167

Query: 448 FETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGR 627
           FE+F  PA+YVAIQ +LSL++SGRT+G++++SGD +++ VPI  G  LP +I+ +++AG 
Sbjct: 168 FESFRVPALYVAIQDILSLFSSGRTSGLIVNSGDQMTYGVPIEGGDILPDSIMTMEVAGH 227

Query: 628 DLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEM 759
           DL+  LMK L  +GYS  T  E  +VR IKEKLCYVALDF  EM
Sbjct: 228 DLSMALMKSLVNKGYSLCTMVELNLVRAIKEKLCYVALDFFDEM 271


>UniRef50_Q5KB93 Cluster: Actin binding protein, putative; n=3;
           Filobasidiella neoformans|Rep: Actin binding protein,
           putative - Cryptococcus neoformans (Filobasidiella
           neoformans)
          Length = 390

 Score =  255 bits (624), Expect = 1e-66
 Identities = 119/229 (51%), Positives = 160/229 (69%), Gaps = 2/229 (0%)
 Frame = +1

Query: 100 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGV-MVGMGQ-KDSYVGDEAQSKRGIL 273
           LVVDNG+G  K G+AG + P  VFPSIVGRP  +    +G  Q KD  +GDEA   R  L
Sbjct: 7   LVVDNGTGFVKCGWAGSNFPDYVFPSIVGRPILRAEERLGTSQLKDIMIGDEAAENRSYL 66

Query: 274 TLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFE 453
            + +P+EHG+V NW+DM  +W +TF  ++ + P    +LLTE P+NPKANR+KM ++MFE
Sbjct: 67  QVTHPMEHGVVKNWEDMRHLWDYTFNEKMHMDPRGKKILLTEPPMNPKANRQKMCEVMFE 126

Query: 454 TFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDL 633
            +    +YVAIQAVL+LYA G  TG+V+DSGDGV+H VP+Y+G+ALPH   RLD+AGRD+
Sbjct: 127 EYGFGGVYVAIQAVLTLYAQGLQTGVVVDSGDGVTHIVPVYDGFALPHLTRRLDVAGRDV 186

Query: 634 TDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSS 780
           T YL+K+L  RGY+F  TA+ E VR IKE LC+ + D E +   A  ++
Sbjct: 187 TRYLIKLLLMRGYAFERTADFETVRGIKEALCFTSYDLEMDKKLAEETT 235


>UniRef50_UPI0000F2D326 Cluster: PREDICTED: similar to actin; n=1;
           Monodelphis domestica|Rep: PREDICTED: similar to actin -
           Monodelphis domestica
          Length = 378

 Score =  253 bits (619), Expect = 4e-66
 Identities = 110/224 (49%), Positives = 156/224 (69%)
 Frame = +1

Query: 88  EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRG 267
           ++ + + DNGSG+CK G +G+  PR +  +++G P+    M    QK  YVG EAQ  R 
Sbjct: 8   KIPSAIFDNGSGLCKVGISGEQNPRFIQATVLGYPQSINSMANTWQKAYYVGQEAQDNRS 67

Query: 268 ILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIM 447
           ILTL +P++HG+VT+WDDMEKIW H + + LR  P++ PVLLTEAPLNP  NR KM +I 
Sbjct: 68  ILTLNHPMQHGVVTSWDDMEKIWEHLYKDGLRETPKQRPVLLTEAPLNPPENRAKMVEIF 127

Query: 448 FETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGR 627
           FETF  PA+YVA+Q +++LYA+G++TG+VL+ GDGV+  +PIY+G  L  +I R D AG 
Sbjct: 128 FETFQVPALYVALQGLMALYATGKSTGVVLECGDGVTAVIPIYQGRCLFQSISRSDFAGG 187

Query: 628 DLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEM 759
           D+T+YL  +  E+G S   T  ++I+ DIKE+LCY+  D  + M
Sbjct: 188 DVTNYLAGLFLEKGISLMNTGSKDIITDIKERLCYIIPDPHERM 231


>UniRef50_P61160 Cluster: Actin-related protein 2; n=96;
           Eukaryota|Rep: Actin-related protein 2 - Homo sapiens
           (Human)
          Length = 394

 Score =  250 bits (611), Expect = 4e-65
 Identities = 119/232 (51%), Positives = 160/232 (68%), Gaps = 3/232 (1%)
 Frame = +1

Query: 100 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRP--RHQGVMVGMGQKDSYVGDEAQSKRGIL 273
           +V DNG+G  K G+AG + P  +FP++VGRP  R    +  +  KD  VGDEA   R +L
Sbjct: 9   VVCDNGTGFVKCGYAGSNFPEHIFPALVGRPIIRSTTKVGNIEIKDLMVGDEASELRSML 68

Query: 274 TLKYPIEHGIVTNWDDMEKIWHHTFYNE-LRVAPEEHPVLLTEAPLNPKANREKMTQIMF 450
            + YP+E+GIV NWDDM+ +W +TF  E L +      +LLTE P+NP  NREK+ ++MF
Sbjct: 69  EVNYPMENGIVRNWDDMKHLWDYTFGPEKLNIDTRNCKILLTEPPMNPTKNREKIVEVMF 128

Query: 451 ETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRD 630
           ET+    +YVAIQAVL+LYA G  TG+V+DSGDGV+H  P+YEG++LPH   RLD+AGRD
Sbjct: 129 ETYQFSGVYVAIQAVLTLYAQGLLTGVVVDSGDGVTHICPVYEGFSLPHLTRRLDIAGRD 188

Query: 631 LTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL 786
           +T YL+K+L  RGY+F  +A+ E VR IKEKLCYV  + EQE   A  ++ L
Sbjct: 189 ITRYLIKLLLLRGYAFNHSADFETVRMIKEKLCYVGYNIEQEQKLALETTVL 240


>UniRef50_Q8TDY3 Cluster: Actin-related protein T2; n=26;
           Amniota|Rep: Actin-related protein T2 - Homo sapiens
           (Human)
          Length = 377

 Score =  245 bits (600), Expect = 9e-64
 Identities = 112/222 (50%), Positives = 156/222 (70%)
 Frame = +1

Query: 97  ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILT 276
           A++ DNGSG CKAG +G+  PR +  SIVG  + Q       QK  +VG+EA  K+  L 
Sbjct: 11  AVIFDNGSGFCKAGLSGEFGPRHMVSSIVGHLKFQAPSAEANQKKYFVGEEALYKQEALQ 70

Query: 277 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 456
           L  P E G++T WDD+E++W H F  EL V P + P+L TE  LNP+ NREKM ++MFE 
Sbjct: 71  LHSPFERGLITGWDDVERLWKHLFEWELGVKPSDQPLLATEPSLNPRENREKMAEVMFEN 130

Query: 457 FNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 636
           F  PA Y++ QAVL+LYAS   TG+V+DSGD V+ TVPI+EGY+LPHA+ +L +AGRD+T
Sbjct: 131 FGVPAFYLSDQAVLALYASACVTGLVVDSGDAVTCTVPIFEGYSLPHAVTKLHVAGRDIT 190

Query: 637 DYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMA 762
           + LM++L   G++F    ++ +V DIK+KLCYVAL+ E+E++
Sbjct: 191 ELLMQLLLASGHTFPCQLDKGLVDDIKKKLCYVALEPEKELS 232


>UniRef50_Q9BYD9 Cluster: Actin-related protein M1; n=12;
           Theria|Rep: Actin-related protein M1 - Homo sapiens
           (Human)
          Length = 372

 Score =  242 bits (593), Expect = 6e-63
 Identities = 109/221 (49%), Positives = 159/221 (71%)
 Frame = +1

Query: 100 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTL 279
           +V+DNGSGM KAG AG   P+ ++P+I+GR + Q      G  +  VGD+AQ  R  L +
Sbjct: 8   VVIDNGSGMIKAGVAGCREPQFIYPNIIGRAKGQS-RAAQGGLELCVGDQAQDWRSSLFI 66

Query: 280 KYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETF 459
            YP+E G++T+W+DME +W H +   L++ P + PVL+TE  LNP ANR+++T++ FE  
Sbjct: 67  SYPVERGLITSWEDMEIMWKHIYDYNLKLKPCDGPVLITEPALNPLANRQQITEMFFEHL 126

Query: 460 NTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTD 639
             PA Y++IQAVL+L+A+G TTG+VL+SG GV+ +VPI+EGY LPH + +LDLAG DLT+
Sbjct: 127 GVPAFYMSIQAVLALFAAGFTTGLVLNSGAGVTQSVPIFEGYCLPHGVQQLDLAGLDLTN 186

Query: 640 YLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMA 762
           YLM ++   G    + ++R+IV DIKE  CYVA+++E+EMA
Sbjct: 187 YLMVLMKNHGIMLLSASDRKIVEDIKESFCYVAMNYEEEMA 227


>UniRef50_Q24C02 Cluster: Actin family protein; n=3;
           Oligohymenophorea|Rep: Actin family protein -
           Tetrahymena thermophila SB210
          Length = 398

 Score =  239 bits (584), Expect = 7e-62
 Identities = 105/214 (49%), Positives = 160/214 (74%)
 Frame = +1

Query: 100 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTL 279
           +V+DNGSG+ +AG AG+D  +  F S +GRP+++ V+    Q D Y+G+ +  +RG+L L
Sbjct: 13  VVIDNGSGIIRAGIAGEDKAKLQFDSYIGRPKYKMVLPTNTQSDYYLGNISDEQRGLLKL 72

Query: 280 KYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETF 459
           +YPI HGI+ NW+DM+ IW +  Y+EL+V+ +E+PVLLTE  +NP  ++ ++ Q  FE F
Sbjct: 73  QYPINHGIIQNWNDMDLIWKYC-YSELKVSAKEYPVLLTEPAINPINHKFRVAQQFFENF 131

Query: 460 NTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTD 639
           N PA+++A+Q VLSL+ASG+TTG+V++ GDGVS  VP+++GY+L +A  R+DL GRD+T+
Sbjct: 132 NAPALFIAVQGVLSLFASGKTTGVVVEIGDGVSQIVPVFDGYSLQYAQQRIDLGGRDITE 191

Query: 640 YLMKILTERGYSFTTTAEREIVRDIKEKLCYVAL 741
           +L  +L   GY F T+AE EI++ IKEK C+V+L
Sbjct: 192 HLNLLLRRSGYFFHTSAEMEIIKKIKEKKCFVSL 225


>UniRef50_Q0J646 Cluster: Os08g0369300 protein; n=2; Oryza sativa
           (japonica cultivar-group)|Rep: Os08g0369300 protein -
           Oryza sativa subsp. japonica (Rice)
          Length = 495

 Score =  233 bits (570), Expect = 4e-60
 Identities = 106/216 (49%), Positives = 149/216 (68%), Gaps = 2/216 (0%)
 Frame = +1

Query: 100 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRP--RHQGVMVGMGQKDSYVGDEAQSKRGIL 273
           +V DNG+G  K GFAG++ P +VFP +VGRP  R++  +      D  VG      R  L
Sbjct: 7   VVCDNGTGYVKCGFAGENFPTSVFPCVVGRPLLRYEESLQEQELTDIVVGAACADLRHQL 66

Query: 274 TLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFE 453
            + YP+ +GIV +WDDM  IW H FY+EL+V P E  +LLT+ PLNP  NREKM + MFE
Sbjct: 67  DVSYPVTNGIVQSWDDMGHIWDHAFYSELKVDPSECKILLTDPPLNPVKNREKMIETMFE 126

Query: 454 TFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDL 633
            +N   +++ +QAVLSLYA G  TG+V+DSGDGV+H VP+ +G++ PH   R+++AGR +
Sbjct: 127 KYNFAGVFIQVQAVLSLYAQGLLTGLVIDSGDGVTHVVPVVDGFSYPHITKRMNVAGRHI 186

Query: 634 TDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVAL 741
           T YL+ +L+ RGY+   +A+ E VR+IKEKLCY++L
Sbjct: 187 TSYLVDLLSRRGYAMNKSADFETVREIKEKLCYLSL 222


>UniRef50_UPI0001554F81 Cluster: PREDICTED: similar to actin; n=1;
           Ornithorhynchus anatinus|Rep: PREDICTED: similar to
           actin - Ornithorhynchus anatinus
          Length = 376

 Score =  233 bits (569), Expect = 5e-60
 Identities = 107/238 (44%), Positives = 160/238 (67%), Gaps = 6/238 (2%)
 Frame = +1

Query: 91  VAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGI 270
           +  LV+DNG+G+CKAGFAGD+AP+ V P+ VG       M   G ++  +    ++ R +
Sbjct: 1   MTTLVIDNGTGLCKAGFAGDNAPKLVVPTAVGIQISPDNMTASGLQNRNILTGWETSRSL 60

Query: 271 L------TLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK 432
           L       L +P+  G+VT+WD+ME++W + F  +L   P +HPVLLTE+P N  A+R+K
Sbjct: 61  LEPGPTLALTFPVTRGVVTDWDEMERLWGYVF-QKLHARPTKHPVLLTESPKNRAADRDK 119

Query: 433 MTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL 612
           + QIMFETFN P+ ++ +Q +L+LYA G  TG+VL+SG G +H VP+++G+ +PHA L  
Sbjct: 120 LLQIMFETFNVPSTFLGVQGLLALYACGLVTGVVLESGAGATHVVPVHQGFGIPHATLSQ 179

Query: 613 DLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL 786
           +L G DL+ +LMK L    YSF + A+R++++DIKE LCYVA DFE  M  +A + S+
Sbjct: 180 ELGGHDLSHFLMKRLLGPMYSFCSLAQRQVIQDIKEDLCYVARDFEMAMRNSARAPSI 237


>UniRef50_Q7XB26 Cluster: Ubiquitin/actin fusion protein 4; n=1;
           Bigelowiella natans|Rep: Ubiquitin/actin fusion protein
           4 - Bigelowiella natans (Pedinomonas minutissima)
           (Chlorarachnion sp.(strain CCMP 621))
          Length = 234

 Score =  225 bits (551), Expect = 7e-58
 Identities = 110/159 (69%), Positives = 123/159 (77%)
 Frame = +1

Query: 85  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKR 264
           EE   LVVDNGS M KAGFAGD APR  FPS+   PR +  M G  ++D Y+G    +KR
Sbjct: 78  EECQPLVVDNGSDMIKAGFAGDGAPRTAFPSVFKVPRVRNTMTG--KQDVYIGS-VNAKR 134

Query: 265 GILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQI 444
           G+L  KY IEHGIVT+WD M KIW HTF NEL+VAPEEHPVLLTE PLNPKANREK  ++
Sbjct: 135 GVLINKYAIEHGIVTDWDAMLKIWDHTFLNELKVAPEEHPVLLTEPPLNPKANREKTIKV 194

Query: 445 MFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSH 561
           MFETF TPA Y+AIQA LSLYASGRTTGIVLDSG GVS+
Sbjct: 195 MFETFKTPATYIAIQAALSLYASGRTTGIVLDSGKGVSY 233


>UniRef50_UPI0000588EB0 Cluster: PREDICTED: similar to actin; n=1;
           Strongylocentrotus purpuratus|Rep: PREDICTED: similar to
           actin - Strongylocentrotus purpuratus
          Length = 386

 Score =  224 bits (547), Expect = 2e-57
 Identities = 111/224 (49%), Positives = 155/224 (69%), Gaps = 5/224 (2%)
 Frame = +1

Query: 100 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQK----DSYVGDEAQSKRG 267
           +V+D+GS   +AGFA +D PR VF SIVGRPRHQ V+  +  K    DSYVG+EAQ++RG
Sbjct: 14  MVIDHGSFEIQAGFAEEDCPRTVFQSIVGRPRHQEVLDDLTTKLNFRDSYVGEEAQNRRG 73

Query: 268 ILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIM 447
           +LTL YPIE GI+T WDDME +W HTF +E++  P++   +L++ P NPK N+EKM +I 
Sbjct: 74  VLTLTYPIERGIITKWDDMEAVWSHTF-SEIKFNPQDEGAVLSQIPNNPKPNKEKMAEIF 132

Query: 448 FETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGR 627
           FE F +P + +A QA L+L++ G+T G+++DSG GV+H VPI+    LP   L++DLAG 
Sbjct: 133 FEKFQSPGICLANQAALALFSLGKTCGLIVDSGHGVTHVVPIHPENPLPPTTLQMDLAGG 192

Query: 628 DLTDYLMK-ILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQE 756
           DL + L   ++ E  Y+   T     +R +KEKLCYVALD + E
Sbjct: 193 DLDEALFSHLVDEHKYNGRLTD----LRVVKEKLCYVALDPDNE 232


>UniRef50_Q9Y615 Cluster: Actin-like protein 7A; n=11; Mammalia|Rep:
           Actin-like protein 7A - Homo sapiens (Human)
          Length = 435

 Score =  222 bits (542), Expect = 9e-57
 Identities = 106/234 (45%), Positives = 150/234 (64%)
 Frame = +1

Query: 85  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKR 264
           E   A+VVD G+G CK GFAG   P     + VG+P  +    G  +K+++VG E  +  
Sbjct: 67  EVTKAVVVDLGTGYCKCGFAGLPRPTHKISTTVGKPYMETAKTGDNRKETFVGQELNNTN 126

Query: 265 GILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQI 444
             L L  P+ HGI+ +WD ++ IW + F  E+++APEEH VL+++ PL+P  NREK  ++
Sbjct: 127 VHLKLVNPLRHGIIVDWDTVQDIWEYLFRQEMKIAPEEHAVLVSDPPLSPHTNREKYAEM 186

Query: 445 MFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAG 624
           +FE FNTPAM++A Q+ LS+Y+ GRT+G+V++ G GVS+ VPIYEGY LP    RLD AG
Sbjct: 187 LFEAFNTPAMHIAYQSRLSMYSYGRTSGLVVEVGHGVSYVVPIYEGYPLPSITGRLDYAG 246

Query: 625 RDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL 786
            DLT YL+ +L   G  FT   +  IV DIK+K C+VALD  +E     S  ++
Sbjct: 247 SDLTAYLLGLLNSAGNEFTQD-QMGIVEDIKKKCCFVALDPIEEKKVPLSEHTI 299


>UniRef50_Q8IS27 Cluster: Actin-related protein 2; n=5;
           Oligohymenophorea|Rep: Actin-related protein 2 -
           Tetrahymena thermophila
          Length = 393

 Score =  218 bits (533), Expect = 1e-55
 Identities = 102/231 (44%), Positives = 154/231 (66%), Gaps = 2/231 (0%)
 Frame = +1

Query: 100 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRP--RHQGVMVGMGQKDSYVGDEAQSKRGIL 273
           +V D+G+G  K G+AGD+ P+   P+++GRP  R    +  +  K+  +G EA   + +L
Sbjct: 7   IVCDSGTGYIKIGYAGDNFPKYSIPAMIGRPMLRFNQKIDDVELKEIMIGGEAAPYQAML 66

Query: 274 TLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFE 453
            L  P+E G V NW DME +W ++F  +L    + + VL+TE  LNP  NR+K  +++FE
Sbjct: 67  ELTKPVEEGTVKNWQDMELLWDYSF-KKLGAETKGNTVLMTEPVLNPAQNRKKTAEVLFE 125

Query: 454 TFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDL 633
            FN   M + IQA+LSLY  G TTG++LDSGDGV+H +P+YE + LPH + R+++AGR +
Sbjct: 126 QFNFGRMQIGIQALLSLYCEGLTTGMLLDSGDGVTHCIPVYENFILPHLVKRMNIAGRHM 185

Query: 634 TDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL 786
           T+YL+K+L  RGY+F +TA+ E+VRDIKE+LCYV+ D   +   A  ++ L
Sbjct: 186 TEYLIKLLFRRGYAFNSTADFELVRDIKERLCYVSGDLVVDRKLANETTCL 236


>UniRef50_Q4QG59 Cluster: Actin-like protein, putative; n=3;
           Leishmania|Rep: Actin-like protein, putative -
           Leishmania major
          Length = 483

 Score =  216 bits (528), Expect = 5e-55
 Identities = 100/214 (46%), Positives = 142/214 (66%)
 Frame = +1

Query: 94  AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGIL 273
           AA+V+D GS   +AGF G+  PR   P++VG PRH+ + +  G  +  VG+EA  K+GIL
Sbjct: 8   AAVVLDCGSFHSRAGFGGEKGPRLDVPTLVGYPRHRSIAMAAGMNEQEVGEEALLKQGIL 67

Query: 274 TLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFE 453
            + +PI +G + +W D+EK+W H F+NELRV+PE H  LLT+    P A RE+  +IM E
Sbjct: 68  DVHHPIRNGFINDWGDVEKLWSHLFFNELRVSPETHCFLLTQPVNTPAAQRERTLEIMME 127

Query: 454 TFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDL 633
           TF+  ++Y+    VLSLY+ G TTG+V+DSG  V+H VPI+EGYAL   + +  +AG  L
Sbjct: 128 TFHAHSLYLGTSQVLSLYSYGLTTGLVVDSGKDVTHAVPIHEGYALVRHVTQSPVAGAAL 187

Query: 634 TDYLMKILTERGYSFTTTAEREIVRDIKEKLCYV 735
           T YL  +L E+GY+  T  E+E++   KE LCYV
Sbjct: 188 TRYLGGLLREQGYALGTATEQELLNGAKEDLCYV 221


>UniRef50_Q75JT2 Cluster: Similar to Drosophila melanogaster (Fruit
           fly). RE12057p; n=4; Dictyostelium discoideum|Rep:
           Similar to Drosophila melanogaster (Fruit fly). RE12057p
           - Dictyostelium discoideum (Slime mold)
          Length = 414

 Score =  214 bits (523), Expect = 2e-54
 Identities = 116/216 (53%), Positives = 151/216 (69%)
 Frame = +1

Query: 136 GFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNW 315
           GF+GD++P A FPS+VG  + +     +GQ DSY+         +LT K          W
Sbjct: 198 GFSGDESPHA-FPSVVGFSKPK-----IGQVDSYLL--------LLTGKI---------W 234

Query: 316 DDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAV 495
              +K W+H F ++L V+ ++HPV LTE P NPK N EKM Q MFE +  PAMYV+IQA+
Sbjct: 235 ---KKFWNHAFNDQLCVSSDQHPVFLTEPPFNPKVNTEKMAQYMFECYGIPAMYVSIQAI 291

Query: 496 LSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYS 675
           LSLYASGRTTGIV+DSG GVSHTVPIYEG A+ ++IL LDLAG DLTDY+MK+L+ERG S
Sbjct: 292 LSLYASGRTTGIVIDSGGGVSHTVPIYEGKAMTNSILHLDLAGNDLTDYMMKMLSERGNS 351

Query: 676 FTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSS 783
           F+TTA +   +  + ++ YVALDFE E+ TAA+S+S
Sbjct: 352 FSTTARKRNCQRYQREIAYVALDFETEVKTAANSTS 387


>UniRef50_A2FH22 Cluster: Actin family protein; n=1; Trichomonas
           vaginalis G3|Rep: Actin family protein - Trichomonas
           vaginalis G3
          Length = 390

 Score =  211 bits (516), Expect = 1e-53
 Identities = 103/230 (44%), Positives = 148/230 (64%), Gaps = 2/230 (0%)
 Frame = +1

Query: 100 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRP--RHQGVMVGMGQKDSYVGDEAQSKRGIL 273
           +V+D G+G  KAG +    P  V  + VGRP  R          KD  V DE    R  L
Sbjct: 6   VVLDLGTGYLKAGLSSRQIPDFVLQNTVGRPILRSDESFSKAKLKDIMVCDETYPVRQYL 65

Query: 274 TLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFE 453
            L  P+EHGIV NW+D   +  + F  +L++  E+HP+L+TEAPLNPK NR+KM +I FE
Sbjct: 66  DLTLPVEHGIVKNWEDEALVLDYVFKEKLKIRNEDHPLLITEAPLNPKDNRKKMCEIFFE 125

Query: 454 TFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDL 633
            FN P + V  QA+L LYA G  TG+V+DSGDGV+H +PI E Y L H   R+D++GRD+
Sbjct: 126 QFNFPRLQVCPQALLVLYAQGLMTGVVVDSGDGVTHIMPIAENYILSHLTGRMDISGRDV 185

Query: 634 TDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSS 783
           T+ L+K+LT RGY+F  T++ ++VR+IKE+LC+++ D + +   A  +++
Sbjct: 186 TEQLVKLLTLRGYTFHKTSDFDVVREIKEQLCFISADIDVDRKIANETTT 235


>UniRef50_A2DBN6 Cluster: Actin family protein; n=1; Trichomonas
           vaginalis G3|Rep: Actin family protein - Trichomonas
           vaginalis G3
          Length = 373

 Score =  209 bits (511), Expect = 5e-53
 Identities = 97/225 (43%), Positives = 140/225 (62%), Gaps = 1/225 (0%)
 Frame = +1

Query: 88  EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRH-QGVMVGMGQKDSYVGDEAQSKR 264
           EV+ +V+D G+   +AGF GD  P+ + P+++GR +  Q     +  KD YVG E   + 
Sbjct: 2   EVSTIVIDTGAYSTRAGFGGDSDPQCILPTVIGRLKSPQDKAAAIATKDIYVGSEVFEQS 61

Query: 265 GILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQI 444
             L LK PI   +++N D++E  W H F  EL +   EHPVL+TE+P N K  REK+TQI
Sbjct: 62  KNLNLKCPISDRVISNIDEIEVFWQHIFSKELNINTSEHPVLMTESPQNTKIMREKVTQI 121

Query: 445 MFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAG 624
           M ETF  PA Y A   VLSLYA+G  +G V+D+G+ ++  +P+Y+ + + H   ++++ G
Sbjct: 122 MMETFKVPAYYTAYPGVLSLYANGMASGCVIDAGETITQILPVYQCFGMTHITGKVEVGG 181

Query: 625 RDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEM 759
           R L  YL K+L +   +     EREIVRDIKE+LCYVA DF  E+
Sbjct: 182 RSLNAYLKKLLNDHDITLPQQNEREIVRDIKEQLCYVATDFNNEV 226


>UniRef50_Q4N681 Cluster: Actin, putative; n=3; Piroplasmida|Rep:
           Actin, putative - Theileria parva
          Length = 380

 Score =  209 bits (510), Expect = 7e-53
 Identities = 101/231 (43%), Positives = 147/231 (63%), Gaps = 5/231 (2%)
 Frame = +1

Query: 85  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIV---GRPRHQGVMVGMG--QKDSYVGDE 249
           +E  AL++D GS + KAGFAG + P+  FP++V   G       +VG G  +K   +   
Sbjct: 3   DETLALIIDTGSAVTKAGFAGSETPKVRFPTLVAIDGNQESDDPLVGNGVLEKLDKLNSN 62

Query: 250 AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRE 429
              +     +  P++HGIV NW   E +W HTF NEL+++ EEHPVLLTE PL PK +RE
Sbjct: 63  KSQELASFEVYRPVQHGIVRNWALAESVWRHTFTNELKISQEEHPVLLTEPPLTPKLHRE 122

Query: 430 KMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILR 609
              Q+ FE+F  PA+Y+A  ++LS+Y S +T+G+VLD G+GV+H+V I+EG  +P+AI R
Sbjct: 123 LCCQLFFESFGVPALYLATTSLLSMYGSSKTSGLVLDIGEGVAHSVLIHEGCIMPYAITR 182

Query: 610 LDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMA 762
           LD+ G DLT  ++K +        T  +R I +DIKE+ C V+LDF+ E+A
Sbjct: 183 LDMGGFDLTSQIVKAV--EPLRANTPYDRRIAKDIKEQCCRVSLDFDAELA 231


>UniRef50_A0E1S8 Cluster: Chromosome undetermined scaffold_73, whole
           genome shotgun sequence; n=1; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_73,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 383

 Score =  208 bits (509), Expect = 9e-53
 Identities = 102/221 (46%), Positives = 143/221 (64%), Gaps = 1/221 (0%)
 Frame = +1

Query: 100 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTL 279
           +V+DNGS   KAGF G  AP    P++VGRP+ +        +D Y G+EA +K   L+L
Sbjct: 11  IVIDNGSYELKAGFQGHYAPSCRIPTVVGRPKLENSDEDF--EDQYFGEEAMAKANALSL 68

Query: 280 KYPIEHGIVTNWDDMEKIWHHTFYNELRVAPE-EHPVLLTEAPLNPKANREKMTQIMFET 456
           KYPI+ GI+ +WD +  I     +N+  +  E EHP+LLTE P+NP ANREK  QI+FET
Sbjct: 69  KYPIQRGIINDWDGIIYINMILIWNQFGIMQESEHPILLTEVPINPNANREKTMQILFET 128

Query: 457 FNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 636
           F  P + +  +AVL LYA G+ TG+V+DSG   ++ VP+YEGY L HA+LR D AG   T
Sbjct: 129 FQAPLISLVNKAVLPLYAVGKLTGVVVDSGQDDTNIVPVYEGYYLQHAVLRRDYAGNACT 188

Query: 637 DYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEM 759
              ++IL + GY F     R ++ ++KEKLCYVA D+++E+
Sbjct: 189 QEFLQILNKSGYYFYKHYYRSLIIEMKEKLCYVAQDYDKEI 229


>UniRef50_Q55DS6 Cluster: Putative uncharacterized protein; n=1;
           Dictyostelium discoideum AX4|Rep: Putative
           uncharacterized protein - Dictyostelium discoideum AX4
          Length = 392

 Score =  204 bits (499), Expect = 1e-51
 Identities = 97/237 (40%), Positives = 159/237 (67%), Gaps = 3/237 (1%)
 Frame = +1

Query: 82  DEEVA-ALVVDNGSGMCKAGFAGDD-APRAVFPSIVGRPRHQGVMVGM-GQKDSYVGDEA 252
           +EE+  ++++D GSG  K GF+ ++  PR  FP+I+GR ++  V+ G   +K  + G E 
Sbjct: 8   NEEIRNSVIIDCGSGFTKVGFSNEELTPRNEFPTIIGRTKYYEVLYGAPNKKVIFAGHEV 67

Query: 253 QSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK 432
           ++++  +++K+PIE G + NWDDMEK+ +++F+  L ++ +E+P+L+T++P N K NRE+
Sbjct: 68  ETQKTNISIKHPIERGSIINWDDMEKLLNYSFHQVLNISCDEYPILITDSPFNSKMNRER 127

Query: 433 MTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL 612
           +TQ++FET+N+    V  +A LSL  SG+ + I+   G G S+TVPIY+G  +  A+  L
Sbjct: 128 LTQLLFETYNSKLASVTNRASLSLIGSGKESAIIAHCGFGESYTVPIYQGKIITKAMSHL 187

Query: 613 DLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSS 783
            L G DL+++LM+ L  R Y F T  E  IV DIKEKL YV+L++  +M  AA++ S
Sbjct: 188 PLGGNDLSNFLMEFLKNRDYKFNTYNENLIVNDIKEKLGYVSLNYNLDMQKAATNIS 244


>UniRef50_Q9Y614 Cluster: Actin-like protein 7B; n=12; Theria|Rep:
           Actin-like protein 7B - Homo sapiens (Human)
          Length = 415

 Score =  204 bits (499), Expect = 1e-51
 Identities = 97/224 (43%), Positives = 144/224 (64%)
 Frame = +1

Query: 88  EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRG 267
           ++ A+++D GS  CK G+AG+  P     S VG+   +    G  +K + VG E  +   
Sbjct: 48  KIKAVIIDLGSQYCKCGYAGEPRPTYFISSTVGKRCPEAADAGDTRKWTLVGHELLNTEA 107

Query: 268 ILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIM 447
            L L  P++HGIV +WD ++ IW + F   +++ PEEH VL+++ PL+P +NREK  ++M
Sbjct: 108 PLKLVNPLKHGIVVDWDCVQDIWEYIFRTAMKILPEEHAVLVSDPPLSPSSNREKYAELM 167

Query: 448 FETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGR 627
           FETF  PAM+V  Q++LS+Y+ G+T+G+V++SG GVSH VPI EG  LP    R D AG 
Sbjct: 168 FETFGIPAMHVTSQSLLSIYSYGKTSGLVVESGHGVSHVVPISEGDVLPGLTSRADYAGG 227

Query: 628 DLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEM 759
           DLT+YLM++L E G++FT      I+  IK+K CY A   E+E+
Sbjct: 228 DLTNYLMQLLNEAGHAFTDD-HLHIIEHIKKKCCYAAFLPEEEL 270


>UniRef50_A2FRF9 Cluster: Actin family protein; n=1; Trichomonas
           vaginalis G3|Rep: Actin family protein - Trichomonas
           vaginalis G3
          Length = 543

 Score =  204 bits (498), Expect = 2e-51
 Identities = 93/226 (41%), Positives = 137/226 (60%)
 Frame = +1

Query: 100 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTL 279
           +V+D GSG  K GFAG   P+  FP++VG P+    ++G    D +VG+E  +K  ++ +
Sbjct: 6   VVIDTGSGFTKVGFAGYYEPKVEFPTVVGVPKDSTALIGGKNVDFFVGNEVFTKSDLVDI 65

Query: 280 KYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETF 459
             PIE+G++ NWDD+EK+WHHT+YNEL V P++HPV++TE     +  REK  Q+ FETF
Sbjct: 66  SKPIENGVIVNWDDIEKVWHHTYYNELLVVPDQHPVIITEKQCATQHAREKTIQMFFETF 125

Query: 460 NTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTD 639
           N P  Y  +Q+V +L + G TTGIV D G+G S  VP+YEGY  PHA+L+  + G  LT 
Sbjct: 126 NVPGYYSGVQSVFALLSCGLTTGIVWDGGEGYSSVVPVYEGYQQPHAVLQSPICGEVLTK 185

Query: 640 YLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASS 777
           +    L   G + T+  +   +  +KE  C V    ++  A  + S
Sbjct: 186 FFTDKLNAAG-TDTSFLKPNDIAGLKENKCRVNRKIDENRAKTSQS 230


>UniRef50_O96819 Cluster: Actin-related protein; n=5;
           Trypanosoma|Rep: Actin-related protein - Trypanosoma
           brucei
          Length = 433

 Score =  203 bits (496), Expect = 3e-51
 Identities = 94/221 (42%), Positives = 141/221 (63%), Gaps = 1/221 (0%)
 Frame = +1

Query: 76  MCDEEVAALVV-DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA 252
           +C  E A +V+ D GS   +AG+A D APR   P++VG PR++GV V  G  +  +GD A
Sbjct: 2   VCSTERAPVVILDGGSHHLRAGYASDGAPRLDIPALVGHPRNRGVAVAAGMNEYEIGDVA 61

Query: 253 QSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK 432
            +KRG+LT+  PIE G V +W++MEK+W H  Y+ELRV PE H  ++ ++   P + +EK
Sbjct: 62  LAKRGMLTVSSPIESGRVVSWENMEKLWGHVMYSELRVRPESHCFIVPQSVNTPASQKEK 121

Query: 433 MTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL 612
             ++M ETF+  ++++    VLSLY+ G TTG+V+DSG   +  VP++EGYAL   +   
Sbjct: 122 TLELMMETFHVHSLFLGASQVLSLYSYGLTTGLVIDSGKDRTMAVPVHEGYALGRHVAES 181

Query: 613 DLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYV 735
           D+AG  LT+Y   +L   G SF T  E +++ + KE +CYV
Sbjct: 182 DVAGEKLTEYFASLLRLEGNSFGTPMEMQVLNNAKEDICYV 222


>UniRef50_A7S2B1 Cluster: Predicted protein; n=1; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 265

 Score =  199 bits (486), Expect = 6e-50
 Identities = 97/234 (41%), Positives = 147/234 (62%), Gaps = 4/234 (1%)
 Frame = +1

Query: 97  ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVG--MGQKD-SYVGDEAQSKRG 267
           A+V+DNG G+ K GFAGD  PR + P++VG P+   +++G  +  KD    GD A +K G
Sbjct: 1   AIVLDNGCGISKIGFAGDRVPRIIQPAVVGNPQRFSMLIGDNVNVKDYKKYGDAAVAKSG 60

Query: 268 ILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIM 447
           ++ L YP+    +  W D+  +W +  Y+EL +   EHP ++TE   N   NREK+T+I+
Sbjct: 61  VMHLSYPMHADKLETWTDVVDLWEYLLYDELDIGEGEHPFIVTEIAKNHPKNREKLTEIL 120

Query: 448 FETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGR 627
           FE F+ PAMY+A Q  LSLYASG TTG+ L SG   +    IYEG+ L H +  L++ G 
Sbjct: 121 FEQFSAPAMYLADQLSLSLYASGMTTGVCLSSGFSCTQAAVIYEGHTLNHTLQTLEIGGH 180

Query: 628 DLTDYLMKIL-TERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL 786
            LT+ L + L  +RG++FT+++  +IV DIKEK+CY++ D  +E+    ++  L
Sbjct: 181 HLTENLKQYLRDQRGHNFTSSSGWQIVNDIKEKICYLSKDHLKEVHNYKTNEGL 234


>UniRef50_Q6X960 Cluster: HSD21; n=13; Theria|Rep: HSD21 - Homo
           sapiens (Human)
          Length = 416

 Score =  198 bits (484), Expect = 1e-49
 Identities = 95/225 (42%), Positives = 143/225 (63%)
 Frame = +1

Query: 88  EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRG 267
           +  A+V+D G+G CK GFAG  +P     +I+G    +    G     +++G+ A+    
Sbjct: 48  KTGAVVIDMGTGTCKVGFAGQASPTYTVATILGCQPKKPATSGQSGLQTFIGEAARVLPE 107

Query: 268 ILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIM 447
            LTL  P+  GIV +WD  E IW H   ++LRVA  +HP+L ++ P +P  NREK+ ++ 
Sbjct: 108 -LTLVQPLRSGIVVDWDAAELIWRHLLEHDLRVATHDHPLLSSDPPFSPATNREKLVEVA 166

Query: 448 FETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGR 627
           FE+  +PAMYVA Q+VLS+YA GR +G+V+D+G GV++TVP+++GY L HA  RLDLAG 
Sbjct: 167 FESLRSPAMYVASQSVLSVYAHGRVSGLVVDTGHGVTYTVPVFQGYNLLHATERLDLAGN 226

Query: 628 DLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMA 762
            LT +L ++L + G       + ++V +IK   CYVA DF++E A
Sbjct: 227 HLTAFLAEMLLQAGLPL-GQQDLDLVENIKHHYCYVASDFQKEQA 270


>UniRef50_UPI000049A548 Cluster: actin; n=1; Entamoeba histolytica
           HM-1:IMSS|Rep: actin - Entamoeba histolytica HM-1:IMSS
          Length = 365

 Score =  197 bits (480), Expect = 3e-49
 Identities = 100/229 (43%), Positives = 145/229 (63%)
 Frame = +1

Query: 100 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTL 279
           +++DNGSG+ KAG + ++ P+ VFP +VG  +          K   +GD A+  +  L L
Sbjct: 6   IIIDNGSGLIKAGESSEELPKIVFPCVVGHSKETN-------KLENIGDFARFSKD-LNL 57

Query: 280 KYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETF 459
           + PI+ GI+ +W+D+E IW   F  EL+V   +  V+LT+A L P  ++EKM QIMFE F
Sbjct: 58  QQPIQRGIINDWNDIEDIWDFAF-EELQVESSDQVVMLTQAALTPPIHKEKMAQIMFEGF 116

Query: 460 NTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTD 639
               + V +Q++L LY SGRTTG+V+D G G+   VPIY GY + HA LRL  AG ++ +
Sbjct: 117 GMKGLDVMMQSLLELYFSGRTTGVVVDCGYGMCQVVPIYNGYMMEHATLRLMCAGEEINE 176

Query: 640 YLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL 786
           YL K+L ERG  F+T +E+  V  IKE+L YVA D+++E   A+ SS L
Sbjct: 177 YLRKLLIERGIIFSTESEKIEVERIKERLGYVAFDYKEESTLASLSSEL 225


>UniRef50_Q4DMP2 Cluster: Actin-related protein 2, putative; n=4;
           Trypanosoma|Rep: Actin-related protein 2, putative -
           Trypanosoma cruzi
          Length = 403

 Score =  196 bits (478), Expect = 5e-49
 Identities = 99/248 (39%), Positives = 151/248 (60%), Gaps = 15/248 (6%)
 Frame = +1

Query: 88  EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRP-------RHQG--------VMVGMG 222
           E   +V+DNGSG  K G+AG + P AVF + +GRP       R  G          V   
Sbjct: 4   EKRPVVLDNGSGFIKCGYAGANFPTAVFQTALGRPVLRSTKKRSHGSGGGEEGHTHVDPM 63

Query: 223 QKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEA 402
            +D   GDE    R +L + YPI +GI+ N D+M  +W +TF   L++ P EH +LL+E 
Sbjct: 64  MRDIVFGDECSGVRHLLDMTYPIRNGIIQNMDEMCHLWDYTFGEMLQINPSEHRLLLSEV 123

Query: 403 PLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEG 582
           PL    +R  + ++MFE +N  A+  A+Q  LSL+++G  TG+ ++SG+G+SH  PI+EG
Sbjct: 124 PLFSSKHRCHLYEVMFEKYNFMAIQSAVQGTLSLFSNGLQTGVAVESGEGISHCTPIFEG 183

Query: 583 YALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMA 762
           YALP A  R+DL GR++T++L++++  RGYSF  +++ E VR +KE+ CY A+D + E  
Sbjct: 184 YALPKANRRVDLGGRNITEFLIRLMQRRGYSFNQSSDYETVRRMKERFCYAAVDSKLEKQ 243

Query: 763 TAASSSSL 786
            A  ++ L
Sbjct: 244 LALETTVL 251


>UniRef50_Q38F20 Cluster: Actin-like protein 3, putative; n=1;
           Trypanosoma brucei|Rep: Actin-like protein 3, putative -
           Trypanosoma brucei
          Length = 416

 Score =  192 bits (469), Expect = 6e-48
 Identities = 99/239 (41%), Positives = 140/239 (58%), Gaps = 17/239 (7%)
 Frame = +1

Query: 100 LVVDNGSGMCKAGFAGDDAPRAVFPSI-----VGRPRHQGVMVGMGQKDSYVGDEAQSKR 264
           +V+DNG+G  K G+AG++ P  + P+        R R   V   +   D YVGDEA +  
Sbjct: 6   VVIDNGTGYTKMGYAGNEEPTYIIPTAYADNEASRRRSHDVFSDL---DFYVGDEALAHS 62

Query: 265 GILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQI 444
               L +PI+HGIV +WD ME+IW H  Y  LRV PEEH  +LTE P NP  NRE   ++
Sbjct: 63  SSCNLYHPIKHGIVEDWDKMERIWQHCVYKYLRVDPEEHGFILTEPPANPPENREHTAEV 122

Query: 445 MFETFNTPAMYVAIQAVLSLYAS------------GRTTGIVLDSGDGVSHTVPIYEGYA 588
           MFETF    +++A+Q  L+L AS            G  TG+V+DSGDGV+H VPI +G+ 
Sbjct: 123 MFETFGVKQLHIAVQGALALRASWTSGKAQQLGLVGENTGVVVDSGDGVTHIVPIVDGFV 182

Query: 589 LPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMAT 765
           + +AI  + LAGRD+T+++++ L ERG          + + IKEK CY+A +  +E  T
Sbjct: 183 MHNAIQHIPLAGRDITNFVLEWLRERGEPVPADDALYLAQHIKEKYCYIARNIAREFET 241


>UniRef50_Q5CSX9 Cluster: Actin; n=2; Cryptosporidium|Rep: Actin -
           Cryptosporidium parvum Iowa II
          Length = 405

 Score =  190 bits (463), Expect = 3e-47
 Identities = 86/215 (40%), Positives = 141/215 (65%)
 Frame = +1

Query: 100 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTL 279
           +V+D GS   KAG   D +P  +FPS+VG+ R + V         +VG+EA ++R  L+L
Sbjct: 22  IVIDCGSAYMKAGTDSDKSPTCIFPSMVGQYRSRYVPEDEDNNPIFVGEEAIAQRKKLSL 81

Query: 280 KYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETF 459
            +PI+HG + +W   E++ ++ FY  L + P +  V++T+ PL    + EK+T++MFE F
Sbjct: 82  TFPIDHGHIDDWTKFEELLNYLFYRGLDIDPIDSSVIITKPPLCSNRHEEKITELMFEMF 141

Query: 460 NTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTD 639
            T ++ +A+Q +++LY++GRTTG+  D G+GV+  VP+Y+GY    ++ R D+ G+++T 
Sbjct: 142 QTQSLNIALQGLMALYSAGRTTGVACDIGEGVTQVVPVYDGYCDSSSLRRADIGGQEITM 201

Query: 640 YLMKILTERGYSFTTTAEREIVRDIKEKLCYVALD 744
           YL K+L+++GY  TT  + E VR IKE LCY+A D
Sbjct: 202 YLQKLLSDKGYIATTRDDLEHVRIIKETLCYIAKD 236


>UniRef50_UPI0000E47BC7 Cluster: PREDICTED: similar to ubiquitin/actin
            fusion protein; n=1; Strongylocentrotus purpuratus|Rep:
            PREDICTED: similar to ubiquitin/actin fusion protein -
            Strongylocentrotus purpuratus
          Length = 1608

 Score =  189 bits (460), Expect = 8e-47
 Identities = 95/233 (40%), Positives = 144/233 (61%), Gaps = 10/233 (4%)
 Frame = +1

Query: 100  LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILT- 276
            +++DNGS M +AG A   AP    P++VGR + + +     +KD YVG+E   K G+LT 
Sbjct: 1236 IILDNGSSMLRAGLADGVAPSVTMPTVVGRLK-KDIESYRNRKDVYVGNELTKKYGLLTY 1294

Query: 277  --------LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK 432
                    L+Y    G+V NW ++E IW H   +EL V  E+HP+LLTE    PK  RE+
Sbjct: 1295 QIILNNSPLRYLPIGGVVDNWAELEHIWDHVVSHELNVKWEDHPILLTELASAPKRQRER 1354

Query: 433  MTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL 612
            + +++FET+ TPA +V  Q  L+L+A+G T+G+VL SG GV+  VP+Y+G  + +A+  L
Sbjct: 1355 ILEVLFETYKTPACFVVNQGALALHANGETSGLVLSSGSGVTEVVPVYQGCTITNAVTTL 1414

Query: 613  DLAGRDLTDYLMKIL-TERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATA 768
              AGR +T  L +IL  ER +S +T  +  I++D+KE + YV  D++ EM+ A
Sbjct: 1415 PTAGRGVTRRLQRILMDERAFSVSTPFDHRILQDLKENMAYVCKDYDSEMSHA 1467


>UniRef50_Q6BG22 Cluster: Actin, putative; n=2; Paramecium
           tetraurelia|Rep: Actin, putative - Paramecium
           tetraurelia
          Length = 370

 Score =  189 bits (460), Expect = 8e-47
 Identities = 90/216 (41%), Positives = 140/216 (64%), Gaps = 1/216 (0%)
 Frame = +1

Query: 100 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTL 279
           +V++N S   +AG  G+ APR  FP+ V + +    +  +      +G++ +  +     
Sbjct: 8   VVIENSSCNIRAGIVGEAAPRCCFPTRVDKVQESQTIKFL------IGNQIEENQYNNQP 61

Query: 280 KYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETF 459
            YPI++G + +W+ +E+IW + F  +L+++P  HPVLLTEAP N K N+EKMTQIMFE F
Sbjct: 62  CYPIQNGQIMDWESIEQIWRYIFEVQLKISPSNHPVLLTEAPCNSKINQEKMTQIMFENF 121

Query: 460 NTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTD 639
             P ++++ Q VLSLY+ G+TTG++LDSG+G ++ VPIYEG+ L   + +LD+AG + T+
Sbjct: 122 EVPFLHISNQTVLSLYSLGKTTGVILDSGEGATYCVPIYEGFQLRQQLSKLDIAGSNCTN 181

Query: 640 YLMKILTERGYSFTTTAER-EIVRDIKEKLCYVALD 744
           Y+ + L E      T  +R +I + IKE LCYVALD
Sbjct: 182 YMSQTLKEEFLKIYTPFQRNQIAKAIKESLCYVALD 217


>UniRef50_UPI0000605B09 Cluster: PREDICTED: similar to actin alpha 1
           skeletal muscle protein; n=1; Mus musculus|Rep:
           PREDICTED: similar to actin alpha 1 skeletal muscle
           protein - Mus musculus
          Length = 255

 Score =  188 bits (457), Expect = 2e-46
 Identities = 81/146 (55%), Positives = 111/146 (76%)
 Frame = +1

Query: 88  EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRG 267
           E   LV D GSG  K GF+G  AP+AVFP+I+G+ +H  V+ G+G++D ++G E Q+ R 
Sbjct: 2   EKTPLVCDYGSGFSKVGFSGTQAPQAVFPTILGKMKHTNVLEGLGEQDWFIGAETQTNRT 61

Query: 268 ILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIM 447
            L + YPI  G +TNWD++EKIWH++FY+ L++APE+HP+L+TEAPL  K  + +MTQI+
Sbjct: 62  ELNMYYPISRGAITNWDNVEKIWHYSFYHSLQIAPEQHPILITEAPLTSKEAKSRMTQIL 121

Query: 448 FETFNTPAMYVAIQAVLSLYASGRTT 525
           FETFN PA+Y A QAVLSL ASGRT+
Sbjct: 122 FETFNFPALYTANQAVLSLIASGRTS 147


>UniRef50_A0CQQ2 Cluster: Chromosome undetermined scaffold_24, whole
           genome shotgun sequence; n=7; Oligohymenophorea|Rep:
           Chromosome undetermined scaffold_24, whole genome
           shotgun sequence - Paramecium tetraurelia
          Length = 869

 Score =  187 bits (455), Expect = 3e-46
 Identities = 88/214 (41%), Positives = 133/214 (62%), Gaps = 4/214 (1%)
 Frame = +1

Query: 103 VVDNGSGMCKAGFAGDDAPRAVFPSIVG-RPRHQGVMVGMGQK---DSYVGDEAQSKRGI 270
           V+DNG+G  K G+AG+  P+   P++V      Q V +        D Y+G EA      
Sbjct: 16  VIDNGTGFTKMGWAGNTEPQFDIPTVVADHQEKQKVQMSKNTNENLDYYIGYEAYDYTKS 75

Query: 271 LTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMF 450
             + YP++ GIV NWD MEK WH + ++ LR  P+E   +LTE P+NP  NRE + +I F
Sbjct: 76  HNIFYPMKSGIVENWDLMEKFWHRSIFDYLRAEPDETTFILTEPPMNPPENRENIAEIFF 135

Query: 451 ETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRD 630
           ETFN   +++++QAVLSL+++G  TG+VLDSGDGV+H +P+ +GY +   I  + LAGRD
Sbjct: 136 ETFNAKGLHISVQAVLSLFSTG-LTGMVLDSGDGVTHCIPVADGYVIGSCIKHIPLAGRD 194

Query: 631 LTDYLMKILTERGYSFTTTAEREIVRDIKEKLCY 732
           +T ++  +L ERG +      +++ R++KEK  Y
Sbjct: 195 ITQFIQNLLKERGENIPAEDIKKVAREVKEKYGY 228


>UniRef50_P32392 Cluster: Actin-related protein 3; n=27;
           Eukaryota|Rep: Actin-related protein 3 - Drosophila
           melanogaster (Fruit fly)
          Length = 418

 Score =  186 bits (453), Expect = 6e-46
 Identities = 99/238 (41%), Positives = 137/238 (57%), Gaps = 16/238 (6%)
 Frame = +1

Query: 97  ALVVDNGSGMCKAGFAGDDAPRAVFPSI--------VGRPRHQGVMVGMGQKDSYVGDEA 252
           A V+D G+G  K GFAG+  P+ + PS         VG    + +  G+   D ++GDEA
Sbjct: 7   ACVIDVGTGYSKLGFAGNKEPQFIIPSAIAIKESARVGDTNTRRITKGIEDLDFFIGDEA 66

Query: 253 QSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK 432
               G  ++KYP+ HG+V +WD ME+      +  LR  PE+H  LLTE PLN   NRE 
Sbjct: 67  FDATGY-SIKYPVRHGLVEDWDLMERFLEQCVFKYLRAEPEDHYFLLTEPPLNTPENREY 125

Query: 433 MTQIMFETFNTPAMYVAIQAVLSLYAS-------GRT-TGIVLDSGDGVSHTVPIYEGYA 588
             +IMFETFN P +Y+A+QAVL+L AS        RT TGIV+DSGDGV+H +P+ EGY 
Sbjct: 126 TAEIMFETFNVPGLYIAVQAVLALAASWASRSAEERTLTGIVVDSGDGVTHVIPVAEGYV 185

Query: 589 LPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMA 762
           +   I  + +AGR++T ++  +L ER          E  + IKEK CY+  D  +E A
Sbjct: 186 IGSCIKHIPIAGRNITSFIQSLLREREVGIPPEQSLETAKAIKEKHCYICPDIAKEFA 243


>UniRef50_Q55DY5 Cluster: Putative uncharacterized protein; n=1;
           Dictyostelium discoideum AX4|Rep: Putative
           uncharacterized protein - Dictyostelium discoideum AX4
          Length = 355

 Score =  185 bits (451), Expect = 1e-45
 Identities = 96/230 (41%), Positives = 136/230 (59%), Gaps = 2/230 (0%)
 Frame = +1

Query: 100 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTL 279
           +++D GSG  K GF G+  P     +IVG P  QG          + G EA ++     L
Sbjct: 6   IIIDFGSGWTKCGFEGEVTPSVECLTIVGHPNKQG------DTKLFYGKEAVARFSTSKL 59

Query: 280 KYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETF 459
            YPI++GIV NW+DMEK   +TFY +LRV P+ H VLLTE  +N K NR KM +IMFET+
Sbjct: 60  VYPIKNGIVCNWEDMEKFIENTFYYKLRVEPQYHSVLLTETTMNTKENRNKMAEIMFETY 119

Query: 460 NTPAMYVAIQAVLSL--YASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDL 633
           + P++ +  Q  LS    ++G   G ++D GD   + VP  +G  +  A++ LD  GR+L
Sbjct: 120 DIPSIKIENQQKLSFDHLSTGTKNGTIVDMGDDSINIVPFVDGQPVTDAVVTLDFGGRNL 179

Query: 634 TDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSS 783
           T YL  +L + GYSF+T A+ +IVR IKEK  ++ LD+E+   T   S S
Sbjct: 180 TGYLAALLFQNGYSFSTVADHQIVRQIKEKHSFIELDYEKPSNTKKQSFS 229


>UniRef50_Q4SGD5 Cluster: Chromosome 17 SCAF14597, whole genome
           shotgun sequence; n=1; Tetraodon nigroviridis|Rep:
           Chromosome 17 SCAF14597, whole genome shotgun sequence -
           Tetraodon nigroviridis (Green puffer)
          Length = 425

 Score =  184 bits (448), Expect = 2e-45
 Identities = 88/186 (47%), Positives = 126/186 (67%), Gaps = 1/186 (0%)
 Frame = +1

Query: 100 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTL 279
           +V DNG+G  K G+AG + P  +FP++VGRP        + +  + VG+        + +
Sbjct: 9   VVCDNGTGFVKCGYAGSNFPEHIFPALVGRP--------IIRSTAKVGNIE------IKV 54

Query: 280 KYPIEHGIVTNWDDMEKIWHHTFYNE-LRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 456
            YP+E+GIV NWDDM+ +W +TF  E L +      +LLTE P+NP  NREK+ ++MFET
Sbjct: 55  NYPMENGIVRNWDDMKHLWDYTFGPEKLNIDSRNCKILLTEPPMNPTKNREKIIEVMFET 114

Query: 457 FNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 636
           +    +Y+AIQAVL+LYA G  TG+V+DSGDGV+H  P+YEG++LPH   RLD+AGRD+T
Sbjct: 115 YQFAGVYIAIQAVLTLYAQGLLTGVVVDSGDGVTHICPVYEGFSLPHLTRRLDIAGRDIT 174

Query: 637 DYLMKI 654
            YL+K+
Sbjct: 175 RYLIKV 180



 Score = 44.8 bits (101), Expect = 0.002
 Identities = 21/47 (44%), Positives = 31/47 (65%)
 Frame = +1

Query: 646 MKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL 786
           +++L  RGY+F  +A+ E VR +KEKLCYV  + EQE   A  ++ L
Sbjct: 225 VQLLLLRGYAFNHSADFETVRMMKEKLCYVGYNIEQEQKLALETTVL 271


>UniRef50_A2VD47 Cluster: Zgc:158823 protein; n=3; Eukaryota|Rep:
           Zgc:158823 protein - Danio rerio (Zebrafish)
           (Brachydanio rerio)
          Length = 334

 Score =  182 bits (444), Expect = 7e-45
 Identities = 94/234 (40%), Positives = 137/234 (58%), Gaps = 16/234 (6%)
 Frame = +1

Query: 103 VVDNGSGMCKAGFAGDDAPRAVFPSI--------VGRPRHQGVMVGMGQKDSYVGDEAQS 258
           V+D G+G  K G+AG+  P+ + P+         VG    + ++ G+   D ++GDEA  
Sbjct: 10  VIDCGTGYTKIGYAGNTEPQFIMPTCIAVRESASVGDQAQRRLVKGVDDLDFFIGDEAID 69

Query: 259 KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 438
           K    T K+PI HGI+ +WD MEK      +  LR  PE+H  L+TE PLN   NRE + 
Sbjct: 70  KPNYAT-KWPIRHGIIEDWDFMEKFMEQVIFKYLRAEPEDHNFLMTEPPLNTPENREYLA 128

Query: 439 QIMFETFNTPAMYVAIQAVLSLYAS-------GRT-TGIVLDSGDGVSHTVPIYEGYALP 594
           +IMFETFN P +Y+A+QAVL+L AS        RT TGIV+DSGDGV+H +P+ EG+ + 
Sbjct: 129 EIMFETFNVPGLYIAVQAVLALAASWTSRQVGERTLTGIVIDSGDGVTHAIPVAEGHVIG 188

Query: 595 HAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQE 756
             I  + +AGRD+T ++ ++L ER          E  + +KE+ CY+  D  +E
Sbjct: 189 SCIKHIPIAGRDITYFIQQLLREREIGIPPEQSLETAKAVKERYCYICPDIVKE 242


>UniRef50_A2ECQ8 Cluster: Actin family protein; n=1; Trichomonas
           vaginalis G3|Rep: Actin family protein - Trichomonas
           vaginalis G3
          Length = 371

 Score =  182 bits (442), Expect = 1e-44
 Identities = 87/223 (39%), Positives = 135/223 (60%)
 Frame = +1

Query: 88  EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRG 267
           ++  +V+DNG+   KAGFAG   P  + P++VG  +    MVG+  K  +VG+EA +K  
Sbjct: 3   DMKTIVIDNGTFSVKAGFAGTKKPHFIIPTVVGTAKENADMVGIKNKAYFVGNEALAKEN 62

Query: 268 ILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIM 447
           +L L  PIE+G+V NW+   ++W   F N+     E+  +L  E P   + N+ KM QI+
Sbjct: 63  LLNLVNPIENGVVQNWEFQTQLWDELFANQFHCPLEDVCILTGEKPACTQQNKAKMAQIL 122

Query: 448 FETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGR 627
           FE FN        Q+VLSL++ GR TG+V D+G+G+   VP+YEGY +PHAI+  +L G 
Sbjct: 123 FEKFNCGGFSSIQQSVLSLFSIGRRTGLVFDNGEGLGSIVPVYEGYTIPHAIIHTELCGS 182

Query: 628 DLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQE 756
            LT+ + +++T +  S T   + E  R +K+KL YV +D++ E
Sbjct: 183 FLTENMKRLITTKDPS-TAEWKLEEFRAMKDKLSYVPIDYQAE 224


>UniRef50_UPI0000F2DE11 Cluster: PREDICTED: similar to
           testis-specific actin-related protein 3; n=1;
           Monodelphis domestica|Rep: PREDICTED: similar to
           testis-specific actin-related protein 3 - Monodelphis
           domestica
          Length = 939

 Score =  179 bits (435), Expect = 8e-44
 Identities = 94/235 (40%), Positives = 143/235 (60%), Gaps = 1/235 (0%)
 Frame = +1

Query: 85  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSY-VGDEAQSK 261
           + +AA+V+D G+G  K G AG+D  RA+ P+ VGR  H   +   G K  Y + +EA++ 
Sbjct: 106 KNLAAVVIDTGTGYSKCGLAGEDRTRAIVPTRVGR--H---LNSEGDKTPYYITEEAEAA 160

Query: 262 RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQ 441
              L        G+VT+WD +E +W+H FY++L V P+E  VL+ ++P++P+ NREK+ +
Sbjct: 161 CSTLI------RGVVTDWDALEVLWNHIFYSKLCVEPQELAVLVADSPVSPRTNREKVVE 214

Query: 442 IMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLA 621
           ++FE F  PAM    QA+LSLYA GRTTG+V+ SG G S+  PI  G   P  + RLD+A
Sbjct: 215 LLFENFGVPAMQTVHQALLSLYAYGRTTGLVMGSGHGTSYVAPIITGELAPLNLYRLDVA 274

Query: 622 GRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL 786
           G+DL++YL ++L   G       + +++  +KE  CYV LD   E+    S + L
Sbjct: 275 GKDLSEYLSQLLLAGG---QPPPKIDVLTHMKETCCYVTLDMVSELCQLESKNRL 326


>UniRef50_P61158 Cluster: Actin-related protein 3; n=107;
           Eukaryota|Rep: Actin-related protein 3 - Homo sapiens
           (Human)
          Length = 418

 Score =  179 bits (435), Expect = 8e-44
 Identities = 98/236 (41%), Positives = 135/236 (57%), Gaps = 16/236 (6%)
 Frame = +1

Query: 97  ALVVDNGSGMCKAGFAGDDAPRAVFPSI--------VGRPRHQGVMVGMGQKDSYVGDEA 252
           A VVD G+G  K G+AG+  P+ + PS         VG    + VM G+   D ++GDEA
Sbjct: 7   ACVVDCGTGYTKLGYAGNTEPQFIIPSCIAIKESAKVGDQAQRRVMKGVDDLDFFIGDEA 66

Query: 253 QSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK 432
             K    T K+PI HGIV +WD ME+      +  LR  PE+H  LLTE PLN   NRE 
Sbjct: 67  IEKPTYAT-KWPIRHGIVEDWDLMERFMEQVIFKYLRAEPEDHYFLLTEPPLNTPENREY 125

Query: 433 MTQIMFETFNTPAMYVAIQAVLSLYAS-------GRT-TGIVLDSGDGVSHTVPIYEGYA 588
             +IMFE+FN P +Y+A+QAVL+L AS        RT TG V+DSGDGV+H +P+ EGY 
Sbjct: 126 TAEIMFESFNVPGLYIAVQAVLALAASWTSRQVGERTLTGTVIDSGDGVTHVIPVAEGYV 185

Query: 589 LPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQE 756
           +   I  + +AGRD+T ++ ++L +R          E  + +KE+  YV  D  +E
Sbjct: 186 IGSCIKHIPIAGRDITYFIQQLLRDREVGIPPEQSLETAKAVKERYSYVCPDLVKE 241


>UniRef50_Q14BL3 Cluster: RIKEN cDNA 4921517D21 gene; n=7;
            Eutheria|Rep: RIKEN cDNA 4921517D21 gene - Mus musculus
            (Mouse)
          Length = 1207

 Score =  178 bits (434), Expect = 1e-43
 Identities = 94/226 (41%), Positives = 136/226 (60%)
 Frame = +1

Query: 85   EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKR 264
            +++AA+V+D G+G  K G A ++   +V PS V   +H       GQ    V +  +   
Sbjct: 856  QKMAAIVIDTGTGFTKCGLAQENHVLSVVPSQVQMLQHPP----QGQPQYVVPEHQEGSY 911

Query: 265  GILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQI 444
             +L        G+V++WD +E +W H FY +L+V PEE  VL+ ++P++P+ NREK+ +I
Sbjct: 912  SVLN------RGVVSDWDALEVLWQHLFYCKLKVQPEEMAVLVADSPISPRTNREKVAEI 965

Query: 445  MFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAG 624
            +FE F+ PAM    QA+L+LYA GRTTG+V+ SG G S+  PI  G   P    RLD+AG
Sbjct: 966  LFERFHVPAMQTVHQALLTLYAYGRTTGLVVGSGHGTSYVAPIITGDLAPIDTYRLDVAG 1025

Query: 625  RDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMA 762
             DLTDYL ++L   G+S     +  I+R IKE  CYVA+D   EMA
Sbjct: 1026 ADLTDYLTQLLLSGGHSL---PKGGIIRQIKEACCYVAMDTATEMA 1068


>UniRef50_Q19R57 Cluster: Actin-like protein 1; n=2; Trypanosoma
           cruzi|Rep: Actin-like protein 1 - Trypanosoma cruzi
           strain CL Brener
          Length = 390

 Score =  175 bits (427), Expect = 8e-43
 Identities = 87/228 (38%), Positives = 137/228 (60%), Gaps = 8/228 (3%)
 Frame = +1

Query: 100 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQ--------KDSYVGDEAQ 255
           ++VD GS + KAG   +  P  +FP++VG P  +  ++   +            VG EA 
Sbjct: 2   IIVDFGSSLVKAGTVTESLPSLIFPAVVGVPAKKNGLLKRNKIALEEAPLAPFLVGAEAI 61

Query: 256 SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKM 435
            +    TL +PI HGIV +W  ME++ HHTF  E  +  EE  ++ TE    PK N E++
Sbjct: 62  HEMHRATLHHPIRHGIVKDWPRMEQVIHHTFV-EFGMNSEETSIVCTEPLFTPKRNSEQL 120

Query: 436 TQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLD 615
            +++FE F  P++ +    + +LY+SGRTTG+VLDSGDGV+   P+Y+ Y + +A  R +
Sbjct: 121 AEVLFEAFGVPSIALIPSGMCALYSSGRTTGVVLDSGDGVTQVTPVYDSYIIRNAASRFN 180

Query: 616 LAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEM 759
           L G ++T++L  +L ERG +FT+  +R  V+ IKE LCYV+ ++E E+
Sbjct: 181 LGGHEVTEHLRTLLFERGLNFTSPQDRLTVQSIKESLCYVSPNYEVEL 228


>UniRef50_Q383R8 Cluster: Actin-like protein, putative; n=4;
           Trypanosoma|Rep: Actin-like protein, putative -
           Trypanosoma brucei
          Length = 394

 Score =  174 bits (423), Expect = 2e-42
 Identities = 80/227 (35%), Positives = 139/227 (61%), Gaps = 2/227 (0%)
 Frame = +1

Query: 85  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQ--KDSYVGDEAQS 258
           ++   +V D GS   + GFAG++APR +  ++VG PR +G++  + Q   D Y GD A +
Sbjct: 3   QQQPVVVFDMGSNKTRVGFAGEEAPRVISSTVVGVPRQRGLVGSLMQHYSDDYAGDAACA 62

Query: 259 KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 438
           + G+L L YP+ +  +T+  ++E      FY+ L + P    +L  E+    + +RE++ 
Sbjct: 63  QEGMLNLSYPVRNRRITSMPEVEHFLQDVFYSRLPLVPSNTMMLWVESVRTSREDRERLC 122

Query: 439 QIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDL 618
           ++MFE+F  P + +   +  +++++GRTTG+V+DSG+G ++   ++EGY L +A    D+
Sbjct: 123 EMMFESFGLPQLGLVAASATTVFSTGRTTGLVVDSGEGCTNFNAVWEGYNLQYATHTSDV 182

Query: 619 AGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEM 759
           AGR LTD L+  L  +GY  +T  +R +V D+K  LCYVA D ++E+
Sbjct: 183 AGRVLTDRLLAFLRAKGYPLSTPNDRRVVEDVKHTLCYVAADVQEEV 229


>UniRef50_Q8IIQ4 Cluster: Actin, putative; n=7; Apicomplexa|Rep:
           Actin, putative - Plasmodium falciparum (isolate 3D7)
          Length = 392

 Score =  173 bits (421), Expect = 4e-42
 Identities = 86/219 (39%), Positives = 136/219 (62%)
 Frame = +1

Query: 88  EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRG 267
           E   +V+DNGSG  KAG    + P  VFP+IVG  ++         K  Y GDEA     
Sbjct: 2   ENKTIVIDNGSGYIKAGINSSEEPTIVFPTIVGIEKNDET------KRIYTGDEAFFHES 55

Query: 268 ILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIM 447
            L +  PI+HG +++WD  +K+W +T  N +  +     +LLTE PL   ++R+KM +I 
Sbjct: 56  NLNIYRPIDHGHISDWDKAQKVWDYTL-NCVDPSKSIKDILLTEPPLCSISHRKKMGEIF 114

Query: 448 FETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGR 627
           FE F+T  + +++  ++SLYASG TTG+VLD G+GV+  +P+++GY   ++I+R D  G 
Sbjct: 115 FEYFDTLNLNLSVSGLMSLYASGLTTGLVLDIGEGVTQCLPVFDGYIEKNSIIRSDFGGE 174

Query: 628 DLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALD 744
           +L+ +L K++ + GYS TTT   E V++IKE +C+ +L+
Sbjct: 175 ELSMFLQKLICDIGYSMTTTKSLEYVKNIKETICFCSLN 213


>UniRef50_UPI00005A3B5D Cluster: PREDICTED: similar to Actin-5C; n=3;
            Laurasiatheria|Rep: PREDICTED: similar to Actin-5C -
            Canis familiaris
          Length = 1248

 Score =  172 bits (419), Expect = 7e-42
 Identities = 95/227 (41%), Positives = 132/227 (58%), Gaps = 1/227 (0%)
 Frame = +1

Query: 85   EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKR 264
            +++AA+V+D G+G  K G A +D   +V PS V   +H         +  Y   E Q   
Sbjct: 897  QDMAAVVIDTGTGFTKCGLAREDHVLSVLPSRVQLLQHPAQ-----DEPRYAVPENQEG- 950

Query: 265  GILTLKYPI-EHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQ 441
                  YP+   G+V++WD +E +W H FY  L V PEE  VL+ ++P++P+ NREK+ +
Sbjct: 951  -----SYPVLNRGVVSDWDALEVLWQHLFYCRLGVRPEELAVLVADSPISPRTNREKVAE 1005

Query: 442  IMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLA 621
            I+FE F+ PAM    QA+L+LYA GRTTG+VL SG G S+  PI  G   P    RLD+A
Sbjct: 1006 ILFERFHVPAMQTVHQALLALYAYGRTTGLVLGSGYGTSYVAPILTGDLAPLDTYRLDVA 1065

Query: 622  GRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMA 762
            G DLT+YL ++L   GYS        +V  IKE  CYVA++   EMA
Sbjct: 1066 GVDLTEYLAQLLLAGGYSLPKAG---LVNQIKEGCCYVAMNMTAEMA 1109


>UniRef50_Q54UQ7 Cluster: Actin-like protein 6A; n=1; Dictyostelium
           discoideum AX4|Rep: Actin-like protein 6A -
           Dictyostelium discoideum AX4
          Length = 440

 Score =  169 bits (410), Expect = 9e-41
 Identities = 81/208 (38%), Positives = 135/208 (64%), Gaps = 14/208 (6%)
 Frame = +1

Query: 85  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRP-RHQGVMVGMGQKDSYVGDEAQSK 261
           ++V+A+V+D G+   K G+AG+D+P+AVFP+ +G   +++   VG G  +    D+++ K
Sbjct: 5   DDVSAIVIDVGTFSTKGGYAGEDSPKAVFPTDIGVVYKNENETVGTGDSEMGEKDDSEPK 64

Query: 262 R-------GI------LTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEA 402
           R       GI      + +  P+  G++ NWD ME+IW+HTFY  L + P EHP+LL E 
Sbjct: 65  RTYYCGTNGITYRRPHMEIINPLSDGLIKNWDAMEQIWNHTFYERLHINPIEHPILLAEP 124

Query: 403 PLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEG 582
             N +A REK+T+IMFE ++ PA+++A  AVLS +AS + + +VLDSG G++   P++EG
Sbjct: 125 TYNTRAIREKVTEIMFEKYHAPALFIAKNAVLSSFASSKASSLVLDSGGGMTSVTPVFEG 184

Query: 583 YALPHAILRLDLAGRDLTDYLMKILTER 666
           + + + I++ +LAG  LT+   +IL+ +
Sbjct: 185 FVVKNGIVKSNLAGNRLTEEYYRILSSK 212


>UniRef50_A2YUL5 Cluster: Putative uncharacterized protein; n=1;
           Oryza sativa (indica cultivar-group)|Rep: Putative
           uncharacterized protein - Oryza sativa subsp. indica
           (Rice)
          Length = 367

 Score =  168 bits (408), Expect = 2e-40
 Identities = 78/158 (49%), Positives = 105/158 (66%), Gaps = 2/158 (1%)
 Frame = +1

Query: 100 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRP--RHQGVMVGMGQKDSYVGDEAQSKRGIL 273
           +V DNG+G  K GFAG++ P +VFP +VGRP  R++  +      D  VG      R  L
Sbjct: 7   VVCDNGTGYVKCGFAGENFPTSVFPCVVGRPLLRYEESLQEQELTDIVVGAACADLRHQL 66

Query: 274 TLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFE 453
            + YP+ +GIV +WDDM  IW H FY+EL+V P E  +LLT+ PLNP  NREKM + MFE
Sbjct: 67  DVSYPVTNGIVQSWDDMGHIWDHAFYSELKVDPSECKILLTDPPLNPVKNREKMIETMFE 126

Query: 454 TFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTV 567
            +N   +++ +QAVLSLYA G  TG+V+DSGDGV+H +
Sbjct: 127 KYNFAGVFIQVQAVLSLYAQGLLTGLVIDSGDGVTHVI 164


>UniRef50_Q4N7N1 Cluster: Actin, putative; n=2; Theileria|Rep:
           Actin, putative - Theileria parva
          Length = 383

 Score =  165 bits (401), Expect = 1e-39
 Identities = 84/223 (37%), Positives = 133/223 (59%)
 Frame = +1

Query: 76  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 255
           M DE+   +V+DNGS   K G +G  +P  +  S+VG PR +        +D Y  ++  
Sbjct: 1   MADEQ--CVVIDNGSFSLKIGLSGSYSPSFIVHSVVGNPRPK--YKHNFTEDFYYAEDVY 56

Query: 256 SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKM 435
           S    ++L + I+HG ++++D ME +W + F   L V  +  PVLLTEAP     +R K 
Sbjct: 57  SSLEFMSLDHLIDHGHISDFDKMEGLWQYCF-TRLEVHSDCRPVLLTEAPFTSPKHRIKS 115

Query: 436 TQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLD 615
           ++I FE FN   + +++  +LS+Y  G+ TG V++ GDGV+  +P+ EGY+   +I R+D
Sbjct: 116 SEIFFERFNVDDLNISVAGLLSMYGLGKLTGTVVEVGDGVTQVLPVIEGYSERSSIKRVD 175

Query: 616 LAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALD 744
             G +LT YL K+L  RGY  T+  + E+VR++KEK C+ +LD
Sbjct: 176 FGGIELTMYLQKMLCTRGYCLTSRPDFELVRELKEKYCFCSLD 218


>UniRef50_UPI0000D9A391 Cluster: PREDICTED: actin related protein M1
           isoform 1; n=1; Macaca mulatta|Rep: PREDICTED: actin
           related protein M1 isoform 1 - Macaca mulatta
          Length = 319

 Score =  162 bits (393), Expect = 1e-38
 Identities = 72/152 (47%), Positives = 107/152 (70%)
 Frame = +1

Query: 100 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTL 279
           +V+DNGSG+ KAG AG   P+ ++P+I+GR + Q      G  +  VGD+AQ  R  L++
Sbjct: 71  VVIDNGSGVIKAGLAGSREPQFIYPNIIGRAKGQS-RAAPGGLELCVGDQAQDWRSSLSI 129

Query: 280 KYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETF 459
            YP+E G++T+WDDME +W H +   L++ P + PVL+TE  LNP ANR+++ ++ FE  
Sbjct: 130 SYPVERGLITSWDDMEIMWKHIYDYNLKLKPCDGPVLITEPALNPLANRQQIVEVFFEHL 189

Query: 460 NTPAMYVAIQAVLSLYASGRTTGIVLDSGDGV 555
             PA Y++IQAVL+L+A+G TTG+VLDSG G+
Sbjct: 190 GVPAFYMSIQAVLALFAAGFTTGLVLDSGAGI 221


>UniRef50_A2DNQ0 Cluster: Actin family protein; n=1; Trichomonas
           vaginalis G3|Rep: Actin family protein - Trichomonas
           vaginalis G3
          Length = 358

 Score =  162 bits (393), Expect = 1e-38
 Identities = 81/215 (37%), Positives = 132/215 (61%)
 Frame = +1

Query: 100 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTL 279
           +V+D G  + KAGF GD  P  VFPS  G    + +  G   K  Y+     SK G  T 
Sbjct: 6   IVLDCGGSIIKAGFGGDSEPGIVFPS-TGPKLKKDIESGFDDK-RYI-----SKFGP-TF 57

Query: 280 KYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETF 459
           + PIE+ ++TN+D+M++IW   F  +L++ PE+HP L+ ++ LN   NR++  QI  E +
Sbjct: 58  RSPIENRVITNFDNMKRIWQELFTEQLQIQPEQHPFLVADSALNSLENRQQTLQIFMEEY 117

Query: 460 NTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTD 639
           N P+   A  + L+LY +G T+GIV+DSG+  +  +P++E + L H + RLD+ G+ +++
Sbjct: 118 NVPSFCPAFASSLALYNAGYTSGIVVDSGESNTDIIPVFECFTLTHLVSRLDVGGKHVSE 177

Query: 640 YLMKILTERGYSFTTTAEREIVRDIKEKLCYVALD 744
           YL K+L ++G       EREI+R++KE++ +V  D
Sbjct: 178 YLKKLLNQQGIVLPGPTEREILREVKEQIGFVRGD 212


>UniRef50_Q8LKR2 Cluster: Actin-related protein 4; n=7; core
           eudicotyledons|Rep: Actin-related protein 4 -
           Arabidopsis thaliana (Mouse-ear cress)
          Length = 442

 Score =  161 bits (392), Expect = 1e-38
 Identities = 87/217 (40%), Positives = 128/217 (58%), Gaps = 22/217 (10%)
 Frame = +1

Query: 85  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVM--------VGMGQKDS-- 234
           +EV+A+VVD GS  CKAG+AG+DAP+AVFPS++G       M             +DS  
Sbjct: 6   DEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSVIGAVDGVEAMDVDVDSTKTNSNSEDSKT 65

Query: 235 -----------YVGDEAQS-KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEE 378
                      YVG +A S +R  + +  PI+ GIV++WD ++ IW H F + L + P E
Sbjct: 66  ESEKEKSKRKLYVGSQAMSYRRDHMEVLSPIKDGIVSDWDLVDNIWEHAFKSCLMIDPTE 125

Query: 379 HPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVS 558
           HP+LL E PLN +  REK  ++MFE +  PA+++A   VL+ +A+GR T +V+D G G +
Sbjct: 126 HPMLLAEPPLNTQQQREKAAELMFEKYKVPALFMAKNPVLTSFATGRATSLVVDCGGGST 185

Query: 559 HTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 669
              P+++GY L  A++   L G  LTD L+K L  +G
Sbjct: 186 TISPVHDGYVLQKAVVSSPLGGEFLTDCLLKSLESKG 222


>UniRef50_UPI0000E23780 Cluster: PREDICTED: hypothetical protein
           isoform 2; n=2; Amniota|Rep: PREDICTED: hypothetical
           protein isoform 2 - Pan troglodytes
          Length = 179

 Score =  161 bits (390), Expect = 2e-38
 Identities = 81/178 (45%), Positives = 104/178 (58%)
 Frame = -3

Query: 597 VGECVSFVDGHGVGDTVAGVQHDTGGTTGRVQREHGLDGDVHGGRVECFEHDXXXXXXXX 418
           +GE +  +DGH VGD V  V H+   T   VQ +HGLDG VHG  VE  +HD        
Sbjct: 1   MGEGIPLIDGHSVGDPVTRVHHNASSTARGVQGQHGLDGHVHGWGVEGLKHDLGHLLVVG 60

Query: 417 XXXXXXXXEQDWVFLGGDTQLIVEGMMPNLLHVIPVSDDSVFDGVFEGQDTSFALCLISY 238
                   +QD V LG  TQL+VEG++P+LLHV+PV DD+V  GV +GQD S AL LI++
Sbjct: 61  LGVQGCLGQQDGVLLGSHTQLVVEGVVPDLLHVVPVGDDAVLHGVLQGQDASLALGLIAH 120

Query: 237 IRVLLSHTDHHALMAGPSHDRGEHGARSIISCETGLAHTGAIVYYQRGNFFVAHLELV 64
           I + L H  HHAL+ G  HD  E     II+C+ GLAH  A+V    G   + H EL+
Sbjct: 121 IGLHLMHAPHHALVPGAPHDGREDSPGGIITCKAGLAHARAVVNDGHGGIII-HGELI 177


>UniRef50_UPI0000449ED3 Cluster: PREDICTED: similar to RIKEN cDNA
           4921517D21 gene; n=2; Gallus gallus|Rep: PREDICTED:
           similar to RIKEN cDNA 4921517D21 gene - Gallus gallus
          Length = 321

 Score =  155 bits (376), Expect = 1e-36
 Identities = 73/147 (49%), Positives = 98/147 (66%)
 Frame = +1

Query: 289 IEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTP 468
           + HG+VT+WD +E++WH  FY+EL V PEE  VL T+APL+P  NREKM +++FE F  P
Sbjct: 48  LTHGVVTDWDRLEELWHRIFYHELAVCPEELAVLATDAPLSPIINREKMAELLFEGFGVP 107

Query: 469 AMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLM 648
           A+ V  + VL+ Y+ G TTG+VL SG G S+ V + +GY LPHA  RLDLAG DLT YL 
Sbjct: 108 AVLVMPRPVLATYSYGCTTGVVLGSGAGTSYVVAVQDGYVLPHASFRLDLAGNDLTAYLS 167

Query: 649 KILTERGYSFTTTAEREIVRDIKEKLC 729
           ++L  R          E ++ +KEK C
Sbjct: 168 QMLAARRVQLPA----ETLQHLKEKCC 190


>UniRef50_UPI00005A2ACF Cluster: PREDICTED: similar to cytoplasmic
           beta-actin; n=1; Canis lupus familiaris|Rep: PREDICTED:
           similar to cytoplasmic beta-actin - Canis familiaris
          Length = 268

 Score =  154 bits (373), Expect = 3e-36
 Identities = 78/112 (69%), Positives = 87/112 (77%)
 Frame = +1

Query: 205 VMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHP 384
           +MVGMGQKDSY+ +EAQ K GILT KY IEHGIV NWDDME I HH FYN+L +APEE  
Sbjct: 97  IMVGMGQKDSYIRNEAQRKWGILTFKYCIEHGIVINWDDME-IQHHNFYNKLCMAPEELY 155

Query: 385 VLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLD 540
           +LLTE PLN KA  E MTQIMFETFNTPAMY+AIQ VL LYA     G+ +D
Sbjct: 156 ILLTEIPLNLKAKGE-MTQIMFETFNTPAMYLAIQTVLFLYAVVTPLGVTMD 206


>UniRef50_Q4Q187 Cluster: Actin-like protein, putative; n=3;
           Leishmania|Rep: Actin-like protein, putative -
           Leishmania major
          Length = 407

 Score =  152 bits (369), Expect = 8e-36
 Identities = 82/233 (35%), Positives = 125/233 (53%), Gaps = 2/233 (0%)
 Frame = +1

Query: 91  VAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQK--DSYVGDEAQSKR 264
           + ++VVD G+   + GF+G++APR +  S VG P  +     + Q   D   GD A +  
Sbjct: 8   IQSVVVDVGTRNTRVGFSGEEAPRTMLRSCVGLPGTRRPRPTLLQHPFDIATGDAAYNDG 67

Query: 265 GILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQI 444
           G+L+L YP+  G V ++D +EK+  +    E RV P+  P L        + +RE++ ++
Sbjct: 68  GLLSLTYPVRAGHVCDYDALEKLLFYALVEEARVTPDTSPFLFLVPADQTRLDRERLCEL 127

Query: 445 MFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAG 624
           +FE+FN P   +      +LY+SGRT G+ LDSG G +    + EGY L H++    LAG
Sbjct: 128 LFESFNIPLAGLLTNTAATLYSSGRTRGLALDSGAGRTCVAAVEEGYTLAHSVRSSSLAG 187

Query: 625 RDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSS 783
             LTD L   L   GY  +T A+R +V   KE LC V+ D + E A    + S
Sbjct: 188 EALTDELFAALRAGGYPLSTAADRGVVEAAKEALCRVSADAKDEEARQVGTHS 240


>UniRef50_UPI0000EC9F4D Cluster: HSD21.; n=2; Gallus gallus|Rep:
           HSD21. - Gallus gallus
          Length = 373

 Score =  150 bits (364), Expect = 3e-35
 Identities = 81/230 (35%), Positives = 131/230 (56%), Gaps = 1/230 (0%)
 Frame = +1

Query: 100 LVVDNGSGMCKAGFAGDDAPRAVFPSIVG-RPRHQGVMVGMGQKDSYVGDEAQSKRGILT 276
           +V+D G+  C+AGF+G  +P A   ++VG R   +G   G+      +G+EA     I T
Sbjct: 15  IVIDMGTRSCRAGFSGHYSPSAEVSTLVGHRMGSEGASAGV-----IIGEEALLYSDIET 69

Query: 277 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 456
           ++  + +G + NW+  E + ++   +ELRV PE+H +LLTE   +P ++RE M ++ FE 
Sbjct: 70  MEV-MHNGFIINWEAAENLCYYLLKHELRVNPEDHALLLTEPLFSPTSSRENMAEMAFEV 128

Query: 457 FNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 636
             TP ++VA Q VLS Y  G+ + +VLD G   +  VP+ EG ++  +  + D+AGR LT
Sbjct: 129 LGTPGLFVAPQPVLSAYTHGKISALVLDMGHAATRVVPVLEGRSMACSSKQTDVAGRCLT 188

Query: 637 DYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL 786
            YL  +L + G+   +     +V DIK   CY+A DF+ E     SS ++
Sbjct: 189 WYLSTLLEDTGH-VLSKGMSHMVEDIKRACCYIAEDFQSECLLPPSSHTM 237


>UniRef50_Q7M3Y6 Cluster: Actin homolog fat, testicular; n=3;
           Deuterostomia|Rep: Actin homolog fat, testicular -
           Pisaster ochraceus (Sea star)
          Length = 155

 Score =  150 bits (364), Expect = 3e-35
 Identities = 72/75 (96%), Positives = 72/75 (96%)
 Frame = +1

Query: 400 APLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYE 579
           APLNPKANREKMTQIMFETFNTPAMYV IQAVLSLYASGRTTGIVLDSGDGVSHTVPIYE
Sbjct: 1   APLNPKANREKMTQIMFETFNTPAMYVGIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYE 60

Query: 580 GYALPHAILRLDLAG 624
           GYALPHAILRL L G
Sbjct: 61  GYALPHAILRLILLG 75


>UniRef50_Q963K1 Cluster: Actin-3; n=1; Cercomonas sp. ATCC
           50318|Rep: Actin-3 - Cercomonas sp. ATCC 50318
          Length = 266

 Score =  147 bits (356), Expect = 3e-34
 Identities = 67/101 (66%), Positives = 90/101 (89%), Gaps = 1/101 (0%)
 Frame = +1

Query: 457 FNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 636
           FNTPA++++  A+L+LY+SGRTTG+VLDSGDG+++TVPIY+GYA+P A LR+DL+G D+T
Sbjct: 2   FNTPAVHISNSAMLALYSSGRTTGVVLDSGDGITYTVPIYDGYAIPQATLRMDLSGCDIT 61

Query: 637 DYLMKILTERG-YSFTTTAEREIVRDIKEKLCYVALDFEQE 756
           D+LM+++T RG +SFTT++EREIVRDIKEKL  VALDF  E
Sbjct: 62  DHLMELITARGHHSFTTSSEREIVRDIKEKLGRVALDFADE 102


>UniRef50_UPI0000499930 Cluster: actin; n=1; Entamoeba histolytica
           HM-1:IMSS|Rep: actin - Entamoeba histolytica HM-1:IMSS
          Length = 372

 Score =  147 bits (355), Expect = 4e-34
 Identities = 78/216 (36%), Positives = 129/216 (59%), Gaps = 1/216 (0%)
 Frame = +1

Query: 100 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTL 279
           +V+D GS  C+ G AG+  P  +FPS VG PR +  +    + D YVG   + ++    +
Sbjct: 5   IVLDFGSQTCRVGNAGESMPTNIFPSYVGIPREKSQL----KPDFYVGKILKEQKREFQI 60

Query: 280 KYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETF 459
           K PI++G + +      ++ +   +E +   +  P+L TE  LNPK  REK  Q++FE F
Sbjct: 61  KSPIKNGTIEDISMASALFKNAL-DECQGYGK--PILFTEPALNPKQIREKTIQLLFERF 117

Query: 460 NTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTD 639
             P++Y +IQ +LSL+AS +T G+V+DSG  ++  +PIYEGY +   + +  +AG DL +
Sbjct: 118 KVPSVYFSIQPILSLFASEKTDGLVIDSGADITQIIPIYEGYVISSCVHKQYVAGNDLLE 177

Query: 640 YLMKILTE-RGYSFTTTAEREIVRDIKEKLCYVALD 744
           YL+  ++E R  + +T A +E++ +  +K C VALD
Sbjct: 178 YLVSTISEKRDVNLSTAAAKEVLENQVKKDCLVALD 213


>UniRef50_UPI0000F2D272 Cluster: PREDICTED: similar to actin; n=1;
           Monodelphis domestica|Rep: PREDICTED: similar to actin -
           Monodelphis domestica
          Length = 790

 Score =  143 bits (346), Expect = 5e-33
 Identities = 81/225 (36%), Positives = 124/225 (55%), Gaps = 9/225 (4%)
 Frame = +1

Query: 88  EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQ--------GVMVGMGQK-DSYV 240
           E +++V+D GS  CKAG A ++ P    PS+VG   ++         ++     K    V
Sbjct: 68  ESSSVVIDIGSAWCKAGLAMENYPTLAVPSVVGYQFYEEEVKVYSPNILKACPPKIRKVV 127

Query: 241 GDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 420
           G E   +   +  ++ I+ G V NWD ME IW+++F + L +  + HPVL+TE P N + 
Sbjct: 128 GLEKMRELKEMPNQFAIDRGRVLNWDAMEDIWYYSF-DYLGIKTKNHPVLITEFPRNDEN 186

Query: 421 NREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHA 600
            R+K  +IM ETFN P++++  QA LSL+ SG  +GIVLD G  ++H  PI  G  +P  
Sbjct: 187 YRQKTLEIMMETFNVPSLHIGNQAELSLFGSGLLSGIVLDCGADLTHIAPIMGGRMIPEC 246

Query: 601 ILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYV 735
            L  ++ G D+  YL   +     +     +RE + D+KEKLCYV
Sbjct: 247 TLIHEIGGIDINIYLYDSIFSDTMTRYCLIKREAMDDLKEKLCYV 291



 Score =  120 bits (290), Expect = 3e-26
 Identities = 74/237 (31%), Positives = 122/237 (51%), Gaps = 5/237 (2%)
 Frame = +1

Query: 88   EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQG---VMVGMGQKDSYV--GDEA 252
            E + LVVD GS  CKAG+ G+  P  + PS+VG    +G   +  G  +  + +  G + 
Sbjct: 423  ERSCLVVDIGSACCKAGWCGEKFPPIIVPSVVGYSPLEGNPSLRPGPSRSQAKLLTGSKN 482

Query: 253  QSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK 432
                  L  ++ I  G +TNW+ ME IW + F  EL     +HP+L+T  P+N +   + 
Sbjct: 483  LPIMRDLRTEFVINRGTITNWEAMESIWRYIF-GELNSGSMDHPLLITGLPMNDEYCLQL 541

Query: 433  MTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL 612
            +T++    FN+  ++         + S +T   +LD G G++   PI  G  +P   L  
Sbjct: 542  VTELF--AFNSSFLFEPFLFDNGKHLS-KTNQPILDCGAGLTRIAPILGGQMIPEFTLIF 598

Query: 613  DLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSS 783
            +L G D++  L K LT R    +   +RE + D+KEKLCYV+ +  Q+ ++ + +SS
Sbjct: 599  ELGGLDISSLLYKSLTNRSGDLSNLVQREAMEDLKEKLCYVSKNPHQKESSKSFTSS 655


>UniRef50_Q4QF44 Cluster: Actin-related protein 3, putative; n=3;
           Leishmania|Rep: Actin-related protein 3, putative -
           Leishmania major
          Length = 405

 Score =  138 bits (335), Expect = 1e-31
 Identities = 83/232 (35%), Positives = 118/232 (50%), Gaps = 4/232 (1%)
 Frame = +1

Query: 94  AALVVDNGSGMCKAGFAGDDAPRAVFPSIVG-RPRHQGVMVGMGQKDS-YVGDEAQSKRG 267
           + +V D G+   + G+AG+  P    P++   R R       +G   +  VG   Q +R 
Sbjct: 9   SVVVCDVGTSTTRLGYAGNAEPTFALPTVCAWRDRMSAETFAVGDAAATMVGPGVQQRR- 67

Query: 268 ILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIM 447
                 P+EHG+V NWD ME+ W H F   L V P++  VLLTEA + P   RE   +IM
Sbjct: 68  ------PLEHGLVVNWDVMEEYWCHLFNRYLCVEPQDVGVLLTEAAVTPYEQREMTAEIM 121

Query: 448 FETFNTPAMYVAIQA--VLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLA 621
           FE+F  P + +  QA  VLS    G  T +V++SG GV+  VPI  GYA+  A  R  +A
Sbjct: 122 FESFGVPRLCIGSQALFVLSSVGDGCDTAVVVESGAGVTQVVPIVAGYAVSGAARRFPVA 181

Query: 622 GRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASS 777
           G D+T Y++K L E           E+   +K +  Y A D   E+A A S+
Sbjct: 182 GWDITQYVLKSLREHERGIEAERALEVAERVKTRYGYTADDIACELARAESN 233


>UniRef50_UPI00015B6274 Cluster: PREDICTED: similar to putative mRNA
           splicing factor; n=1; Nasonia vitripennis|Rep:
           PREDICTED: similar to putative mRNA splicing factor -
           Nasonia vitripennis
          Length = 515

 Score =  138 bits (334), Expect = 1e-31
 Identities = 74/182 (40%), Positives = 106/182 (58%), Gaps = 11/182 (6%)
 Frame = -3

Query: 588 CVSFVDG-HGVGDTVAGVQHDTGGTTGRVQREHGLDGDVHGGRVECFEHDXXXXXXXXXX 412
           CV +    H V + +A V+HD GG    ++R+  L+  VH  RVE  EHD          
Sbjct: 329 CVEYTKNTHSVRNAIATVEHDAGGPARCIERQDSLNSYVHSRRVERLEHDLRHLLSVGLR 388

Query: 411 XXXXXXEQDWVFLGGDTQLIVEGMMPNLLHVIPVSDDSVFDGVFEGQDTSFALCLISYIR 232
                 E++ +FL GD QL+VEG+MP+LLHVIPV D SV D +F  +DT+  L L++Y+ 
Sbjct: 389 VERSLGEENGMFLWGDAQLVVEGVMPDLLHVIPVGDYSVLDRIFNREDTALGLGLVAYVG 448

Query: 231 VLLSHTDHHA----------LMAGPSHDRGEHGARSIISCETGLAHTGAIVYYQRGNFFV 82
           VLL+H DH A          L+AGP+ D  + G+R +++ ET LAH+ +IV ++ G   V
Sbjct: 449 VLLAHADHDALWIKSMVDTHLIAGPADDGWKDGSRRVVAGETSLAHSRSIVNHESGYVVV 508

Query: 81  AH 76
           AH
Sbjct: 509 AH 510


>UniRef50_Q9H568 Cluster: Actin-like protein 8; n=10; Eutheria|Rep:
           Actin-like protein 8 - Homo sapiens (Human)
          Length = 366

 Score =  138 bits (334), Expect = 1e-31
 Identities = 82/235 (34%), Positives = 127/235 (54%), Gaps = 7/235 (2%)
 Frame = +1

Query: 100 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGR-PRHQGVMVGMGQKDSYVGDEAQSKRGILT 276
           +++D+GSG  KAG AG + P+ VFP+IV   P  +       ++   +G +        T
Sbjct: 6   VIIDHGSGFLKAGTAGWNEPQMVFPNIVNYLPCKENPGPSYARRRVSLGIDICHPD---T 62

Query: 277 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 456
             YPIE G + NW+ ++ +W     N  R   E  PV++TE PL   A+R+KM +I+FE 
Sbjct: 63  FSYPIERGRILNWEGVQYLWSFVLENHRR-EQEVPPVIITETPLREPADRKKMLEILFEL 121

Query: 457 FNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 636
            + P++ +A Q  +SLYASG  TG+V+DSG G++   P ++G  LP +   L+ AG+DL+
Sbjct: 122 LHVPSVLLADQLQMSLYASGLLTGVVVDSGYGLTRVQPFHQGRPLPASGKTLEFAGQDLS 181

Query: 637 DYLMKILTERGYSFTTTAEREIVRDIKEKLCYV------ALDFEQEMATAASSSS 783
            YL+K L +         + E V   +   CYV      ALDF +   +A   S+
Sbjct: 182 AYLLKSLFKEDCDRRCLFQLETVAVTQMNKCYVPQNLGEALDFRERQQSALDESN 236


>UniRef50_Q6BG23 Cluster: Actin, putative; n=1; Paramecium
           tetraurelia|Rep: Actin, putative - Paramecium
           tetraurelia
          Length = 328

 Score =  138 bits (333), Expect = 2e-31
 Identities = 67/161 (41%), Positives = 98/161 (60%)
 Frame = +1

Query: 277 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 456
           +KYPI +  + ++D ME +WH  F+  L   PE+  +L+T      K  +EK TQIMFET
Sbjct: 21  IKYPILNSKIVDFDTMETVWHKAFFEYLMTNPEDSSILITSQLNTSKNEKEKTTQIMFET 80

Query: 457 FNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 636
           FN     + IQ++LSL++SG+TTG V+DSG+  ++ VPIYEGY L       ++AG+  +
Sbjct: 81  FNISKFIIQIQSILSLFSSGKTTGFVVDSGNDTTYFVPIYEGYKLDIKDNFCNIAGKSCS 140

Query: 637 DYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEM 759
            YL  ++T+           EI+  IKEK CY+ LD EQE+
Sbjct: 141 TYLNHLITQSNQK--RVGNLEILDYIKEKYCYITLDKEQEL 179


>UniRef50_Q19R56 Cluster: Actin-like protein 3; n=4; Trypanosoma
           cruzi|Rep: Actin-like protein 3 - Trypanosoma cruzi
           strain CL Brener
          Length = 426

 Score =  132 bits (320), Expect(2) = 6e-31
 Identities = 76/198 (38%), Positives = 110/198 (55%), Gaps = 1/198 (0%)
 Frame = +1

Query: 94  AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVM-VGMGQKDSYVGDEAQSKRGI 270
           + +V+D GSG  KA F+   AP + FPS+ GR +++ +     G     VG +A  +RG+
Sbjct: 3   STIVLDAGSGSVKAAFSSATAPTS-FPSLAGRVKYKPLFQTSHGCDVVSVGKDAAERRGL 61

Query: 271 LTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMF 450
           L L YPI+HGI+ NWD  + +       +L  +  E  V   E P + +  R ++ QI+F
Sbjct: 62  LHLTYPIQHGIIVNWDVWQLLLQQ-IEQQLDASLAEKSVFWVEHPFSSRPQRARVAQILF 120

Query: 451 ETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRD 630
           E      M V I  +LSLYA+G TTGIVLD G+GVS      +GYA+   + R D  G  
Sbjct: 121 EEKGIFGMCVGIAPLLSLYATGETTGIVLDVGEGVSSVAAAVQGYAVTGMMQREDFGGGA 180

Query: 631 LTDYLMKILTERGYSFTT 684
           +T YL ++L E G S+ T
Sbjct: 181 VTQYLQRLLREYG-SYNT 197



 Score = 24.6 bits (51), Expect(2) = 6e-31
 Identities = 10/17 (58%), Positives = 13/17 (76%)
 Frame = +1

Query: 688 AEREIVRDIKEKLCYVA 738
           AERE+ R IKE+ C V+
Sbjct: 230 AERELARSIKEQRCEVS 246


>UniRef50_O96019 Cluster: Actin-like protein 6A; n=63;
           Eumetazoa|Rep: Actin-like protein 6A - Homo sapiens
           (Human)
          Length = 429

 Score =  136 bits (328), Expect = 8e-31
 Identities = 78/223 (34%), Positives = 125/223 (56%), Gaps = 14/223 (6%)
 Frame = +1

Query: 85  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGR--PRHQG--VMVGMGQKDS------ 234
           +EV ALV D GS   +AG+AG+D P+  FP+ +G    R  G  +M   G K        
Sbjct: 9   DEVGALVFDIGSYTVRAGYAGEDCPKVDFPTAIGMVVERDDGSTLMEIDGDKGKQGGPTY 68

Query: 235 YVGDEA-QSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLN 411
           Y+   A +  R  +    P+++G+V +WD  + I  HT+   ++     HPVL++EAP N
Sbjct: 69  YIDTNALRVPRENMEAISPLKNGMVEDWDSFQAILDHTYKMHVKSEASLHPVLMSEAPWN 128

Query: 412 PKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYAL 591
            +A REK+T++MFE +N PA ++   AVL+ +A+GR+TG++LDSG   +  +P+++GY L
Sbjct: 129 TRAKREKLTELMFEHYNIPAFFLCKTAVLTAFANGRSTGLILDSGATHTTAIPVHDGYVL 188

Query: 592 PHAILRLDLAGRDLTDYLMKILTERGYSFT---TTAEREIVRD 711
              I++  LAG  +T    ++  E           A +E VR+
Sbjct: 189 QQGIVKSPLAGDFITMQCRELFQEMNIELVPPYMIASKEAVRE 231


>UniRef50_A2DEE0 Cluster: Actin family protein; n=1; Trichomonas
           vaginalis G3|Rep: Actin family protein - Trichomonas
           vaginalis G3
          Length = 378

 Score =  135 bits (326), Expect = 1e-30
 Identities = 72/218 (33%), Positives = 121/218 (55%), Gaps = 2/218 (0%)
 Frame = +1

Query: 88  EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQK-DSYVGDEAQSKR 264
           ++  +V+D GS   K G +GDD PR    S+ G  +   +    G   D +VG EA  K 
Sbjct: 13  QMKVVVIDLGSDRIKVGISGDDIPRHFVKSVFGTLKTFDIK---GHNIDFFVGQEAIEKS 69

Query: 265 GILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLN-PKANREKMTQ 441
              +L  P ++G +TN DD+E+++H+ F  E+ + PE+  V+++  PLN P++ R  + +
Sbjct: 70  DPNSLYNPFKNGYITNPDDIERLFHYIFEKEIHINPEKKSVIIS-TPLNGPQSQRNIIAE 128

Query: 442 IMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLA 621
           I+FE +   +++++    L +Y + R TG V+D G+  +    IY+   +P A +  D+A
Sbjct: 129 ILFEKYKIGSLHISTPNTLGMYTTSRFTGTVVDCGESFTEIASIYDMLTVPQASIVSDIA 188

Query: 622 GRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYV 735
           G  LT  L KI+ +  Y F     +E VR++KEK C V
Sbjct: 189 GSTLTTQLQKIVKDSNYLFARANGKEHVRELKEKTCLV 226


>UniRef50_UPI00004987CF Cluster: actin; n=2; Entamoeba histolytica
            HM-1:IMSS|Rep: actin - Entamoeba histolytica HM-1:IMSS
          Length = 876

 Score =  134 bits (325), Expect = 2e-30
 Identities = 80/235 (34%), Positives = 128/235 (54%), Gaps = 2/235 (0%)
 Frame = +1

Query: 73   KMCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVG-DE 249
            K+ D+  A LV D GS   K G AG++ PR V P+       +    G  ++  Y   DE
Sbjct: 512  KIADD--AVLVFDCGSSFIKVGVAGEEQPRKVIPTCYCTIEDEDYEGGERKEFGYKAIDE 569

Query: 250  AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVA-PEEHPVLLTEAPLNPKANR 426
             +       L +P++    T+WD +  I  + + NEL    P  HPV++TE P   +   
Sbjct: 570  DEG------LVWPLDPRKDTDWDGLLAIIQNIYENELDGCDPASHPVVMTELPNMNEVAT 623

Query: 427  EKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAIL 606
            +K+  +MF   N P + +   A+++LYA G+ TG+V++ G+ +   VP  +GY +  AI 
Sbjct: 624  DKIKSMMFNDLNVPFLKIVNPALMALYAEGKETGVVVEIGNRMQ-IVPAVDGYVIDSAIT 682

Query: 607  RLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAA 771
            ++      LT+Y+ ++L   GY +TT+A+ E+VR IKE +CYVALD++ EM   A
Sbjct: 683  KIKGNVSGLTEYMSRLLRACGYIYTTSAQMELVRAIKESVCYVALDYDAEMKKKA 737


>UniRef50_Q6FRF2 Cluster: Similar to sp|P38696 Saccharomyces
           cerevisiae YHR129c ACT5; n=1; Candida glabrata|Rep:
           Similar to sp|P38696 Saccharomyces cerevisiae YHR129c
           ACT5 - Candida glabrata (Yeast) (Torulopsis glabrata)
          Length = 387

 Score =  133 bits (322), Expect = 4e-30
 Identities = 67/222 (30%), Positives = 117/222 (52%), Gaps = 2/222 (0%)
 Frame = +1

Query: 100 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTL 279
           +++DNGS + KAGFAG   P  +  + +G P  +  MV +  K++Y+G+ A  +R  L L
Sbjct: 13  VILDNGSSVIKAGFAGSQQPDVLEYAWIGNPLAERSMVTVSNKETYIGNSAYERRATLHL 72

Query: 280 KYPIEHGIVTNWDDMEKIWHHTFYNELRVAP-EEHPVLLTEAPLNPKANREKMTQIMFET 456
           + P     + +WD +E +W +   N+L +   +EHPV+LT +    K   EKM +++FE 
Sbjct: 73  ESPYSTNAIMSWDRLEDLWDYVLLNKLEIEQLQEHPVVLTNSMSTSKKEEEKMCEVLFEK 132

Query: 457 FNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 636
           F+ PA+Y +   ++SLY  GRTTG  +  G        + +G  +  +    +  G  +T
Sbjct: 133 FSIPAIYCSRDPIMSLYGLGRTTGCSVSCGHRGIGITTVIDGMIVGGSSQISNTGGSAVT 192

Query: 637 DYLMKILTERGYSFTTTAER-EIVRDIKEKLCYVALDFEQEM 759
           + ++ +L              E++R IKE+ C ++ DF  E+
Sbjct: 193 NTMLDLLRHNHPKLENGQNGIELIRSIKERCCVLSKDFYNEI 234


>UniRef50_A2YQV6 Cluster: Putative uncharacterized protein; n=1;
           Oryza sativa (indica cultivar-group)|Rep: Putative
           uncharacterized protein - Oryza sativa subsp. indica
           (Rice)
          Length = 581

 Score =  132 bits (320), Expect = 7e-30
 Identities = 71/193 (36%), Positives = 105/193 (54%), Gaps = 23/193 (11%)
 Frame = +1

Query: 217 MGQKDSYVGDEAQS---KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPV 387
           M   D ++GDEA S     G+ T K+PI HG V +WD ME+ W    +N LR  PEEH  
Sbjct: 364 MADLDFFMGDEALSLFKSSGLYTRKHPINHGQVDDWDTMERFWQQCIFNYLRCNPEEHYF 423

Query: 388 LLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL--------------------Y 507
           LLT++P++   +RE   +IMFETFN P +Y+++Q+VLSL                    +
Sbjct: 424 LLTDSPVSTPESRECAGEIMFETFNVPGLYISVQSVLSLSAGYAFLKSISDEDSVSVFCF 483

Query: 508 ASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTT 687
           A    TG+V+D GDG  H VP+  GY +  +I     +G D+T +++++L ERG      
Sbjct: 484 AIPLYTGVVVDIGDGAPHVVPVVNGYVIGSSIKSFPFSGSDVTQFVLQLLQERGELIAPE 543

Query: 688 AEREIVRDIKEKL 726
              +I R  + K+
Sbjct: 544 DSLDIARRSRRKI 556


>UniRef50_A7AS14 Cluster: Actin, putative; n=1; Babesia bovis|Rep:
           Actin, putative - Babesia bovis
          Length = 382

 Score =  130 bits (313), Expect = 5e-29
 Identities = 73/225 (32%), Positives = 120/225 (53%)
 Frame = +1

Query: 97  ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILT 276
           ++++D GS   KAG +    P    PSI G  R +     MG  + Y G+E Q +   ++
Sbjct: 6   SVIIDTGSLYLKAGLSDQAEPLLHCPSIYGDVRRR-FQKEMGN-ERYYGNECQQRMSYMS 63

Query: 277 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 456
               ++HG + ++D    +W + F + + V P+   VL+ E  L    +  K  +I+ E 
Sbjct: 64  TTNVVDHGHIFDYDIAAGLWKYAF-DTMDVEPKGASVLMIEPVLCSAEHHRKTGEILLEG 122

Query: 457 FNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 636
                ++ ++  VLSLY  G+++G+V+D GDG+   VP+ EG+    AI R+D  G +LT
Sbjct: 123 MGVEEIHTSMSGVLSLYGVGKSSGMVVDIGDGMIQVVPMEEGHLEKKAIRRIDFGGLELT 182

Query: 637 DYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAA 771
            YL K+L E GY  T+  + +  R IKE+LC+ +LD   +   AA
Sbjct: 183 MYLQKLLCELGYPMTSRDDFDTCRKIKEELCFTSLDPRADENNAA 227


>UniRef50_A4RW28 Cluster: Predicted protein; n=2; Ostreococcus|Rep:
           Predicted protein - Ostreococcus lucimarinus CCE9901
          Length = 425

 Score =  129 bits (312), Expect = 7e-29
 Identities = 72/200 (36%), Positives = 114/200 (57%), Gaps = 6/200 (3%)
 Frame = +1

Query: 85  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGV--MVGMGQKDS---YVGDE 249
           +EV+A+V+D G+   KAG+AG D P+ VFPS VG     G   M   G+  S   +  D 
Sbjct: 5   DEVSAVVIDLGTHSVKAGYAGQDTPQHVFPSAVGECAKGGDADMTAEGENASARHFEVDN 64

Query: 250 AQSKRGILTLKYPI-EHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANR 426
              +R  + +  P  E+G++ +W+ +E IW H     L +  +EHPVLL+E   N  A R
Sbjct: 65  MGIRRDGMEVTSPYGENGMLEDWEAVEAIWEHALKKRLALQTDEHPVLLSEPVHNSDAVR 124

Query: 427 EKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAIL 606
            KM ++MFE    PA+++A   VLS +A G+ + +V+D G   +    I++G+AL  +++
Sbjct: 125 AKMVELMFEKHAPPALFLAKSPVLSSFAVGKASSLVIDMGGKHTTVSAIHDGFALQKSVV 184

Query: 607 RLDLAGRDLTDYLMKILTER 666
           R  L G  LTD ++K L ++
Sbjct: 185 RSPLGGEALTDVVLKYLEKK 204


>UniRef50_Q54JL1 Cluster: Putative uncharacterized protein; n=1;
           Dictyostelium discoideum AX4|Rep: Putative
           uncharacterized protein - Dictyostelium discoideum AX4
          Length = 414

 Score =  129 bits (311), Expect = 9e-29
 Identities = 81/237 (34%), Positives = 128/237 (54%), Gaps = 24/237 (10%)
 Frame = +1

Query: 100 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ--SKRGI- 270
           +++D G+   + G+ G++ P     +++G P     M+G+ +K+ Y G +    +KR   
Sbjct: 5   IIIDVGTKNIRIGYGGEEKPNETLLNLIGIPTTIK-MIGVERKNYYAGSDINFINKRNHR 63

Query: 271 LTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMF 450
           L+L  P++ GIV+NW+DMEKI+    Y E +VAPEE  +LLTE PL  K +  K+ +IMF
Sbjct: 64  LSLTCPMKRGIVSNWEDMEKIYSRLLYYEFKVAPEESDILLTEPPLTSKNDHNKLIEIMF 123

Query: 451 ETFNTPAMYVAIQAVLSLYASG---------------------RTTGIVLDSGDGVSHTV 567
           ETF T ++ +  Q++LS Y+S                       ++G+V+D GD V++ V
Sbjct: 124 ETFCTQSVSLLDQSMLSFYSSSSSSSSSSSSSSSSSSSSSQFENSSGLVVDIGDSVTNIV 183

Query: 568 PIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVA 738
           P Y G  L   I+R +  G D+  YL    T + Y+       E + DIKEK  YV+
Sbjct: 184 PFYNGVLLKEGIVRQEFGGSDIVTYLND--TYKQYNIPI----ETLYDIKEKFGYVS 234


>UniRef50_A2EUM6 Cluster: Actin family protein; n=1; Trichomonas
           vaginalis G3|Rep: Actin family protein - Trichomonas
           vaginalis G3
          Length = 360

 Score =  129 bits (311), Expect = 9e-29
 Identities = 73/212 (34%), Positives = 117/212 (55%)
 Frame = +1

Query: 100 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTL 279
           LV+D GSG  KAGFAG+D+P  VFP++VG  RH   +      D  +G+ A S   + T+
Sbjct: 8   LVLDFGSGFVKAGFAGNDSPSLVFPTVVGNLRH-AKLGPSNSNDPLIGESALSGANV-TV 65

Query: 280 KYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETF 459
           K PI    + + +D   I ++ F   L +  E + +L++          E +T+   ETF
Sbjct: 66  KRPIVRSEIQSPEDFYSIVNYIFQT-LEIKGENNHILISRPSGASTQQLELITEYFIETF 124

Query: 460 NTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTD 639
           + P++     A LSL ++GR TG+V + G  +++ VPI+E + L HA +  +L G+D+  
Sbjct: 125 HVPSIAFISSAALSLLSTGRATGVVAECGYSITNVVPIFEFFGLEHARITANLGGQDVDL 184

Query: 640 YLMKILTERGYSFTTTAEREIVRDIKEKLCYV 735
           YL  +L + G      A+   V ++KE+LCYV
Sbjct: 185 YLKSLLKKIGMG---EADNNAVNEVKEQLCYV 213


>UniRef50_A3BPG0 Cluster: Putative uncharacterized protein; n=3;
           Oryza sativa|Rep: Putative uncharacterized protein -
           Oryza sativa subsp. japonica (Rice)
          Length = 467

 Score =  128 bits (310), Expect = 1e-28
 Identities = 57/145 (39%), Positives = 89/145 (61%)
 Frame = +1

Query: 235 YVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNP 414
           YVG E + +R  + +  P++ G VT+WD ++ IW+H F   L + PEEHP+L+ E   N 
Sbjct: 105 YVGQELEFRRDHMEVISPMKDGTVTDWDIVDNIWNHAFRQRLLINPEEHPMLIAEPSTNT 164

Query: 415 KANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALP 594
              REK  ++MFE +  PA+++A  AVL+ +ASGR T +V+DSG G +    +++GY L 
Sbjct: 165 GQQREKAAELMFEKYKVPALFLAKNAVLTSFASGRATSLVVDSGGGSTVVAAVHDGYVLQ 224

Query: 595 HAILRLDLAGRDLTDYLMKILTERG 669
            ++    + G  LTD +MK L  +G
Sbjct: 225 KSVATSPIGGEFLTDCMMKSLESKG 249



 Score = 52.0 bits (119), Expect = 2e-05
 Identities = 21/32 (65%), Positives = 28/32 (87%)
 Frame = +1

Query: 85  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSI 180
           +EV+A+V+D GS  CKAG+AGDD P+AVFPS+
Sbjct: 5   DEVSAIVIDVGSYSCKAGYAGDDTPKAVFPSL 36


>UniRef50_Q9N4N4 Cluster: Putative uncharacterized protein; n=2;
           Caenorhabditis|Rep: Putative uncharacterized protein -
           Caenorhabditis elegans
          Length = 436

 Score =  128 bits (308), Expect = 2e-28
 Identities = 73/211 (34%), Positives = 118/211 (55%), Gaps = 17/211 (8%)
 Frame = +1

Query: 85  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA--QS 258
           +EV+ LV D GS   + GFAG++ P+   PS +             Q+    GD +  Q+
Sbjct: 9   DEVSGLVFDAGSQSFRVGFAGEEYPKGDIPSYIAVQEALPDDTIEKQEAMEEGDNSKVQT 68

Query: 259 KR------GILTLKYP---------IEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLL 393
           KR      G   +  P         ++ G++ +W+  EKI  H++ N L   P EHPVL 
Sbjct: 69  KREKNFFIGTTKIIVPRARTNMESFMKEGLIEDWELFEKIVEHSYENILYSNPSEHPVLF 128

Query: 394 TEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPI 573
           +E+  N +A REK+T+IMFE F  PA Y++   VLS +A GRT G+++DSG   +  VP+
Sbjct: 129 SESSWNDRARREKLTEIMFEKFQVPAYYLSKNVVLSCFAQGRTHGLMVDSGATQTSVVPV 188

Query: 574 YEGYALPHAILRLDLAGRDLTDYLMKILTER 666
           ++GYA+ HA+++  + G  +T+ L ++L ++
Sbjct: 189 FDGYAVTHAVVKCPIGGDLITEQLAQMLDQQ 219


>UniRef50_UPI000059FC57 Cluster: PREDICTED: similar to cytoplasmic
           beta-actin; n=1; Canis lupus familiaris|Rep: PREDICTED:
           similar to cytoplasmic beta-actin - Canis familiaris
          Length = 221

 Score =  126 bits (305), Expect = 5e-28
 Identities = 63/77 (81%), Positives = 68/77 (88%)
 Frame = +1

Query: 556 SHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYV 735
           S T+PI EGYA PHA+LRLDLAGR L  +LM ILTERGYSFTT AE+EIVRDIKEKLC V
Sbjct: 3   SPTLPIDEGYASPHAVLRLDLAGRGLAHHLMTILTERGYSFTTAAEQEIVRDIKEKLCCV 62

Query: 736 ALDFEQEMATAASSSSL 786
           ALDFEQE+ATAASSSSL
Sbjct: 63  ALDFEQEVATAASSSSL 79


>UniRef50_Q9SRK2 Cluster: Putative actin; n=1; Arabidopsis
           thaliana|Rep: Putative actin - Arabidopsis thaliana
           (Mouse-ear cress)
          Length = 378

 Score =  126 bits (305), Expect = 5e-28
 Identities = 75/239 (31%), Positives = 127/239 (53%), Gaps = 10/239 (4%)
 Frame = +1

Query: 100 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTL 279
           +V+DNG G+ KAG  G+  P  V P+ + +P      +      + + DE         +
Sbjct: 5   VVLDNGGGLIKAGQGGERDPTTVIPNCLYKPLSSKKFIHPSPLTT-LSDEIDLTSA--AV 61

Query: 280 KYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETF 459
           + PI+ G + N D   +IW H F + L +AP    +LLTEAPL+  + +    +++FE F
Sbjct: 62  RRPIDRGYLINSDLQREIWSHLFTSLLHIAPSSSSLLLTEAPLSIPSVQRTTDELVFEDF 121

Query: 460 NTPAMYVA-IQAVLSLYASGR---------TTGIVLDSGDGVSHTVPIYEGYALPHAILR 609
              ++Y+A  Q+++ LY + R            +V+D G   +H VP+   + L HAI R
Sbjct: 122 GFSSLYIAHPQSLVHLYEASRQPDSILSKTQCSLVVDCGFSFTHAVPVLHNFTLNHAIKR 181

Query: 610 LDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL 786
           +DL G+  T+YL ++++ R  S     E  +V D KEKLC+V+LD  +++  A + ++L
Sbjct: 182 IDLGGKAFTNYLKELVSYR--SINVMDETFLVDDAKEKLCFVSLDLLRDLRLARNGNTL 238


>UniRef50_A7QKV4 Cluster: Chromosome chr8 scaffold_115, whole genome
           shotgun sequence; n=1; Vitis vinifera|Rep: Chromosome
           chr8 scaffold_115, whole genome shotgun sequence - Vitis
           vinifera (Grape)
          Length = 431

 Score =  125 bits (301), Expect = 1e-27
 Identities = 63/93 (67%), Positives = 73/93 (78%), Gaps = 1/93 (1%)
 Frame = +1

Query: 223 QKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEK-IWHHTFYNELRVAPEEHPVLLTE 399
           QKD+YV DEAQSK+ +LTLKYP + GIV NWDD  K IWHHTFY EL VAPE H VLLTE
Sbjct: 21  QKDAYVEDEAQSKKDMLTLKYPTKSGIVGNWDDKGKTIWHHTFYIELCVAPEAHLVLLTE 80

Query: 400 APLNPKANREKMTQIMFETFNTPAMYVAIQAVL 498
             LN K N +KMTQ MFETF+TPA+ V+ Q++L
Sbjct: 81  VLLNLKVNHDKMTQSMFETFSTPAI-VSSQSML 112


>UniRef50_Q8LKR0 Cluster: Actin-related protein 6; n=26;
           Magnoliophyta|Rep: Actin-related protein 6 - Arabidopsis
           thaliana (Mouse-ear cress)
          Length = 422

 Score =  124 bits (300), Expect = 2e-27
 Identities = 74/237 (31%), Positives = 125/237 (52%), Gaps = 10/237 (4%)
 Frame = +1

Query: 106 VDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKY 285
           +DNG G+ KAG  G+  P  V P+ + +P      +      + + DE         ++ 
Sbjct: 8   LDNGGGLIKAGQGGERDPTTVIPNCLYKPLSSKKFIHPSPLTT-LSDEIDLTSA--AVRR 64

Query: 286 PIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNT 465
           PI+ G + N D   +IW H F + L +AP    +LLTEAPL+  + +    +++FE F  
Sbjct: 65  PIDRGYLINSDLQREIWSHLFTSLLHIAPSSSSLLLTEAPLSIPSVQRTTDELVFEDFGF 124

Query: 466 PAMYVA-IQAVLSLYASGR---------TTGIVLDSGDGVSHTVPIYEGYALPHAILRLD 615
            ++Y+A  Q+++ LY + R            +V+D G   +H VP+   + L HAI R+D
Sbjct: 125 SSLYIAHPQSLVHLYEASRQPDSILSKTQCSLVVDCGFSFTHAVPVLHNFTLNHAIKRID 184

Query: 616 LAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL 786
           L G+  T+YL ++++ R  S     E  +V D KEKLC+V+LD  +++  A + ++L
Sbjct: 185 LGGKAFTNYLKELVSYR--SINVMDETFLVDDAKEKLCFVSLDLLRDLRLARNGNTL 239


>UniRef50_Q9Y7X8 Cluster: Actin-like protein Arp5; n=1;
           Schizosaccharomyces pombe|Rep: Actin-like protein Arp5 -
           Schizosaccharomyces pombe (Fission yeast)
          Length = 721

 Score =  119 bits (286), Expect = 1e-25
 Identities = 66/226 (29%), Positives = 120/226 (53%), Gaps = 3/226 (1%)
 Frame = +1

Query: 100 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTL 279
           LV+DNGS   +AG+ G+  P+ VF ++V R R +     + +  + VG++   + G  ++
Sbjct: 27  LVIDNGSWQLRAGWGGEKDPKLVFDNLVSRYRDRK----LSRTSTLVGNDTLIEVGSRSI 82

Query: 280 -KYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 456
            + P E  +++NWD ME++  +TF  +L +   EHP+ +TE   NP   R  MT+++FE 
Sbjct: 83  ARSPFERNVISNWDLMEQVLDYTFL-KLGIDRMEHPICMTEPLANPTYVRSTMTELLFEL 141

Query: 457 FNTPAMYVAIQAVLSLYASGR--TTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRD 630
           +N P++   I  + S Y + +  ++GIVL+ G+  SH +P+  G  +     R+   G  
Sbjct: 142 YNAPSVAYGIDGLFSFYHNTKPSSSGIVLNLGNAASHVIPVLNGERILSEAKRISWGGSQ 201

Query: 631 LTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATA 768
            + YL+K+   +  SF           +    C+V+ D+  ++A A
Sbjct: 202 SSSYLLKLFQIKYPSFPIKMLPSQAELLMHDHCHVSSDYTHDIAHA 247


>UniRef50_Q2H0E9 Cluster: Putative uncharacterized protein; n=1;
           Chaetomium globosum|Rep: Putative uncharacterized
           protein - Chaetomium globosum (Soil fungus)
          Length = 656

 Score =  117 bits (282), Expect = 3e-25
 Identities = 68/229 (29%), Positives = 117/229 (51%), Gaps = 6/229 (2%)
 Frame = +1

Query: 94  AALVVDNGSGMCKAGFAGDDAPRAVFPSIVG--RPRHQGVMVGMGQKDSYVGDEAQSKRG 267
           A +V+DNGS   +AG++ +D PR   P I+   R R  G       +D Y    A   RG
Sbjct: 54  AVIVIDNGSSTVRAGWSFEDKPRLAIPPIMSKYRDRKAGKTFSFAGQDCYADTTA---RG 110

Query: 268 ILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPE---EHPVLLTEAPLNPKANREKMT 438
            +   +    GIV++WD +E +  H F        E   + P+++TEA  N   +R+ M+
Sbjct: 111 HIRNAFEAGTGIVSSWDVVEHVLDHVFIKLGMNGVEGGIDMPIVMTEAVANLPYSRKTMS 170

Query: 439 QIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDL 618
           +++FE +N P++   I ++ S   +   TG+V+ S    +H +P+Y+  AL    +RL+ 
Sbjct: 171 EMLFECYNAPSVVYGIDSLFSYRHNRGKTGLVVSSSYSATHLIPVYDSKALLSQAIRLNW 230

Query: 619 AGRDLTDYLMKILTERGYS-FTTTAEREIVRDIKEKLCYVALDFEQEMA 762
            G    +YL K++  + Y+ F          ++    CYV+LD++QE+A
Sbjct: 231 GGWHAAEYLQKLIRLKYYTGFPGKLNSSQAENMVRDFCYVSLDYDQEVA 279


>UniRef50_Q22WQ4 Cluster: Actin family protein; n=1; Tetrahymena
           thermophila SB210|Rep: Actin family protein -
           Tetrahymena thermophila SB210
          Length = 444

 Score =  113 bits (272), Expect(2) = 4e-25
 Identities = 68/221 (30%), Positives = 117/221 (52%), Gaps = 27/221 (12%)
 Frame = +1

Query: 76  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPR-------------------- 195
           M  E++ A+VVD GS   +AG++G+D PR V PS VG                       
Sbjct: 1   MFTEDITAIVVDPGSLSIRAGYSGEDTPRLVMPSQVGVREEIKVPDQSQLLKDEDGNIIN 60

Query: 196 -HQGVMVGMGQKDS-----YVGD-EAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYN 354
             Q  M+   + D      YVG+   + +R  + +     +G V +WD  EK+    + N
Sbjct: 61  AEQNKMIEENKSDDKFKNYYVGESNLKIRRDNMEVVSSYMNGEVKDWDAFEKLLLDVYEN 120

Query: 355 ELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIV 534
           ++RV P E+ +L++E+ L+ +  REK+ Q+ FE+   P  ++    VLS ++SGR+T +V
Sbjct: 121 QIRVQPSEYCLLISESSLHNQRQREKICQLAFESLKVPNFFIVKSGVLSCFSSGRSTALV 180

Query: 535 LDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKIL 657
           LD+G   ++ VP+++GY L  ++ + D+ G  LT+ ++  L
Sbjct: 181 LDTGAYSTYAVPVHDGYVLQKSVRKFDIGGEFLTEKILNNL 221



 Score = 24.6 bits (51), Expect(2) = 4e-25
 Identities = 10/21 (47%), Positives = 14/21 (66%)
 Frame = +1

Query: 673 SFTTTAEREIVRDIKEKLCYV 735
           S+    + EI RDIKE++C V
Sbjct: 257 SYEKFCQLEIARDIKEQICRV 277


>UniRef50_Q7M3B0 Cluster: Actin beta; n=1; Sus scrofa domestica|Rep:
           Actin beta - Sus scrofa domestica (domestic pig)
          Length = 195

 Score =  116 bits (279), Expect = 7e-25
 Identities = 68/122 (55%), Positives = 75/122 (61%), Gaps = 2/122 (1%)
 Frame = +1

Query: 235 YVGDEAQSK--RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPL 408
           + GD+A       I+   YPIEHGIVTNWDDMEKIWHHTFYNELRVAPEE          
Sbjct: 3   FAGDDAPRAVFPSIVGRPYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEE---------- 52

Query: 409 NPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYA 588
                   MTQIMFETFNTPAMYVAIQAVLSLYAS      +L     + +    +E Y 
Sbjct: 53  --------MTQIMFETFNTPAMYVAIQAVLSLYAS------ILTERGKLCYVALDFESYE 98

Query: 589 LP 594
           LP
Sbjct: 99  LP 100



 Score = 46.4 bits (105), Expect = 8e-04
 Identities = 20/20 (100%), Positives = 20/20 (100%)
 Frame = +1

Query: 133 AGFAGDDAPRAVFPSIVGRP 192
           AGFAGDDAPRAVFPSIVGRP
Sbjct: 1   AGFAGDDAPRAVFPSIVGRP 20


>UniRef50_Q6C061 Cluster: Actin-related protein 4; n=1; Yarrowia
           lipolytica|Rep: Actin-related protein 4 - Yarrowia
           lipolytica (Candida lipolytica)
          Length = 432

 Score =  116 bits (278), Expect = 9e-25
 Identities = 67/210 (31%), Positives = 104/210 (49%), Gaps = 7/210 (3%)
 Frame = +1

Query: 85  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSY-------VG 243
           +EVA LV+D GS   + G+AG+D P+ V  +  G    + V +     ++        VG
Sbjct: 14  DEVATLVIDTGSSYTRVGYAGEDTPKLVVSTECGLMADEDVEMEDDTSNTTKKLNKYKVG 73

Query: 244 DEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKAN 423
           D A      + + +P+  GIV +WD ++ IW ++    L    + HP++LTE   N +AN
Sbjct: 74  DSANLPLPNMEVLHPLTDGIVADWDAVQNIWEYSLAR-LNADTKTHPLMLTEPCWNTQAN 132

Query: 424 REKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAI 603
           + K  +I FE+   PA Y+   AV S +A+G+   +VLD G  V+   P+ +G  L    
Sbjct: 133 KLKALEIAFESLEVPASYLVKDAVASAFAAGKGNALVLDVGSEVASVTPVIDGLVLYKPA 192

Query: 604 LRLDLAGRDLTDYLMKILTERGYSFTTTAE 693
            R   AG  L   + K+L  RG   T   E
Sbjct: 193 RRSQYAGDYLDRQIKKVLVSRGIDLTPRFE 222


>UniRef50_UPI0000E466A7 Cluster: PREDICTED: similar to actin, alpha
           1, skeletal muscle; n=1; Strongylocentrotus
           purpuratus|Rep: PREDICTED: similar to actin, alpha 1,
           skeletal muscle - Strongylocentrotus purpuratus
          Length = 258

 Score =  114 bits (274), Expect = 3e-24
 Identities = 50/79 (63%), Positives = 61/79 (77%)
 Frame = +1

Query: 205 VMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHP 384
           +   M  +D +VGDEAQ KRG+L++KYPIE GIVTNW+DME IWHHTFYNELRV P+E  
Sbjct: 2   IPTSMITRDHFVGDEAQRKRGLLSIKYPIERGIVTNWEDMETIWHHTFYNELRVDPKELL 61

Query: 385 VLLTEAPLNPKANREKMTQ 441
           V  T+ P + KA+REK TQ
Sbjct: 62  VFFTDVPKSTKASREKTTQ 80



 Score = 58.4 bits (135), Expect = 2e-07
 Identities = 24/34 (70%), Positives = 31/34 (91%)
 Frame = +1

Query: 658 TERGYSFTTTAEREIVRDIKEKLCYVALDFEQEM 759
           T+RG +FT TAERE+VR+IKEK+CY+A DFE+EM
Sbjct: 79  TQRGINFTCTAEREVVREIKEKVCYIAQDFEKEM 112


>UniRef50_Q9DFB8 Cluster: Actin; n=1; Scomberomorus maculatus|Rep:
           Actin - Scomberomorus maculatus (Spanish mackerel)
          Length = 101

 Score =  113 bits (272), Expect = 5e-24
 Identities = 50/80 (62%), Positives = 60/80 (75%)
 Frame = +3

Query: 249 GTEQKRYPDPQIPHRTRNRH*LG*HGEDLASYLLQ*AACRPRGTPSPAH*GSPQPQGQQR 428
           G E+KR+PDP++ HR R+ H LG HGEDLA +LLQ AAC PR  P P   G  QP+ QQR
Sbjct: 22  GPEKKRHPDPEVSHRARHHHQLGRHGEDLAPHLLQRAACGPRRAPHPGDRGPSQPKSQQR 81

Query: 429 EDDPDHVRNIQHARHVRRHP 488
           EDDPDHVR++Q  R+VRRHP
Sbjct: 82  EDDPDHVRDVQCTRNVRRHP 101


>UniRef50_Q5CKL2 Cluster: BRG1/brm-associated factor 53A; n=2;
           Cryptosporidium|Rep: BRG1/brm-associated factor 53A -
           Cryptosporidium hominis
          Length = 423

 Score =  113 bits (271), Expect = 6e-24
 Identities = 73/225 (32%), Positives = 119/225 (52%), Gaps = 2/225 (0%)
 Frame = +1

Query: 85  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKR 264
           ++V A++VD GS M K G+ G+D PR V+PS+VG          +    SY+ D +    
Sbjct: 11  DDVGAIIVDVGSYMTKIGYGGEDCPRQVWPSVVGVKESGDKRFPLNFL-SYLEDVSVEP- 68

Query: 265 GILTLKYPIEHGIVTNWDDMEKIWHHTFYN-ELRVAPEEHPVLLTEAPLNPKANREKMTQ 441
               LKY ++  ++ N D  E+I   T     L     EHP+LLTE   + +  REK  +
Sbjct: 69  ---CLKY-VDGDLILNGDVFEEIIRTTSGKIGLSTDLREHPILLTEPSKHNRQIREKEVE 124

Query: 442 IMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLA 621
           IMFE F+ PA+Y A +A+LS ++ GR++G+V+D G   +  VPI +GY L   +    + 
Sbjct: 125 IMFEKFDVPAVYTAKKAILSAFSVGRSSGLVVDIGATATSIVPILDGYTLQKPLCEYPIG 184

Query: 622 GRDLTDYLMK-ILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQ 753
           G  L D + + +L E+  S +     + +    + L Y +++ E+
Sbjct: 185 GDFLDDQIARHLLKEKNLSISPNFSFKKIIHKDKPLSYESVNLEK 229


>UniRef50_Q9P7X7 Cluster: Actin-related protein 4; n=1;
           Schizosaccharomyces pombe|Rep: Actin-related protein 4 -
           Schizosaccharomyces pombe (Fission yeast)
          Length = 433

 Score =  113 bits (271), Expect = 6e-24
 Identities = 64/196 (32%), Positives = 101/196 (51%)
 Frame = +1

Query: 85  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKR 264
           +EV+A+V+D GS   + GF+G+D P+ V PS  G       + G    + Y+    +S  
Sbjct: 9   DEVSAIVIDPGSKWTRIGFSGEDIPKCVLPSYCGEFSDGRRLFG----EEYI---YKSNP 61

Query: 265 GILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQI 444
           G + +K  I +G V NWD    +W +    +L+  P EHP+L+TE   NP  NR K  + 
Sbjct: 62  G-MEIKNAIRNGWVENWDVTVDLWRYGLEQQLKTNPLEHPILITEPFDNPPENRVKTLET 120

Query: 445 MFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAG 624
           MFE+   PA Y+A Q   + +ASG+ T  ++D G   S    IY+G+ L         +G
Sbjct: 121 MFESLRCPATYLAKQETCAAFASGKGTACLVDIGAERSSVSAIYDGFVLQKGYQVQHFSG 180

Query: 625 RDLTDYLMKILTERGY 672
             + D L + L ++ +
Sbjct: 181 NAINDILAQTLRDKNF 196


>UniRef50_Q9LHH0 Cluster: Actin-like protein; n=11;
           Magnoliophyta|Rep: Actin-like protein - Arabidopsis
           thaliana (Mouse-ear cress)
          Length = 724

 Score =  111 bits (266), Expect = 3e-23
 Identities = 69/231 (29%), Positives = 117/231 (50%), Gaps = 11/231 (4%)
 Frame = +1

Query: 100 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTL 279
           +V+DNG+   + G+AG+  PR VF +IV RPRH+      G+  + VGD   S       
Sbjct: 22  IVIDNGASYFRIGWAGETEPRVVFRNIVQRPRHKAT----GETVTIVGDLDPSMMKYFDC 77

Query: 280 -----KYPIEHGIVTNWDDMEKIWHHTFYN-ELRVAPEEHPVLLTEAPLNPKANREKMTQ 441
                + P +  +V  ++ ME I  + F       +  +HP+L+TE   NP  +R KM +
Sbjct: 78  TRSGPRSPFDSNVVYQFEIMEYILDYAFDRLGANGSGIDHPILITECACNPVQSRSKMAE 137

Query: 442 IMFETFNTPAMYVAIQAVLS-----LYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAIL 606
           ++FET+  PA+   + A  S     L+   +  GIVL  G   +H++P  +G  +     
Sbjct: 138 LLFETYGVPAVAFGVDAAFSYKYNQLHGICKKDGIVLCPGFTTTHSIPFVDGEPIYKGSS 197

Query: 607 RLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEM 759
           R ++ G  +TDYL ++L+ +    ++    E   D+K + CY+A D+  E+
Sbjct: 198 RTNIGGYHVTDYLKQLLSLKYPFHSSRFTWEKAEDLKLEHCYIAPDYASEI 248


>UniRef50_Q8MVN5 Cluster: Cardiac actin-like protein; n=1; Boltenia
           villosa|Rep: Cardiac actin-like protein - Boltenia
           villosa
          Length = 137

 Score =  111 bits (266), Expect = 3e-23
 Identities = 55/93 (59%), Positives = 62/93 (66%), Gaps = 1/93 (1%)
 Frame = +1

Query: 202 GVMVGMGQKDSYVGDEAQS-KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEE 378
           GV  G  +K + +G   QS  R I   K P+E  I+TNWD  EKIWHHT  NEL VAPEE
Sbjct: 12  GVRGGRDRK-TVMGYRTQSIGREICLSKIPLERXIITNWDXQEKIWHHTLNNELEVAPEE 70

Query: 379 HPVLLTEAPLNPKANREKMTQIMFETFNTPAMY 477
           HP L T+A  NPKANREKM Q MFE F+ PAMY
Sbjct: 71  HPTLFTKAAWNPKANREKMAQXMFEPFSVPAMY 103


>UniRef50_UPI0000F2D271 Cluster: PREDICTED: similar to actin-like 8;
           n=1; Monodelphis domestica|Rep: PREDICTED: similar to
           actin-like 8 - Monodelphis domestica
          Length = 370

 Score =  108 bits (260), Expect = 1e-22
 Identities = 68/223 (30%), Positives = 111/223 (49%), Gaps = 3/223 (1%)
 Frame = +1

Query: 97  ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGR---PRHQGVMVGMGQKDSYVGDEAQSKRG 267
           ++V+D G+  CKAG  G + P    P ++G    P + G      +K     + A  K  
Sbjct: 4   SVVIDIGNDWCKAGLGGKNYPTIAVPEVIGYQSFPENPGPSNPQTRKIVGFNNLALMKE- 62

Query: 268 ILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIM 447
            L  ++PI  G V NW+ ME +  + F   L +  E+H +L+T    +  ++R K+ ++M
Sbjct: 63  -LPTEFPIVRGQVKNWEAMETVLTYAF-ESLGIKTEDHAILVTGFLSHRASHRMKLLEVM 120

Query: 448 FETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGR 627
            ETFN P++Y+   A L LY SG  TG+V+ SG G++   P++ G A         +AG 
Sbjct: 121 METFNVPSLYIGELAELCLYGSGILTGLVVHSGPGLTCITPVFNGKADYTYADVFQMAGI 180

Query: 628 DLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQE 756
           D++  L K L  +        +   +  IKE  CYV+ +  Q+
Sbjct: 181 DISLLLHKALFNQEMDSNNLPQVLSMNSIKEMTCYVSRNPSQK 223


>UniRef50_Q18PR4 Cluster: Actin-related protein; n=1; Porphyra
           yezoensis|Rep: Actin-related protein - Porphyra
           yezoensis
          Length = 573

 Score =  108 bits (259), Expect = 2e-22
 Identities = 62/191 (32%), Positives = 103/191 (53%), Gaps = 5/191 (2%)
 Frame = +1

Query: 82  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGR---PRHQGVMVGMGQKDSYVGDEA 252
           D  V ++V D GS  CK GFAG+D P +++ S +G    P      V   ++   VGD+A
Sbjct: 5   DGTVPSVVFDFGSHTCKVGFAGEDLPHSLYSSNIGAFPSPVVANGGVQPAKRGIIVGDQA 64

Query: 253 QS-KRGILTLKYPIE-HGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANR 426
            + +R  + +    + +G+V NW+  E +  H +   ++ A E+  V+  E        R
Sbjct: 65  LAIRRDDMNVTPAFDANGLVANWEAYEGLLAHAYSTGVQAASEDFAVMYAEPTHACIRQR 124

Query: 427 EKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAIL 606
           E++ +++FET   PA+ V+   VL+ YA+GR TG+VLD GD  +   P+ +G      +L
Sbjct: 125 ERIGELLFETHGAPALAVSPAVVLAAYANGRHTGVVLDVGDATTTAAPVLDGTVARSLVL 184

Query: 607 RLDLAGRDLTD 639
           R  +AGR L++
Sbjct: 185 RTRVAGRSLSE 195


>UniRef50_A7RPC3 Cluster: Predicted protein; n=3; Eumetazoa|Rep:
           Predicted protein - Nematostella vectensis
          Length = 64

 Score =  107 bits (257), Expect = 3e-22
 Identities = 51/64 (79%), Positives = 54/64 (84%)
 Frame = +1

Query: 97  ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILT 276
           ALV+D GS M K GFAGDDAP+ VFP IVGRPRHQGVMVGMGQKDSYVG EA SKRGIL+
Sbjct: 1   ALVIDVGSHMWKVGFAGDDAPKGVFPPIVGRPRHQGVMVGMGQKDSYVGWEAHSKRGILS 60

Query: 277 LKYP 288
           L  P
Sbjct: 61  LSTP 64


>UniRef50_Q4WA13 Cluster: Chromatin remodeling complex subunit
           (Arp5), putative; n=14; Pezizomycotina|Rep: Chromatin
           remodeling complex subunit (Arp5), putative -
           Aspergillus fumigatus (Sartorya fumigata)
          Length = 757

 Score =  106 bits (255), Expect = 5e-22
 Identities = 60/227 (26%), Positives = 115/227 (50%), Gaps = 3/227 (1%)
 Frame = +1

Query: 94  AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGIL 273
           +A+V+DNGS + KAG++ D +PR + P ++ R R + +  G  Q   Y      + RG L
Sbjct: 59  SAIVIDNGSSLLKAGWSFDVSPRFILPPVMSRYRDRKLNKGC-QFIGYDAYVDATTRGQL 117

Query: 274 TLKYPIEHGIVTNWDDMEKIWHHTFYN---ELRVAPEEHPVLLTEAPLNPKANREKMTQI 444
              +     +V NWD ME +  + F     +      + P+++TE   N    R  M +I
Sbjct: 118 RYAFDPGTSVVGNWDVMEGLLDYVFIKLGVDGANGGVDRPIVMTEPIANLNYPRRMMNEI 177

Query: 445 MFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAG 624
           +FE ++ P++   I ++ S   +  T G+++ S    +H +P+    AL     RL+  G
Sbjct: 178 LFECYSAPSVAYGIDSLFSYRYNKGTDGLIISSSHTSTHVIPVLNSKALLSNCSRLNWGG 237

Query: 625 RDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMAT 765
              ++Y++K++  +  +F        + D+  K CYV+ D+++E+++
Sbjct: 238 MHASEYMLKLMKLKYPTFPARMTESQMEDLVHKHCYVSTDYDRELSS 284


>UniRef50_UPI0000D56C2F Cluster: PREDICTED: similar to Actin-57B;
           n=1; Tribolium castaneum|Rep: PREDICTED: similar to
           Actin-57B - Tribolium castaneum
          Length = 291

 Score =  105 bits (253), Expect = 1e-21
 Identities = 60/139 (43%), Positives = 84/139 (60%), Gaps = 3/139 (2%)
 Frame = +1

Query: 349 YNELRVAPEEHPVLLTEAPLNP--KANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRT 522
           Y +L+VAPE HPVLLT+ P  P  KA  EK+ QIMFE F  PA+++   +VLSLY+ G  
Sbjct: 14  YKQLKVAPENHPVLLTK-PYFPISKATTEKIAQIMFEDFKIPALHLIYPSVLSLYSYGSL 72

Query: 523 TGIVLDSGDGVSHTVPIYEGYALPHAILR-LDLAGRDLTDYLMKILTERGYSFTTTAERE 699
           TG+V+ SG+  S   PIYEG+ L   + R L +AG+ LT++L   L ++G       +  
Sbjct: 73  TGLVVQSGNFESQFYPIYEGHILERTLTRGLPVAGQYLTEFLQDALAKKG----LRCDYA 128

Query: 700 IVRDIKEKLCYVALDFEQE 756
               IKE+  YV++D   E
Sbjct: 129 TANSIKERAFYVSMDLNNE 147


>UniRef50_Q7S6X6 Cluster: Actin-like protein arp-6; n=5;
           Pezizomycotina|Rep: Actin-like protein arp-6 -
           Neurospora crassa
          Length = 446

 Score =  105 bits (251), Expect = 2e-21
 Identities = 76/243 (31%), Positives = 122/243 (50%), Gaps = 23/243 (9%)
 Frame = +1

Query: 100 LVVDNGSGMCKAGFAGDDA----PRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRG 267
           LV+DNG+   KAGF  DD     PR + P+ + R RH+ +         YVG E +  + 
Sbjct: 22  LVLDNGADTIKAGFVSDDKSDGKPR-IIPNCLARDRHRKI---------YVGSELEKCKD 71

Query: 268 I--LTLKYPIEHGIVTNWDDMEKIWHHTFYNEL---RVAPEEHPVLLTEAPLNPKANREK 432
              L  + P+E G + NW+  ++IW   F+++    +  P +  ++LTE P +  + +  
Sbjct: 72  FSELAFRRPVEKGFIVNWEAQKEIWDREFFDDKAAQKCDPSDTRLILTEQPNSLPSLQTH 131

Query: 433 MTQIMFETFNTPAMYVAIQAVLSLYAS----GRTTGIVLDS--------GDGVSHTV--P 570
             QI+FE +   + Y  +  V + Y       RT    +DS          G SHT   P
Sbjct: 132 CDQIVFEEYGFASYYRGLGPVFNAYRDIQSIFRTPQSTIDSPAQVILLIDSGYSHTTVTP 191

Query: 571 IYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFE 750
           I +G  L  AI RLD+ G+ +T+YL ++L+ R   F    E  IV ++KE +CY +LDF+
Sbjct: 192 ILQGRPLHPAIRRLDVGGKLMTNYLTRLLSVR--HFDMRNEPYIVNEMKEAVCYTSLDFK 249

Query: 751 QEM 759
            ++
Sbjct: 250 GDL 252


>UniRef50_UPI0000DD7E8B Cluster: PREDICTED: similar to ARP3
           actin-related protein 3 homolog B; n=1; Homo
           sapiens|Rep: PREDICTED: similar to ARP3 actin-related
           protein 3 homolog B - Homo sapiens
          Length = 406

 Score =  104 bits (250), Expect = 2e-21
 Identities = 54/120 (45%), Positives = 75/120 (62%), Gaps = 8/120 (6%)
 Frame = +1

Query: 388 LLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASG-------RT-TGIVLDS 543
           L TE PLN   NRE + +IMFE+FN P +Y+A+QAVL+L AS        RT TGIV+DS
Sbjct: 257 LQTEPPLNTPENREYLAEIMFESFNVPGLYIAVQAVLALAASWTSRQVGERTLTGIVIDS 316

Query: 544 GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEK 723
           GDGV+H +P+ EGY +   I  + +AGRD+T ++ ++L ER          E  + IK +
Sbjct: 317 GDGVTHVIPVAEGYVIGSCIKHIPIAGRDITYFIQQLLREREVGIPPEQSLETAKAIKNQ 376


>UniRef50_A5B4L4 Cluster: Putative uncharacterized protein; n=1;
           Vitis vinifera|Rep: Putative uncharacterized protein -
           Vitis vinifera (Grape)
          Length = 571

 Score =  103 bits (247), Expect = 5e-21
 Identities = 51/106 (48%), Positives = 66/106 (62%), Gaps = 3/106 (2%)
 Frame = +1

Query: 217 MGQKDSYVGDEAQSKR---GILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPV 387
           M   D ++GDEA ++        L YPI HG V NWD ME+ W    +N LR  PE+H  
Sbjct: 120 MADLDFFIGDEAIARSRNSSTYNLSYPIVHGQVDNWDAMERFWQQCIFNYLRCDPEDHYF 179

Query: 388 LLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTT 525
           LLTE+PL    +RE   +IMFETFN P +Y+A+Q VL+L A+G TT
Sbjct: 180 LLTESPLTAPESREYTGEIMFETFNVPGLYIAVQPVLAL-AAGYTT 224



 Score = 64.5 bits (150), Expect = 3e-09
 Identities = 26/76 (34%), Positives = 46/76 (60%)
 Frame = +1

Query: 529 IVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVR 708
           +V+D GDG +H VP+ +GY +  +I  + +AG+D+T ++ +++ ERG         E+ R
Sbjct: 279 VVVDVGDGATHVVPVADGYVIGSSIKSIPIAGKDVTLFVQQLMRERGEHVPPEDSFEVAR 338

Query: 709 DIKEKLCYVALDFEQE 756
            +KE  CY + D  +E
Sbjct: 339 KVKEMYCYTSSDIVKE 354


>UniRef50_Q3M0X0 Cluster: Actin6-2; n=3; Paramecium tetraurelia|Rep:
           Actin6-2 - Paramecium tetraurelia
          Length = 394

 Score =  103 bits (247), Expect = 5e-21
 Identities = 58/229 (25%), Positives = 120/229 (52%), Gaps = 9/229 (3%)
 Frame = +1

Query: 100 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYV-GDE----AQSKR 264
           +V+DNG+   K G +G+D PR ++ +  G    Q        K   + G +     + K+
Sbjct: 11  VVIDNGTDTIKVGISGEDYPRLIYDNKCGSHSVQNDNDNPNNKPQLLFGQDLKKVVKEKK 70

Query: 265 GILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAP-EEHPVLLTEAPLNPKANREKMTQ 441
             + L  PI+ G + N + M++ W +   + L+++  ++  +L+ +   N K  + K+ +
Sbjct: 71  LNVQLSNPIKDGKIDNVESMKEFWQYILEDGLQISELQQVNLLIIDQVKNSKEYKSKLAE 130

Query: 442 IMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLA 621
           + F+     ++     A LSL+++G  +G+ ++ G  V+  VPIY+G+ + HA+    ++
Sbjct: 131 VFFDYLKVQSVLFMNSASLSLFSTGLVSGLSIELGHAVNTIVPIYQGFPIMHALEFSHIS 190

Query: 622 GRDLTDYL---MKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEM 759
           G ++T  L   ++        F+   ++ I++DIKE +CY+A D+E +M
Sbjct: 191 GAEITQCLENDLRCYETLIDKFSEEEKQWIIKDIKENMCYIASDYEMQM 239


>UniRef50_Q09849 Cluster: Uncharacterized protein C23D3.09; n=1;
           Schizosaccharomyces pombe|Rep: Uncharacterized protein
           C23D3.09 - Schizosaccharomyces pombe (Fission yeast)
          Length = 430

 Score =  103 bits (246), Expect = 7e-21
 Identities = 55/200 (27%), Positives = 103/200 (51%), Gaps = 2/200 (1%)
 Frame = +1

Query: 85  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKR 264
           EE+ +LV+D GS   + G+AG+++P  + PS      + GV   +  ++ YV DE Q   
Sbjct: 8   EEIPSLVIDPGSCWTRFGYAGEESPMTILPS------YYGVRSDVTGRNKYVVDELQIHA 61

Query: 265 GI--LTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 438
            I  + +K    +GI+ +W+     W      +L+V P E+ +++TE   NP++ R+++ 
Sbjct: 62  PIPGMEVKNGKSNGIIQDWESTLYTWERGLKEKLQVNPTEYAMMITEPSWNPQSVRQQIM 121

Query: 439 QIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDL 618
           +  FE  + PA Y+  QAV   +A+ ++T +++D G   +   P+ +G  +   I +  L
Sbjct: 122 EAAFEQLHVPAFYLTKQAVCVAFANSKSTALIVDIGSDNASVTPVVDGLIIRKGIFKQSL 181

Query: 619 AGRDLTDYLMKILTERGYSF 678
           AG  L   + ++       F
Sbjct: 182 AGDFLNANIEQLFNTMNIEF 201


>UniRef50_UPI00006C1719 Cluster: PREDICTED: similar to actin, alpha
           2, smooth muscle, aorta; n=3; Homo/Pan/Gorilla
           group|Rep: PREDICTED: similar to actin, alpha 2, smooth
           muscle, aorta - Homo sapiens
          Length = 183

 Score =  101 bits (243), Expect = 2e-20
 Identities = 45/52 (86%), Positives = 48/52 (92%)
 Frame = +1

Query: 217 MGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAP 372
           MGQKDSYVGDEAQSK GILTLKYPIE G+VTN DDMEKIWHHTFYN+LR+ P
Sbjct: 1   MGQKDSYVGDEAQSKYGILTLKYPIEQGMVTNRDDMEKIWHHTFYNKLRLHP 52



 Score = 48.0 bits (109), Expect = 3e-04
 Identities = 23/32 (71%), Positives = 26/32 (81%)
 Frame = +1

Query: 685 TAEREIVRDIKEKLCYVALDFEQEMATAASSS 780
           TAE EIVRDIKEKLCYV  D ++E+ATA  SS
Sbjct: 53  TAEWEIVRDIKEKLCYVTPDIKRELATAVFSS 84


>UniRef50_UPI0000498A93 Cluster: actin; n=1; Entamoeba histolytica
           HM-1:IMSS|Rep: actin - Entamoeba histolytica HM-1:IMSS
          Length = 360

 Score =  101 bits (243), Expect = 2e-20
 Identities = 61/219 (27%), Positives = 101/219 (46%)
 Frame = +1

Query: 88  EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRG 267
           E   +V+D GS   KAG A D+AP  +  +++G     G + G          E+     
Sbjct: 3   EEVPIVLDIGSYSIKAGTAEDEAPSCIIRNVIGE-HETGKIYG----------ESVFNNN 51

Query: 268 ILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIM 447
           I    YPI  G++++ DD+E I    F   + V     P+++TE  L P   +++  ++ 
Sbjct: 52  IKDYHYPINRGMISDCDDIEGILRFVFDENMGVDASTRPIIVTEEALCPNLRKQEYGELF 111

Query: 448 FETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGR 627
           FE F TP +Y  +    +L      TG+ +D G+      P Y G  + +A  +    G 
Sbjct: 112 FEKFETPGLYFELTGNCALIPLDLETGLTVDFGESFVSIFPFYNGTYIFNASDKQCFGGL 171

Query: 628 DLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALD 744
           D + +L  IL ++GY+     +RE++  IKE      LD
Sbjct: 172 DCSTHLASILAKQGYTLNIDNDRELLNTIKENYSVARLD 210


>UniRef50_UPI0000E4A0BF Cluster: PREDICTED: similar to Actin-related
           protein 5; n=2; Strongylocentrotus purpuratus|Rep:
           PREDICTED: similar to Actin-related protein 5 -
           Strongylocentrotus purpuratus
          Length = 602

 Score =  100 bits (240), Expect = 4e-20
 Identities = 59/194 (30%), Positives = 100/194 (51%), Gaps = 8/194 (4%)
 Frame = +1

Query: 100 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGIL-T 276
           +++DNGS   + G+A +  PR  F +I+ R R      G    D+ +G++  +   +   
Sbjct: 93  IIIDNGSCFSRVGWASEGTPRLTFRNIIARQR------GKKDSDAQIGNDIPNVETVRWL 146

Query: 277 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPE---EHPVLLTEAPLNPKANREKMTQIM 447
           LK   +  +VT++D  E+I  H F   L +  E   +HP+++TE P NP   R+ M++++
Sbjct: 147 LKTQFDRDVVTHYDAQEQILDHAF-QRLGIDSEGAVKHPIVMTETPCNPNLCRQTMSELL 205

Query: 448 FETFNTPAMYVAIQAVLSLY----ASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLD 615
           FE +  P +   I ++ S Y     S     +VL SG   SH +P+  G   P    RL+
Sbjct: 206 FECYQIPNLAYGIDSLFSHYYNCPESVNGCSLVLSSGFQTSHILPVINGQLDPAHCRRLN 265

Query: 616 LAGRDLTDYLMKIL 657
           + G  LT YL+++L
Sbjct: 266 IGGTHLTGYLLRLL 279


>UniRef50_Q23FF9 Cluster: Actin family protein; n=2; Tetrahymena
           thermophila|Rep: Actin family protein - Tetrahymena
           thermophila SB210
          Length = 426

 Score =  100 bits (240), Expect = 4e-20
 Identities = 51/164 (31%), Positives = 97/164 (59%), Gaps = 1/164 (0%)
 Frame = +1

Query: 259 KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAP-EEHPVLLTEAPLNPKANREKM 435
           K+  L  K+PI++G + ++D +  ++ +     L+V       +L+ ++PLNPK  + K+
Sbjct: 108 KKFELEEKFPIQNGKIVDFDAIRDLYTYALEKLLQVNEISSCNLLIIDSPLNPKNYKHKL 167

Query: 436 TQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLD 615
            +I+F+     ++     + LSL+++G TTG+V++SG  ++  +P++EG+A+PHA     
Sbjct: 168 AEILFDDMKVNSVLFQNSSSLSLFSTGETTGLVVESGHSLTTCIPVFEGFAIPHAFQHSY 227

Query: 616 LAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDF 747
           LAG+ +T+    IL E         +  + +DIKE++CYVA D+
Sbjct: 228 LAGQKMTE----ILKEELKIPAGQLDDNVFKDIKERMCYVARDY 267


>UniRef50_Q6CF37 Cluster: Similar to sp|P53946 Saccharomyces
           cerevisiae YNL059c ARP5Actin- related protein; n=1;
           Yarrowia lipolytica|Rep: Similar to sp|P53946
           Saccharomyces cerevisiae YNL059c ARP5Actin- related
           protein - Yarrowia lipolytica (Candida lipolytica)
          Length = 724

 Score =   99 bits (238), Expect = 6e-20
 Identities = 56/226 (24%), Positives = 113/226 (50%), Gaps = 4/226 (1%)
 Frame = +1

Query: 94  AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQ-GVMVGMGQKDSYVGDEAQSKRGI 270
           + + +D G+ M +AG+   + P  VFP++ G+ R +     G+    +   D        
Sbjct: 23  STIAIDFGTHMTRAGYTDTNGPNLVFPTLTGKYRERKSAGPGLAGATTVGYDNFIEPSTR 82

Query: 271 LTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPE---EHPVLLTEAPLNPKANREKMTQ 441
           L+ + P +  +V+NW   E++  +TF  +LRV  +   ++ +++ E   +P A R  + Q
Sbjct: 83  LSARSPYDGALVSNWTVAEEVLDYTFA-KLRVGSDGCVDNHIIMNELMSSPAAQRRNLQQ 141

Query: 442 IMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLA 621
           ++FE +   ++ + + A+ S YA+   TG+VL  G+  +H +P+ +G A      R+   
Sbjct: 142 VLFEGYGVRSVALGVDALFSYYANDGKTGLVLSVGNEATHIIPVIDGIAQRELTKRITWG 201

Query: 622 GRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEM 759
           GR  + +L ++L  +  +F           I E  CYV+  +++E+
Sbjct: 202 GRTASAFLAQLLQLKYPTFPLKLSATQTTKILENHCYVSDGYKEEL 247


>UniRef50_Q17GZ9 Cluster: Actin-related protein 5; n=4;
           Endopterygota|Rep: Actin-related protein 5 - Aedes
           aegypti (Yellowfever mosquito)
          Length = 655

 Score = 99.1 bits (236), Expect = 1e-19
 Identities = 54/196 (27%), Positives = 105/196 (53%), Gaps = 8/196 (4%)
 Frame = +1

Query: 94  AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQ---KDSYVGDEAQSKR 264
           AA+V+DNGS  C+AG+AG D P  VF +++ +PR         +       +G++  +  
Sbjct: 28  AAIVIDNGSYHCRAGWAGKDVPSLVFKNVLAKPRKDRSKKDTSEVVVPTVQIGNDITNIE 87

Query: 265 GI-LTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPE---EHPVLLTEAPLNPKANREK 432
            +   L+   +  +VT+    E+I+ + F   L +  +    HPVLLTE   NP  +R  
Sbjct: 88  AVRFQLRTQFDRNVVTHLHVQEQIFDYLF-GRLGINADGCVPHPVLLTECVANPNYSRML 146

Query: 433 MTQIMFETFNTPAMYVAIQAVLSLYAS-GRTTGIVLDSGDGVSHTVPIYEGYALPHAILR 609
           M+++MFE +  P +  A+  +LS   + G+ +G+++  G   +H +P+  G  +   + R
Sbjct: 147 MSELMFECYGIPGIVYAVDGLLSYRMNGGQDSGLIVSCGYQATHVIPVLNGRMVEDKVRR 206

Query: 610 LDLAGRDLTDYLMKIL 657
           ++L G ++ +++ ++L
Sbjct: 207 INLGGFNMINFMFRLL 222


>UniRef50_Q4QF49 Cluster: Actin-like protein, putative; n=2;
           Leishmania|Rep: Actin-like protein, putative -
           Leishmania major
          Length = 440

 Score = 98.3 bits (234), Expect = 2e-19
 Identities = 69/224 (30%), Positives = 106/224 (47%), Gaps = 8/224 (3%)
 Frame = +1

Query: 97  ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILT 276
           A V+D GS   + GFAGD  PR    + V + +      G       V D         T
Sbjct: 27  AAVLDMGSHTTRLGFAGDTVPRMRQRTCVVKGK------GTFSDACDVLDHVDDPAAATT 80

Query: 277 LKYPIEHGIVTNWDDMEKIWHHTF-YNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFE 453
           +   +E+G++ +W+  E++        +L       P+L+TE  L P   R+K+ +++FE
Sbjct: 81  V---LENGVIVDWEGYEELLSRVARILDLENVENSTPLLVTEKALVPTHQRQKIAEVLFE 137

Query: 454 TFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDL 633
           T    A   A+  VLSLYASG  TG+ ++ G   SH  P+++G +L HA   LD+ G DL
Sbjct: 138 THRVVATSFALSPVLSLYASGLGTGVAVELGHDQSHVAPVFQGLSLFHATHCLDVGGADL 197

Query: 634 TDYLMKILTERGY-------SFTTTAEREIVRDIKEKLCYVALD 744
           T +   +++           S T T    +   IKE+ C VA D
Sbjct: 198 TRHFTSLMSGVATTHVSVLGSMTPTQRESMWEYIKERHCTVAED 241


>UniRef50_UPI0000498FDF Cluster: actin; n=1; Entamoeba histolytica
            HM-1:IMSS|Rep: actin - Entamoeba histolytica HM-1:IMSS
          Length = 763

 Score = 97.1 bits (231), Expect = 4e-19
 Identities = 63/213 (29%), Positives = 115/213 (53%), Gaps = 2/213 (0%)
 Frame = +1

Query: 103  VVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLK 282
            ++D GS   K+GF     P  V P++VG+  HQ    G  +++ YVGDEA  KRGIL+L+
Sbjct: 425  IIDIGSCSIKSGFESVGTPSIVTPTVVGKNLHQ--TSGFVEQNLYVGDEAIDKRGILSLE 482

Query: 283  YPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN 462
            YP++   + +++ ++ +  H+    + VA + HP ++    L P   +   ++I+F    
Sbjct: 483  YPMQKEPI-DYNSLKSVMKHS----VEVA-QGHPTVVITNGLTPLQMKINTSEILFNEGV 536

Query: 463  TPAMYV-AIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTD 639
                +V   QA+  LY   +   ++++ G  +S  +P+  G    +   +L +AG   T+
Sbjct: 537  QSIRFVDEAQAISRLY--NKQNCVIVNIGGMMSWVIPVINGIVYNNISQKLPIAGVKCTE 594

Query: 640  YLMKILTERGYSF-TTTAEREIVRDIKEKLCYV 735
             LM +L++ G +  +T++E+EI R IKE   Y+
Sbjct: 595  ILMALLSKEGITLGSTSSEKEIARQIKEATGYI 627


>UniRef50_Q5C683 Cluster: SJCHGC08418 protein; n=1; Schistosoma
           japonicum|Rep: SJCHGC08418 protein - Schistosoma
           japonicum (Blood fluke)
          Length = 106

 Score = 96.7 bits (230), Expect = 6e-19
 Identities = 46/103 (44%), Positives = 65/103 (63%)
 Frame = +1

Query: 100 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTL 279
           +VVDNG+G  KAG+AGD  PR + P ++GRP+           D +VG+ A + R  L L
Sbjct: 9   IVVDNGAGHLKAGYAGDGGPRILVPMLIGRPKKCSKYT-----DWFVGEHANAIRNELIL 63

Query: 280 KYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPL 408
             PI +GIVT+ D +  +W++ F  ELR +PE HPVL++E PL
Sbjct: 64  NCPIANGIVTDIDGLSLVWYYMFMKELRTSPENHPVLISEYPL 106


>UniRef50_P53946 Cluster: Actin-related protein 5; n=7;
           Saccharomycetales|Rep: Actin-related protein 5 -
           Saccharomyces cerevisiae (Baker's yeast)
          Length = 755

 Score = 95.5 bits (227), Expect = 1e-18
 Identities = 58/227 (25%), Positives = 114/227 (50%), Gaps = 7/227 (3%)
 Frame = +1

Query: 100 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTL 279
           + +D GS   +AGF     P  +FP+ + + R +     + +  ++VG++    + + + 
Sbjct: 40  IAIDFGSSKLRAGFVNHATPTHIFPNALTKFRDRK----LNKNFTFVGNDTLLDQAVRSQ 95

Query: 280 -KYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEE---HPVLLTEAPLNPKANREKMTQIM 447
            + P +   VTNW+  E+I  +TF++ L V P+    +P+LLTE     ++ R    QI+
Sbjct: 96  SRSPFDGPFVTNWNLTEEILDYTFHH-LGVVPDNGIPNPILLTERLATVQSQRTNWYQIL 154

Query: 448 FETFNTPAMYVAIQAVLSLY---ASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDL 618
           FET+N P +   I ++ S Y    SG  TG+V+  G   ++ +P+ +G  +     R++ 
Sbjct: 155 FETYNVPGVTFGIDSLFSFYNYNPSGNKTGLVISCGHEDTNVIPVVDGAGILTDAKRINW 214

Query: 619 AGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEM 759
            G    DYL  ++  +   F T         + +  CYV+ ++++++
Sbjct: 215 GGHQAVDYLNDLMALKYPYFPTKMSYLQYETMYKDYCYVSRNYDEDI 261


>UniRef50_A7QZ13 Cluster: Chromosome undetermined scaffold_261,
           whole genome shotgun sequence; n=1; Vitis vinifera|Rep:
           Chromosome undetermined scaffold_261, whole genome
           shotgun sequence - Vitis vinifera (Grape)
          Length = 232

 Score = 95.1 bits (226), Expect = 2e-18
 Identities = 64/203 (31%), Positives = 102/203 (50%), Gaps = 3/203 (1%)
 Frame = +1

Query: 85  EEVAALVVDNGSGMCKAGFA-GDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 261
           E + A+VVD GS + KAGF   D AP  + P+ +      G ++     D+ + ++    
Sbjct: 44  ESMEAVVVDAGSKLLKAGFTIPDQAPSMLIPTQMKHILEDGPLI-----DNLLFED---- 94

Query: 262 RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELR--VAPEEHPVLLTEAPLNPKANREKM 435
              +T+  P+  G++ +WD ME + +H  Y  LR  +  E H +L T+    PKA RE++
Sbjct: 95  ---ITVD-PVVRGLIRDWDTMEDLLNHVLYTGLRWEMGNEGH-ILFTDPLSTPKAFREQL 149

Query: 436 TQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLD 615
            Q+MFE FN    Y + Q VLSL+  GR +G  +D G+      P+ +G        R +
Sbjct: 150 VQLMFEIFNISDFYASEQVVLSLHVVGRISGCTIDFGNWKIDIAPVIKGAVQHITSRRFE 209

Query: 616 LAGRDLTDYLMKILTERGYSFTT 684
           + G DLT+++   L      F T
Sbjct: 210 IGGVDLTNFIDSYLIPYFPKFNT 232


>UniRef50_Q6C982 Cluster: Actin-like protein ARP6; n=1; Yarrowia
           lipolytica|Rep: Actin-like protein ARP6 - Yarrowia
           lipolytica (Candida lipolytica)
          Length = 387

 Score = 95.1 bits (226), Expect = 2e-18
 Identities = 66/231 (28%), Positives = 114/231 (49%), Gaps = 2/231 (0%)
 Frame = +1

Query: 100 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTL 279
           +++DNGS   K+   GD    A  P+ + R R + V VG  Q  +   D A      L  
Sbjct: 1   MILDNGSYAIKSDRTGD----AETPNALIRGRDKTVYVG--QDLTKCKDYAS-----LVF 49

Query: 280 KYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETF 459
           K P E G + NWD  + +W + FYN       +  +LLT+ PL        + Q++FE +
Sbjct: 50  KRPSEKGQLINWDIQKAVWDNLFYNPQTGVDTDSSLLLTQYPLTLPQVSANIDQVVFEEY 109

Query: 460 NTPAMYVAIQAVLSLYASGRTTG--IVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDL 633
                +    A L  ++SG+     +V+D+G   +H  P+  G      I R+++ G+ +
Sbjct: 110 GFEQYHRTEAANLVAWSSGQCLDACLVVDAGFNATHVTPVLFGQVHEPGIRRVNVGGKTM 169

Query: 634 TDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL 786
           T+ L + ++ R Y+     E  I+  +KEK+C+V+ DF++++  A  + SL
Sbjct: 170 TNLLKETVSFRHYNMMD--ETYIINRVKEKVCFVSQDFDKDLDLAKKTKSL 218


>UniRef50_Q5KAQ4 Cluster: Actin-like protein ARP6; n=1;
           Filobasidiella neoformans|Rep: Actin-like protein ARP6 -
           Cryptococcus neoformans (Filobasidiella neoformans)
          Length = 490

 Score = 95.1 bits (226), Expect = 2e-18
 Identities = 68/233 (29%), Positives = 115/233 (49%), Gaps = 11/233 (4%)
 Frame = +1

Query: 100 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTL 279
           L++DNG+   KAG +G D    V P+ + R R +        K  YVGDE  + + +  +
Sbjct: 7   LIIDNGAYEIKAGISGVDWEPRVLPNSIARSRTE--------KRVYVGDEIDNCKDLSGI 58

Query: 280 KY--PIEHGIVTNWDDMEKIWHHTFY-NELRVAPEEHPVLLTEAPLNPKANREKMTQIMF 450
            Y  P E G++ NWD    IW   F  + L + P E  +L+TE   N     E   Q++F
Sbjct: 59  VYRRPFEKGMLVNWDAERIIWDRLFSPSVLNINPTETSLLVTEPYFNLPNIAETYDQMIF 118

Query: 451 ETFNTPAMYVAIQAVL----SLYASGR----TTGIVLDSGDGVSHTVPIYEGYALPHAIL 606
           E F   + +    A L     LY S +       IV+D G   +H VPI +G  +   + 
Sbjct: 119 EEFEFQSYFRCAPAALIPYGGLYESDQGIPPQCTIVIDMGYSYTHVVPIRDGQIVWEHVK 178

Query: 607 RLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMAT 765
           R+D+ G+ LT++L  +++ R ++     +  +V  ++E   YV+L+++ ++ T
Sbjct: 179 RIDVGGKLLTNHLKHLISFRQWNMID--QTHVVNSVREACGYVSLNWKGDLET 229


>UniRef50_P45890 Cluster: Actin-like protein 13E; n=8;
           Eumetazoa|Rep: Actin-like protein 13E - Drosophila
           melanogaster (Fruit fly)
          Length = 398

 Score = 93.9 bits (223), Expect = 4e-18
 Identities = 63/235 (26%), Positives = 116/235 (49%), Gaps = 13/235 (5%)
 Frame = +1

Query: 94  AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGIL 273
           A +V+DNG+   K G A  D P  V P+ + + + +       ++ ++VG++    R   
Sbjct: 4   AVVVLDNGAHTAKVGLANQDEPHVV-PNCIMKAKSE-------RRRAFVGNQIDECRDTS 55

Query: 274 TLKYPI--EHGIVTNWDDMEKIWHHTFYNE-LRVAPEEHPVLLTEAPLNPKANREKMTQI 444
            L Y +  + G + NW   + +W + F  + +  + E   +++TE  +N ++ +E   +I
Sbjct: 56  ALYYILAFQRGYLLNWHTQKTVWDYIFSKDGIGCSLENRNIVITEPQMNFQSIQEATLEI 115

Query: 445 MFETFNTPAMYVAIQAVLSLY-----ASGRTTG-----IVLDSGDGVSHTVPIYEGYALP 594
           +FE +    +Y    A L+ +     +  RTT      I++D G   +H VP   G  + 
Sbjct: 116 LFEEYKVDGVYKTTAADLAAFNYVADSEERTTMESLNCIIIDVGYSFTHVVPFVLGRRVL 175

Query: 595 HAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEM 759
             I R+D+ G+ LT+ L ++++ R        E  +V  IKE +C+VA DF+Q M
Sbjct: 176 QGIRRIDMGGKALTNQLKELISYR--HLNVMDESHVVNQIKEDVCFVAEDFKQAM 228


>UniRef50_Q54E71 Cluster: Putative uncharacterized protein; n=1;
           Dictyostelium discoideum AX4|Rep: Putative
           uncharacterized protein - Dictyostelium discoideum AX4
          Length = 684

 Score = 93.5 bits (222), Expect = 5e-18
 Identities = 61/221 (27%), Positives = 112/221 (50%), Gaps = 8/221 (3%)
 Frame = +1

Query: 100 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRH-QGVMVGMGQKDSYVGDEAQSKRGILT 276
           +++DNGS  C+AGFA D +P+ +F S+VG+ +     +VG   K+   GD ++     LT
Sbjct: 33  IIIDNGSYQCRAGFANDISPKLIFRSLVGKVKSTSSPIVGNSLKE---GDISR-----LT 84

Query: 277 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 456
           +K P +  ++ +    E I+ + F+        E+PVL+TE   NP   R+ M++++FE 
Sbjct: 85  IKSPFDSNLLVHPPSQESIFDYIFHKFGIENEIENPVLITEPTSNPTFCRKYMSELLFEC 144

Query: 457 FNTPAMYVAIQAVLSLYA------SGRTTGIVLDSGDGVSHTVPIYEGYALPH-AILRLD 615
           +N  ++   I ++ S Y        G    +++ S    +H   + + Y + H    R++
Sbjct: 145 YNIKSVVYGIDSLFSFYGQRDQFKDGGKNSLIIGSSFNTTHIYNV-QNYNVSHQQTKRIN 203

Query: 616 LAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVA 738
           + G   TDYL K++  +     +   +     IKE+ CYV+
Sbjct: 204 IGGGASTDYLRKLIHLKYPKHKSYFTQNYTNKIKEEHCYVS 244


>UniRef50_Q6BIA3 Cluster: CA5059|IPF3691 Candida albicans IPF3691;
           n=5; Saccharomycetales|Rep: CA5059|IPF3691 Candida
           albicans IPF3691 - Debaryomyces hansenii (Yeast)
           (Torulaspora hansenii)
          Length = 450

 Score = 93.5 bits (222), Expect = 5e-18
 Identities = 59/165 (35%), Positives = 85/165 (51%), Gaps = 3/165 (1%)
 Frame = +1

Query: 97  ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILT 276
           A+V+DNGS   KAGFA DD P  VF S      +  V VG    D  V +  +S   I+T
Sbjct: 7   AVVIDNGSHTTKAGFALDDLPSLVFNSNYVVDSNSKVQVG----DKQVDESPESD--IMT 60

Query: 277 LKYPIEHGIVTNWDDMEKIWHHTFYN---ELRVAPEEHPVLLTEAPLNPKANREKMTQIM 447
               +E+G++ N+D +   W + + N      +  +E P++LTE P N   N+   TQI 
Sbjct: 61  F---MENGLIYNFDSIVHNWQYVYDNIDNNNAINAKEFPLMLTEQPWNTSKNKLATTQIA 117

Query: 448 FETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEG 582
           FET   P   +    +  LY  GR+TG+V+D G  V+   PI +G
Sbjct: 118 FETLEVPIFSLVKTPLSQLYHMGRSTGLVVDIGSSVASVTPILDG 162


>UniRef50_UPI0000E46266 Cluster: PREDICTED: similar to actin; n=1;
           Strongylocentrotus purpuratus|Rep: PREDICTED: similar to
           actin - Strongylocentrotus purpuratus
          Length = 341

 Score = 93.1 bits (221), Expect = 7e-18
 Identities = 40/120 (33%), Positives = 73/120 (60%)
 Frame = +1

Query: 304 VTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVA 483
           VT+WD  E+I  H  + + ++   +HP++L E P   ++ R+KM ++ FE  + P  Y+A
Sbjct: 61  VTDWDSFEQIIQHAIWTKSKIKSSDHPLVLIEKPGLERSCRQKMVELAFEGLDVPEFYLA 120

Query: 484 IQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTE 663
            + V++LY+ G ++GIVL S    S+   I++G+  P+ ++ L   GRD+T Y M ++ +
Sbjct: 121 SEPVVALYSVGLSSGIVLSSSYMSSNVSTIHDGHRPPYGLVHLGFGGRDVTQYAMDLIKD 180


>UniRef50_Q19R52 Cluster: ALP5; n=6; Trypanosomatidae|Rep: ALP5 -
           Trypanosoma cruzi strain CL Brener
          Length = 422

 Score = 92.7 bits (220), Expect = 1e-17
 Identities = 68/215 (31%), Positives = 111/215 (51%), Gaps = 4/215 (1%)
 Frame = +1

Query: 97  ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVG-DEAQSKRGIL 273
           A +VD GS   + GFAGDD PR   P+ V +        G G++ S +   +A + R   
Sbjct: 27  AAIVDIGSYTTRIGFAGDDKPRVDEPTCVVK--------GTGKESSSLCLKKAYNCRATT 78

Query: 274 TLKYPIEHGIVTNWDDMEKIWHHTFYNEL-RVAPEE--HPVLLTEAPLNPKANREKMTQI 444
            +   IE G V +W+ ME++   ++ +EL +++ +E   P+LLTE  L P+  R+K+ +I
Sbjct: 79  EVSRVIEKGEV-DWEAMEQLL--SYLDELLQLSSKEVQTPLLLTEKMLVPRTQRQKLAEI 135

Query: 445 MFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAG 624
           + E     A++ A   VL+LYA+G  +G  ++ G    H VP+++GY L HA   L++ G
Sbjct: 136 LMEKHGVTAVHFAQSPVLALYAAGICSGTSVEMGYNACHVVPVFQGYPLFHATHMLNVGG 195

Query: 625 RDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLC 729
              T  +M    E           ++   +KEK C
Sbjct: 196 DLCTRQMMSTGPELPAMVHPNHRIDVWSHLKEKYC 230


>UniRef50_A3M088 Cluster: Vacuolar targeting, actin-related protein;
           n=5; Saccharomycetales|Rep: Vacuolar targeting,
           actin-related protein - Pichia stipitis (Yeast)
          Length = 775

 Score = 92.7 bits (220), Expect = 1e-17
 Identities = 58/228 (25%), Positives = 107/228 (46%), Gaps = 8/228 (3%)
 Frame = +1

Query: 100 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVM--VGMGQKDSYVGDEAQSKRGIL 273
           + +D G    K G      P  +FPS+  R R +  +  + +  KD Y     +S     
Sbjct: 43  IALDIGCSSFKIGLTNSPEPHNIFPSVAARYRDRKALKTLTLAGKDVYRDSLVRS----- 97

Query: 274 TLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPE---EHPVLLTEAPLNPKANREKMTQI 444
           ++K P +  +VTNWD ME +  ++  +   V       +P++LTE    P + R+ M +I
Sbjct: 98  SIKTPFDGPLVTNWDYMEVLLDYSLAHLGVVGDNGRLNNPLILTEPVGVPFSQRKNMYEI 157

Query: 445 MFETFNTPAMYVAIQAVLSLYA---SGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLD 615
           +FE +  P +   I ++ S YA   S   +G+V+ +G   +H +P+  G  +     R+D
Sbjct: 158 LFEAYQAPKVTFGIDSLFSFYANSTSSTASGLVIGTGHESTHVIPVLHGKGILSQTKRID 217

Query: 616 LAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEM 759
             G     +L K+L+ +   F +        ++    CYV+ D+++E+
Sbjct: 218 FGGHQAEQFLGKLLSLKYPYFPSKLNAHHTSNLFRDFCYVSKDYQEEI 265


>UniRef50_P80428 Cluster: Actin-related protein 4; n=4;
           Saccharomycetales|Rep: Actin-related protein 4 -
           Saccharomyces cerevisiae (Baker's yeast)
          Length = 489

 Score = 92.7 bits (220), Expect = 1e-17
 Identities = 57/192 (29%), Positives = 91/192 (47%), Gaps = 1/192 (0%)
 Frame = +1

Query: 85  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKR 264
           +EV+A+V+D GS     G++G D P+++ PS+ G+          G K  +        R
Sbjct: 12  DEVSAVVIDPGSYTTNIGYSGSDFPQSILPSVYGK-----YTADEGNKKIFSEQSIGIPR 66

Query: 265 GILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEH-PVLLTEAPLNPKANREKMTQ 441
               LK  IE+G+V +WD  ++ W     NEL +      P LLTE   N   NR+K  +
Sbjct: 67  KDYELKPIIENGLVIDWDTAQEQWQWALQNELYLNSNSGIPALLTEPVWNSTENRKKSLE 126

Query: 442 IMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLA 621
           ++ E     A Y+A  +    +A+GR   +V+D G       PI +G  L  +  R  +A
Sbjct: 127 VLLEGMQFEACYLAPTSTCVSFAAGRPNCLVVDIGHDTCSVSPIVDGMTLSKSTRRNFIA 186

Query: 622 GRDLTDYLMKIL 657
           G+ +   + K L
Sbjct: 187 GKFINHLIKKAL 198


>UniRef50_Q6CSB9 Cluster: Actin-related protein 4; n=1;
           Kluyveromyces lactis|Rep: Actin-related protein 4 -
           Kluyveromyces lactis (Yeast) (Candida sphaerica)
          Length = 520

 Score = 92.7 bits (220), Expect = 1e-17
 Identities = 56/195 (28%), Positives = 96/195 (49%), Gaps = 1/195 (0%)
 Frame = +1

Query: 85  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKR 264
           +E+ A+V+D GS +   G++G D P+++ PS  G     G       K  +        R
Sbjct: 12  DEINAIVIDPGSFVTNIGYSGTDCPQSIMPSSYGNVETDG-----DTKRIFNEQPLLFPR 66

Query: 265 GILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEH-PVLLTEAPLNPKANREKMTQ 441
             + +K  +E+  + +WD  ++ W +    +L+    +  PVLLTE   N +A+R+K  +
Sbjct: 67  AGMEIKPIVENSTIVDWDRAQEQWEYALNTDLKFESNKGTPVLLTEPIWNSEASRKKSLE 126

Query: 442 IMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLA 621
           I+ E+    A Y+A  +    +A GR T +V+D G  VS   P+ +G  L  +  R  +A
Sbjct: 127 ILLESMEFEACYLAANSSAVSFAMGRPTCLVVDIGHDVSTVSPVIDGMTLSKSSTRNYVA 186

Query: 622 GRDLTDYLMKILTER 666
           G+ L   + K L  R
Sbjct: 187 GKYLNHLIAKNLKPR 201


>UniRef50_Q5KLG9 Cluster: 53 kDa brg1-associated factor b
           (Actin-related protein baf53b), putative; n=1;
           Filobasidiella neoformans|Rep: 53 kDa brg1-associated
           factor b (Actin-related protein baf53b), putative -
           Cryptococcus neoformans (Filobasidiella neoformans)
          Length = 476

 Score = 91.5 bits (217), Expect = 2e-17
 Identities = 52/151 (34%), Positives = 80/151 (52%), Gaps = 2/151 (1%)
 Frame = +1

Query: 214 GMGQKDSYVGDEAQS--KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPV 387
           G G+K  YVG++  S  + G+    + ++ G+V + +    + HH  +  L V PEEHP+
Sbjct: 85  GSGRK-YYVGEDGVSVWRPGMEVGNFMLD-GVVNDPEPASALLHHILHERLGVNPEEHPI 142

Query: 388 LLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTV 567
           ++TE   N    R+ MT++ FE    PA+Y     VLS +A+G+ T +VLD G   S  V
Sbjct: 143 MITEPAWNTPKARQVMTEMAFEGEKMPALYFGSSGVLSAFAAGKPTALVLDVGYATSSAV 202

Query: 568 PIYEGYALPHAILRLDLAGRDLTDYLMKILT 660
           PI +GYAL    +   LA + +   L    T
Sbjct: 203 PIVDGYALRAGTMHQPLASQLIVSQLQNHFT 233



 Score = 44.4 bits (100), Expect = 0.003
 Identities = 26/74 (35%), Positives = 38/74 (51%), Gaps = 2/74 (2%)
 Frame = +1

Query: 85  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKR 264
           +EV+ALV+D GS   +AG+AG+D PR V PS  G           G   + VG+   +K 
Sbjct: 6   DEVSALVLDFGSYTTRAGYAGEDCPRVVCPSFYGYTNDPS---SSGSNGNSVGENGANKE 62

Query: 265 G--ILTLKYPIEHG 300
               +T+  P+  G
Sbjct: 63  NGEDVTMAEPVPEG 76


>UniRef50_Q9LZY1 Cluster: Actin-like protein; n=4; core
           eudicotyledons|Rep: Actin-like protein - Arabidopsis
           thaliana (Mouse-ear cress)
          Length = 368

 Score = 91.1 bits (216), Expect = 3e-17
 Identities = 62/154 (40%), Positives = 81/154 (52%), Gaps = 2/154 (1%)
 Frame = +1

Query: 97  ALVVDNGSGMCKAGFA-GDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGIL 273
           ALVVD GS   KAG A  D +P  + PS + R      MV  G   +   D   +    +
Sbjct: 3   ALVVDAGSKFLKAGAAIPDQSPAMIIPSQMKR------MVDDGSSSA---DNPTTVFEDV 53

Query: 274 TLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAP-EEHPVLLTEAPLNPKANREKMTQIMF 450
           TL  PIE G++ +WD ME +  +  Y  L      E  +L T+    PKA RE++ Q+MF
Sbjct: 54  TLD-PIERGLIRDWDAMEDLLRYVVYTGLGWEEGNEGNILFTDPLCTPKAIREQLVQLMF 112

Query: 451 ETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDG 552
           ETFN    Y + QAVLSLYA GR +G  +D G G
Sbjct: 113 ETFNVSGFYASEQAVLSLYAVGRISGCTVDIGHG 146


>UniRef50_Q7QA11 Cluster: ENSANGP00000003921; n=1; Anopheles gambiae
           str. PEST|Rep: ENSANGP00000003921 - Anopheles gambiae
           str. PEST
          Length = 390

 Score = 91.1 bits (216), Expect = 3e-17
 Identities = 54/202 (26%), Positives = 110/202 (54%), Gaps = 5/202 (2%)
 Frame = +1

Query: 100 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGI-LT 276
           +V+DNGS  C+AG+   + P  VF +I+ +PR         +KD  +G++  +   + L 
Sbjct: 5   IVIDNGSFNCRAGWMLKEKPALVFRNILAKPRKD-----RNKKDIEIGNDIVNIEALRLQ 59

Query: 277 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEE---HPVLLTEAPLNPKANREKMTQIM 447
           L+   +  +VT+++  E+I+ + F  +L +  E    H V++TE   NP   R  M++++
Sbjct: 60  LRTQFDRNVVTHYNVQEQIFDYIF-TKLGINSENSVPHKVMITECLFNPNYCRSLMSELL 118

Query: 448 FETFNTPAMYVAIQAVLSLYASGR-TTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAG 624
           FE ++ P +   + ++LS +++ R  +G+++ +G   +H VP+  G  +   I R+++ G
Sbjct: 119 FECYDIPGLSYGVDSLLSFHSNQRGKSGLIIATGYHTTHVVPVLNGRMVVENIRRINIGG 178

Query: 625 RDLTDYLMKILTERGYSFTTTA 690
             +  +L + L +  Y+F   A
Sbjct: 179 SHMIAFLHRCL-QLKYTFHLNA 199


>UniRef50_Q22XS7 Cluster: Actin family protein; n=1; Tetrahymena
           thermophila SB210|Rep: Actin family protein -
           Tetrahymena thermophila SB210
          Length = 725

 Score = 89.8 bits (213), Expect = 7e-17
 Identities = 62/233 (26%), Positives = 121/233 (51%), Gaps = 13/233 (5%)
 Frame = +1

Query: 100 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTL 279
           L+VDNGS   + G A ++ P   + +++G  R  G ++     ++Y+ DEA     ++ +
Sbjct: 12  LIVDNGSWEIRLGSALNEVPNLTYYNLLGIDRKNGNLLCGENLNNYI-DEA----NLIYV 66

Query: 280 KYPIEHGIVTNWDDMEKIWH-----HTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQI 444
           K P   G+V +WD    +W       T +   +   + + + +   P  P   R++M ++
Sbjct: 67  K-PQVRGVVVDWDHEVHLWEKMLDAQTEFESKQNELQSYSISILHNPCVPDKVRQRMIEV 125

Query: 445 MFETFNTPAMYVAI-QAVLSLYASGR-------TTGIVLDSGDGVSHTVPIYEGYALPHA 600
            FE F   A+Y A+ Q +  ++A  +       T  +V++ G   ++ VP ++G  + +A
Sbjct: 126 CFEYFGFDAIYPALSQQMSQIHALDKYNKKISDTFQLVIEIGHSATYFVPFFDGQPINYA 185

Query: 601 ILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEM 759
           I RLD+ G+ LT++L +I+T R        E  +V  IKE +C+V+ +F++++
Sbjct: 186 IKRLDVGGKLLTNHLKEIITCRYIQLKN--EIRMVSQIKEDMCFVSQNFQKDI 236


>UniRef50_Q0IFH2 Cluster: Actin; n=4; Endopterygota|Rep: Actin -
           Aedes aegypti (Yellowfever mosquito)
          Length = 400

 Score = 89.0 bits (211), Expect = 1e-16
 Identities = 64/242 (26%), Positives = 119/242 (49%), Gaps = 11/242 (4%)
 Frame = +1

Query: 76  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 255
           M D +V   ++DNG+   K G +  DAP+ V   I      +        +  ++G++ +
Sbjct: 1   MSDGDV--FILDNGAFYAKLGMSDWDAPKTVLNCITKAKSER--------RRPFIGNQIE 50

Query: 256 SKRGILTLKYPI--EHGIVTNWDDMEKIWHHTFYNEL-RVAPEEHPVLLTEAPLNPKANR 426
             R +  L Y +  + G + NWD  + +W + F ++   V   E P+L+TE   N ++ +
Sbjct: 51  ECRDVSGLFYILCFQRGYLVNWDIQKTVWDYMFSSDCCPVNFSETPLLITEPLFNFQSIQ 110

Query: 427 EKMTQIMFETFNTPAMY----VAIQAVLSLYASGRTTG----IVLDSGDGVSHTVPIYEG 582
           E M +I++E ++  A+     V + A   ++     T     +V+D G   +H VP  +G
Sbjct: 111 EAMLEILYEEYDCDAVCKTNSVDLVAFNYVHEENHKTRPLCCLVVDMGYSFTHVVPFVKG 170

Query: 583 YALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMA 762
                AI R+D+ G+ LT++L +I++ R        E  ++  +KE  C+V+ DF ++M 
Sbjct: 171 VKQKEAIRRIDVGGKLLTNHLKEIISYR--QLNVMDESYVINQVKEDSCFVSQDFNEDMR 228

Query: 763 TA 768
            A
Sbjct: 229 IA 230


>UniRef50_Q0V0G6 Cluster: Putative uncharacterized protein; n=1;
           Phaeosphaeria nodorum|Rep: Putative uncharacterized
           protein - Phaeosphaeria nodorum (Septoria nodorum)
          Length = 443

 Score = 88.2 bits (209), Expect = 2e-16
 Identities = 68/235 (28%), Positives = 113/235 (48%), Gaps = 22/235 (9%)
 Frame = +1

Query: 100 LVVDNGSGMCKAGF--AGDDAPR----AVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 261
           LV+DNG+   KAG+  +  +AP      V P+ + R            K +YVG +    
Sbjct: 18  LVLDNGAYAIKAGYVPSASEAPTYDDCRVIPNCIARSTRD--------KCTYVGSDLDGC 69

Query: 262 R--GILTLKYPIEHGIVTNWDDMEKIWHHTFYNE-----LRVAPEEHPVLLTEAPLNPKA 420
           +  G L  + P+E G + NW+  + IW H F         R  P+E  +LLTE P  PK 
Sbjct: 70  KDFGELAFRRPVEKGFIVNWEAEKAIWEHEFMEAAVVEGFRCDPKETNLLLTEKPNCPKE 129

Query: 421 NREKMTQIMFETFNTPAMYVAIQAVLSLY--ASGRTTG-------IVLDSGDGVSHTVPI 573
            ++   +I+FE F   + Y  +   L+ Y  AS  +         +++D+    +  +P+
Sbjct: 130 LQKNCDEIVFEQFEFASYYRCVGPRLNAYHPASPESLSSLPQECLLIIDTSYSDTTILPL 189

Query: 574 YEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVA 738
           Y G  +  A+ RL + G+ LT+YL ++ + R Y+     E  ++ +IKE + YVA
Sbjct: 190 YSGRLIQSAVRRLTVGGKLLTNYLRELASLRHYNL--MEETYLLNEIKEAVSYVA 242


>UniRef50_Q6C0A9 Cluster: Yarrowia lipolytica chromosome F of strain
           CLIB122 of Yarrowia lipolytica; n=1; Yarrowia
           lipolytica|Rep: Yarrowia lipolytica chromosome F of
           strain CLIB122 of Yarrowia lipolytica - Yarrowia
           lipolytica (Candida lipolytica)
          Length = 427

 Score = 87.0 bits (206), Expect = 5e-16
 Identities = 50/191 (26%), Positives = 95/191 (49%), Gaps = 3/191 (1%)
 Frame = +1

Query: 85  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKR 264
           +EV ++V++ GS   + GF+GDD P+ V P+  G+  +       G+ D Y        R
Sbjct: 18  DEVTSIVIECGSSYTRVGFSGDDLPKVVIPTKYGKYTND-----KGE-DVYEFGLENVHR 71

Query: 265 GIL--TLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAP-EEHPVLLTEAPLNPKANREKM 435
            +    +  P++ G + +WD + K+W +    +L+V    E+P+++TE   N  A R K+
Sbjct: 72  PVAGKEIYSPVQDGCIQDWDGVAKLWEYAIKEKLKVDDLSEYPLVITEQMWNSSARRAKI 131

Query: 436 TQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLD 615
            ++ F+ F +PA+      + + YA+ R   I+++ G  V+    + +G  +  A     
Sbjct: 132 AEMCFDKFRSPAISFVKNPLCTAYAAVRPNSIIVEIGSAVASVSTVLDGNVVTKASFHSK 191

Query: 616 LAGRDLTDYLM 648
             G D  +YL+
Sbjct: 192 FGG-DFLNYLI 201


>UniRef50_Q9VEC3 Cluster: Actin-related protein 5; n=1; Drosophila
           melanogaster|Rep: Actin-related protein 5 - Drosophila
           melanogaster (Fruit fly)
          Length = 648

 Score = 87.0 bits (206), Expect = 5e-16
 Identities = 54/240 (22%), Positives = 112/240 (46%), Gaps = 20/240 (8%)
 Frame = +1

Query: 100 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS------------YVG 243
           LV+DNGS  C+ G++    P   F +++ +PR          + S             VG
Sbjct: 7   LVIDNGSYECRVGWSDSKEPDLRFRNVLTKPRKDRKKEAAASEGSASQTTVEQSAEIQVG 66

Query: 244 DEAQSKRGILT-LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPE--EHPVLLTEAPLNP 414
           ++  +   +   LK P E  ++TNW+  E+I+ + F        +  +HP++LTEA  NP
Sbjct: 67  NDITNIEAVRAHLKSPFERNVITNWNHQEQIFDYIFTKMGFDGQDKIDHPIILTEALANP 126

Query: 415 KANREKMTQIMFETFNTPAMYVAIQAVLS-----LYASGRTTGIVLDSGDGVSHTVPIYE 579
              R++M +++FE +  P++   I A+ S           +  +++  G   +H +P+ +
Sbjct: 127 NFCRQQMNELLFECYGIPSVSYGIDALYSWKHHQQKQKNISDALIISFGYSTTHVIPVLD 186

Query: 580 GYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEM 759
           G      + RL++ G  +  YL +++  +            +  +  + C++A+D+++E+
Sbjct: 187 GKLQLEHVRRLNVGGYHIITYLFRLMQMKYPVHLNAITISRMEKLVHEHCHIAVDYKEEL 246


>UniRef50_Q7SXV8 Cluster: ARP5 actin-related protein 5 homolog; n=6;
           Euteleostomi|Rep: ARP5 actin-related protein 5 homolog -
           Danio rerio (Zebrafish) (Brachydanio rerio)
          Length = 592

 Score = 86.6 bits (205), Expect = 6e-16
 Identities = 60/230 (26%), Positives = 113/230 (49%), Gaps = 10/230 (4%)
 Frame = +1

Query: 100 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGIL-T 276
           +VVDNGS  C+AG++   AP    P +V RP       G  +  + VG++  +   +  T
Sbjct: 35  VVVDNGSFQCRAGWSSG-APELDNPRLVFRPAAARSR-GAARGGAQVGNDIPNPEPLRWT 92

Query: 277 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPE---EHPVLLTEAPLNPKANREKMTQIM 447
           LK   +   V N+D  E ++ + F + L +  +   EHP+++TE   NP   R+ M++++
Sbjct: 93  LKSAFDRDTVVNFDIQELVFDYIFMH-LGINTQGRVEHPLVVTEPACNPLQCRQMMSELL 151

Query: 448 FETFNTPAMYVAIQAVLSLY------ASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILR 609
           FE +  P +   + ++ SL+      A   +T +VL SG   SH +P+  G        R
Sbjct: 152 FECYGVPRVAYGVDSLFSLHQNSSADAGAPSTALVLSSGHHCSHVLPVINGRLDAVNCKR 211

Query: 610 LDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEM 759
           ++L G     Y  ++L  +  +   +     + ++  +  Y+A+D++ E+
Sbjct: 212 VNLGGGQAAAYYQRLLQLKYPANQASITLSRMEELLHQHSYIAVDYQNEL 261


>UniRef50_Q9GZN1 Cluster: Actin-related protein 6; n=26;
           Chordata|Rep: Actin-related protein 6 - Homo sapiens
           (Human)
          Length = 396

 Score = 86.2 bits (204), Expect = 8e-16
 Identities = 60/232 (25%), Positives = 113/232 (48%), Gaps = 6/232 (2%)
 Frame = +1

Query: 91  VAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGI 270
           +  LV+DNG+   K G++ ++   +V P+   R +   +      +     DE +   G+
Sbjct: 1   MTTLVLDNGAYNAKIGYSHENV--SVIPNCQFRSKTARLKTFTANQI----DEIKDPSGL 54

Query: 271 LTLKYPIEHGIVTNWDDMEKIWHHTFYNEL-RVAPEEHPVLLTEAPLNPKANREKMTQIM 447
             +  P + G + NWD   ++W + F  E+ +V   +  +++TE   N  + +E M +I+
Sbjct: 55  FYI-LPFQKGYLVNWDVQRQVWDYLFGKEMYQVDFLDTNIIITEPYFNFTSIQESMNEIL 113

Query: 448 FETFNTPAMYVAIQAVLSLYASGRTTG-----IVLDSGDGVSHTVPIYEGYALPHAILRL 612
           FE +   A+       LS +   R        I++DSG   +H VP         AI+R+
Sbjct: 114 FEEYQFQAVLRVNAGALSAHRYFRDNPSELCCIIVDSGYSFTHIVPYCRSKKKKEAIIRI 173

Query: 613 DLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATA 768
           ++ G+ LT++L +I++ R        E  ++  +KE +CYV+ DF ++M  A
Sbjct: 174 NVGGKLLTNHLKEIISYR--QLHVMDETHVINQVKEDVCYVSQDFYRDMDIA 223


>UniRef50_Q5C3R3 Cluster: SJCHGC08022 protein; n=1; Schistosoma
           japonicum|Rep: SJCHGC08022 protein - Schistosoma
           japonicum (Blood fluke)
          Length = 209

 Score = 84.6 bits (200), Expect = 3e-15
 Identities = 57/168 (33%), Positives = 92/168 (54%), Gaps = 9/168 (5%)
 Frame = +1

Query: 100 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPR-HQGVMVGMGQKDSYVGDEAQSKRGILT 276
           +V+DNG+  C+AG++  + P   FP++V RPR  +GV+VG   +D       +S R   +
Sbjct: 39  IVIDNGNFECRAGYSNFEKPHMTFPNVVYRPRMSKGVLVGNDIQD------LESVRH--S 90

Query: 277 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVA-PEEHPVLLTEAPLNPKANREKMTQIMFE 453
           LK P    +V N D  E++  H F ++L V  P  +PV++ EA  NP   R ++T+++FE
Sbjct: 91  LKSPFIDNLVINLDVQEQVISHIF-DKLNVQKPLSNPVVINEALCNPGVCRSQLTELLFE 149

Query: 454 TFNTPAMYVAIQAVLSLYASGRTTGIVLDS-------GDGVSHTVPIY 576
           +FNTP +   +    S Y   R+  I L++       G   +H VPI+
Sbjct: 150 SFNTPKLMYYVDCFASYYNFQRSGNIDLNANCLLISVGYQRTHIVPIF 197


>UniRef50_A1C924 Cluster: Actin family protein; n=4;
           Eurotiomycetidae|Rep: Actin family protein - Aspergillus
           clavatus
          Length = 436

 Score = 84.2 bits (199), Expect = 3e-15
 Identities = 66/255 (25%), Positives = 123/255 (48%), Gaps = 36/255 (14%)
 Frame = +1

Query: 103 VVDNGSGMCKAGFAGDDAPR----------AVFPSIVGRPRHQGVMVGMGQKDSYVGDEA 252
           ++DNG+   KAG+A +  P           ++ P+ + + R   + +G  Q  + V D  
Sbjct: 26  IIDNGAYTLKAGYASESPPTNDIDQALSACSIIPNAIAKTRGNRIYIG-AQLSTQVTDWN 84

Query: 253 QSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNE-------LRVA-PEEHPVLLTEAPL 408
           +     +  + P+E G + NW+  ++IW  +F++E       LR+  PE+  ++LTEAP 
Sbjct: 85  E-----MAFRRPVEKGYIVNWEAQKEIWETSFFDEKTVRSKDLRIENPEDTTLVLTEAPN 139

Query: 409 NPKANREKMTQIMFETFNTPAMYVAIQAVL-------SLYAS--GRTTG---------IV 534
                +    +I+ E +        + + L       SL+    G+  G         +V
Sbjct: 140 ALPTLQRNADEIVMEEWGFGGYLRCVGSSLNAWNDLQSLFGDPVGQEPGPLVSPKECLLV 199

Query: 535 LDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDI 714
           +DSG   +   P+Y G  L  AI RLD+ G+ LT+YL ++++ R Y+     E  I+ ++
Sbjct: 200 VDSGYSHTTVTPLYRGQPLQRAIRRLDIGGKHLTNYLKEMVSMRQYNMVD--ETYIMNEV 257

Query: 715 KEKLCYVALDFEQEM 759
           KE +C+V+ +F  ++
Sbjct: 258 KEAVCFVSNNFANDL 272


>UniRef50_Q293V2 Cluster: Actin-related protein 5; n=2; Drosophila
           pseudoobscura|Rep: Actin-related protein 5 - Drosophila
           pseudoobscura (Fruit fly)
          Length = 651

 Score = 83.8 bits (198), Expect = 4e-15
 Identities = 58/243 (23%), Positives = 116/243 (47%), Gaps = 23/243 (9%)
 Frame = +1

Query: 100 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQ-----------GVMVGMGQK---DSY 237
           LV+DNGS  C+ G+     P   F +++ +PR             G    +  +   +  
Sbjct: 8   LVIDNGSYECRVGWNNTKEPALRFRNVLTKPRKDRKKEAIPDTTDGAPTPVAAEVPAEIQ 67

Query: 238 VGDEAQSKRGILT-LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEE---HPVLLTEAP 405
           VG++  +   +   LK P E  I+TNW+  E+I+ + F  ++    E+   +P++LTEA 
Sbjct: 68  VGNDITNIEAVRAHLKSPFERNIITNWNHQEQIFDYIF-TKMGFEGEQSIANPIVLTEAL 126

Query: 406 LNPKANREKMTQIMFETFNTPAMYVAIQAVLSL--YASGR---TTGIVLDSGDGVSHTVP 570
            NP   R+ M++++FE +  PA+   I A+ S   Y + R   +  +++  G   +H +P
Sbjct: 127 ANPNFCRQNMSELLFECYGIPAVSYGIDALYSWEHYQNRRKKVSDALIISLGYSTTHVIP 186

Query: 571 IYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFE 750
           +  G      + RL++ G  +  YL+ ++  +            +  +  + C++A+D+ 
Sbjct: 187 VLNGKLQLQHVRRLNVGGYHIITYLLCLMQMKYPVHLNAISISRMEKLVHEHCHIAVDYR 246

Query: 751 QEM 759
           +E+
Sbjct: 247 EEL 249


>UniRef50_Q4P303 Cluster: Putative uncharacterized protein; n=1;
            Ustilago maydis|Rep: Putative uncharacterized protein -
            Ustilago maydis (Smut fungus)
          Length = 1173

 Score = 83.4 bits (197), Expect = 6e-15
 Identities = 58/231 (25%), Positives = 108/231 (46%), Gaps = 11/231 (4%)
 Frame = +1

Query: 100  LVVDNGSGMCKAGFAGDDA---------PRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA 252
            +++DNGS   +AGFA   A         P   + +++ + R +     M    + V  + 
Sbjct: 424  IIIDNGSSELRAGFALSHAADPTSFSQQPFVAYDNLISKVRDRKKSFTMLLVGNDVYADG 483

Query: 253  QSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYN-ELRVAPEEHPVLLTEAPLNPKANRE 429
             S+  I   + P +  +VT+WD ME +  +TF N  +     +HP+ +TE   NP  +R 
Sbjct: 484  LSRSSI---RSPFDTDVVTSWDAMEIVLDYTFSNLGIDTDRVQHPICMTETLCNPAYSRG 540

Query: 430  KMTQIMFETFNTPAMYVAIQAVLSLYASG-RTTGIVLDSGDGVSHTVPIYEGYALPHAIL 606
             M ++MFE +  P++   I  + S Y +      +V+ SG   +  +P   G  +     
Sbjct: 541  IMNELMFEAYQVPSVNYGIDCLFSAYQNEVGQDALVVSSGRSSTVVIPTVAGKGILTNSK 600

Query: 607  RLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEM 759
            RL   G   +D L++++  +   F T       +++ E+LCYV+ D+  ++
Sbjct: 601  RLAWGGAQASDLLLRLIQLKYPGFPTRVTPWQAQNMLEELCYVSDDYASDI 651


>UniRef50_Q9H9F9 Cluster: Actin-related protein 5; n=19;
           Euteleostomi|Rep: Actin-related protein 5 - Homo sapiens
           (Human)
          Length = 607

 Score = 82.6 bits (195), Expect = 1e-14
 Identities = 65/235 (27%), Positives = 115/235 (48%), Gaps = 15/235 (6%)
 Frame = +1

Query: 100 LVVDNGSGMCKAGFA--GDDA---PRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKR 264
           LV+DNGS   +AG+A  G D    PR  F ++  R R        G     VG+   S  
Sbjct: 33  LVLDNGSFQVRAGWACPGQDPGPEPRLQFRAVCARGRGGA----RGASGPQVGNALGSLE 88

Query: 265 GIL-TLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPE---EHPVLLTEAPLNPKANREK 432
            +   L+ P +  +  N +  E +  ++F + L V+ +   +HP++LTEA  NP  +R+ 
Sbjct: 89  PLRWMLRSPFDRNVPVNLELQELLLDYSFQH-LGVSSQGCVDHPIVLTEAVCNPLYSRQM 147

Query: 433 MTQIMFETFNTPAMYVAIQAVLSLY----ASGRTTGIVLDSGDGVSHTVPIYEGYALPHA 600
           M++++FE +  P +   I ++ S Y     +   +G+++ SG   +H +PI EG      
Sbjct: 148 MSELLFECYGIPKVAYGIDSLFSFYHNKPKNSMCSGLIISSGYQCTHVLPILEGRLDAKN 207

Query: 601 ILRLDLAGRDLTDYLMKILTER--GYSFTTTAEREIVRDIKEKLCYVALDFEQEM 759
             R++L G     YL ++L  +  G+    T  R  + +I  +  Y+A D+ +E+
Sbjct: 208 CKRINLGGSQAAGYLQRLLQLKYPGHLAAITLSR--MEEILHEHSYIAEDYVEEL 260


>UniRef50_Q6BXN0 Cluster: Actin-related protein 4; n=7;
           Saccharomycetales|Rep: Actin-related protein 4 -
           Debaryomyces hansenii (Yeast) (Torulaspora hansenii)
          Length = 492

 Score = 82.2 bits (194), Expect = 1e-14
 Identities = 49/201 (24%), Positives = 98/201 (48%), Gaps = 7/201 (3%)
 Frame = +1

Query: 85  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMV------GMGQKDSYVGD 246
           +E+ A+V+D+ S   + G+AGDD P+ + PS    P    + +      G  +     G+
Sbjct: 14  DEINAIVLDSSSFHTRIGYAGDDFPKIITPSSYASPNEDAMELDNKKKNGKSKSSKIFGE 73

Query: 247 EAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANR 426
                R    +   ++  ++ +W+   + +H+ F + L +  +E P+L+TE        R
Sbjct: 74  SINIPRSNHNVSPILKDSVIIDWEAAIEQYHYYFDDVLTLNYKEQPILITEPVWCTPQYR 133

Query: 427 EKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSG-DGVSHTVPIYEGYALPHAI 603
           + + +  +E F+ PA+++A       +  GR   +V+D G D VS T P+ +G +L    
Sbjct: 134 QTLLETFYENFDFPALFLAKSPTCISFQQGRPNCLVVDIGHDSVSVT-PVIDGISLLKNS 192

Query: 604 LRLDLAGRDLTDYLMKILTER 666
           ++ +  G+ L D +  +LT +
Sbjct: 193 MKTNYGGQYLNDQIEDMLTHK 213


>UniRef50_A7TST0 Cluster: Putative uncharacterized protein; n=1;
           Vanderwaltozyma polyspora DSM 70294|Rep: Putative
           uncharacterized protein - Vanderwaltozyma polyspora DSM
           70294
          Length = 501

 Score = 81.8 bits (193), Expect = 2e-14
 Identities = 55/207 (26%), Positives = 98/207 (47%), Gaps = 13/207 (6%)
 Frame = +1

Query: 85  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMV-GMGQKDSYVGDEAQSK 261
           +E++A+V+D GS     G++G D P+A+ PS  G    + V   G  + +       +SK
Sbjct: 12  DEISAVVIDPGSFTTNIGYSGTDCPQAILPSYYGEISLKEVASEGNEEIEENSASNNKSK 71

Query: 262 R--GILTLKYP---------IEHGIVTNWDDMEKIWHHTFYNELRVAPEEH-PVLLTEAP 405
           +  G  ++ YP         +++G V +WD  ++ W     N L +      P  LTE  
Sbjct: 72  KIFGEQSINYPRADYEIKPIVKNGEVIDWDGAQEQWDWALKNALYLESNSGIPAFLTEPI 131

Query: 406 LNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGY 585
            N   NR+K  +++ E     A Y++       +ASGR   +V+D G  V+   P+ +G 
Sbjct: 132 WNTVENRKKSLEVLLEGLQFEACYLSPTPTCISFASGRPNCLVVDIGHDVASVSPVIDGM 191

Query: 586 ALPHAILRLDLAGRDLTDYLMKILTER 666
            L  + +R  ++GR + + + + L  R
Sbjct: 192 TLSKSSMRNFISGRFINEKIKEFLKPR 218


>UniRef50_Q09443 Cluster: Actin-like protein C08B11.6; n=2;
           Caenorhabditis|Rep: Actin-like protein C08B11.6 -
           Caenorhabditis elegans
          Length = 418

 Score = 81.8 bits (193), Expect = 2e-14
 Identities = 57/230 (24%), Positives = 107/230 (46%), Gaps = 4/230 (1%)
 Frame = +1

Query: 91  VAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGI 270
           +  ++ DNG    K G    ++PR V  SIV + +H+   V +  +     +E   K  +
Sbjct: 3   LTTIIFDNGGHNMKIGTIDSESPRLVPNSIV-KAKHEKKRVFVAHEQ----EECSDKFSL 57

Query: 271 LTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMF 450
             ++ PIE G V NWD  ++IW  TF   + V      + LT+      A  +  ++I+F
Sbjct: 58  FYVR-PIERGYVVNWDTQQQIWEKTF-GSMDVEASTSRIALTDNNYLIPALPDVSSEILF 115

Query: 451 ETFNTPAMYVAIQAVLSLYASGRTT----GIVLDSGDGVSHTVPIYEGYALPHAILRLDL 618
           + F    ++    + L    S +       +V+DSG   +       G  +  +++R+D+
Sbjct: 116 DYFGFTEVHKTSASTLVAKHSNKINNEKCAVVVDSGFSWTTVASFVNGMLIQDSVIRIDV 175

Query: 619 AGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATA 768
            G+ LT+ L   ++ R      + E  ++ + KE LC+V+ +F++ M  A
Sbjct: 176 GGKALTNKLKDWVSYR--QLNVSEETYVINECKEDLCFVSQNFDESMKEA 223


>UniRef50_Q6SQL6 Cluster: Actin; n=1; Pandalus platyceros|Rep: Actin
           - Pandalus platyceros
          Length = 179

 Score = 81.4 bits (192), Expect = 2e-14
 Identities = 55/114 (48%), Positives = 70/114 (61%), Gaps = 2/114 (1%)
 Frame = +1

Query: 451 ETFNTPAMYVAIQAVLSLYASGRTTGIVLD-SGDGVSHT-VPIYEGYALPHAILRLDLAG 624
           E+F+TPAMY    + LS  ++     +V   +   VS T  P   G+ALPHAIL L    
Sbjct: 1   ESFSTPAMYCISASRLSSPSTPLAIPLVSSVTLLMVSPTWCPSMIGFALPHAILVLTWL- 59

Query: 625 RDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL 786
                    ++TE+ YSFTT AEREIV DIKEKLCY+ALD+  EM TAA+SSS+
Sbjct: 60  ---------VVTEKSYSFTTIAEREIVCDIKEKLCYIALDYGSEMNTAAASSSI 104


>UniRef50_A6R1X8 Cluster: Putative uncharacterized protein; n=1;
           Ajellomyces capsulatus NAm1|Rep: Putative
           uncharacterized protein - Ajellomyces capsulatus NAm1
          Length = 444

 Score = 81.0 bits (191), Expect = 3e-14
 Identities = 64/222 (28%), Positives = 106/222 (47%), Gaps = 35/222 (15%)
 Frame = +1

Query: 85  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYV-GDEAQ-S 258
           +EV+A+++D G    +AGFAG+D P++V P+  G+            +D Y+ GD    +
Sbjct: 15  DEVSAIILDPGYSTVRAGFAGEDTPKSVIPTCYGK-------YTTDAQDKYIYGDSIYVT 67

Query: 259 KRGILTLKYPI-EHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVL--------------- 390
            R  L++  P+   GIV +WD  EK+W ++F + L      +P+                
Sbjct: 68  PRPGLSIHNPMGREGIVEDWDAAEKVWEYSFTSRLTGPKSGNPLFNGLNDTANGDLPAEM 127

Query: 391 ---------LTEAPL-------NPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRT 522
                    L ++PL       NP   REK  +I  E + TPA Y+A    L+ +ASG+ 
Sbjct: 128 DVVEAEEKPLADSPLLMTECGWNPVKAREKTIEIAMEKWGTPAFYLARNGPLAAFASGKA 187

Query: 523 TGIVLDSG-DGVSHTVPIYEGYALPHAILRLDLAGRDLTDYL 645
           + +V+D G  GVS T P+++G  L   +    L G  ++  +
Sbjct: 188 SALVVDVGASGVSIT-PVHDGLVLKRGVQHSPLGGEFISSQI 228


>UniRef50_Q12406 Cluster: Actin-related protein 7; n=2;
           Saccharomyces cerevisiae|Rep: Actin-related protein 7 -
           Saccharomyces cerevisiae (Baker's yeast)
          Length = 477

 Score = 81.0 bits (191), Expect = 3e-14
 Identities = 47/185 (25%), Positives = 88/185 (47%), Gaps = 4/185 (2%)
 Frame = +1

Query: 100 LVVDNGSGMCKAGFAGDDAPRAVFPS-IVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILT 276
           +V+ NGS    AGF+  + P+ + PS  + R    G    +    + +   A+ + G   
Sbjct: 8   VVIHNGSHRTVAGFSNVELPQCIIPSSYIKRTDEGGEAEFIFGTYNMIDAAAEKRNGDEV 67

Query: 277 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPK---ANREKMTQIM 447
                  G+  NWD +E  W + +  +L+V+PEE P+++T    N K   A  E+  ++ 
Sbjct: 68  YTLVDSQGLPYNWDALEMQWRYLYDTQLKVSPEELPLVITMPATNGKPDMAILERYYELA 127

Query: 448 FETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGR 627
           F+  N P   + I+ +    + G+++  V+D G    +  PI +G  + +A++R    G 
Sbjct: 128 FDKLNVPVFQIVIEPLAIALSMGKSSAFVIDIGASGCNVTPIIDGIVVKNAVVRSKFGG- 186

Query: 628 DLTDY 642
           D  D+
Sbjct: 187 DFLDF 191


>UniRef50_A6RD01 Cluster: Putative uncharacterized protein; n=1;
           Ajellomyces capsulatus NAm1|Rep: Putative
           uncharacterized protein - Ajellomyces capsulatus NAm1
          Length = 762

 Score = 80.6 bits (190), Expect = 4e-14
 Identities = 57/227 (25%), Positives = 109/227 (48%), Gaps = 10/227 (4%)
 Frame = +1

Query: 94  AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ---SKR 264
           +A+V+DNGS + KAG++ D +PR + P ++ + R +       +   +VG +A    + R
Sbjct: 111 SAIVIDNGSYLVKAGWSFDKSPRFIIPPVMAKYRDRK----FNRTCHFVGYDAYVDATTR 166

Query: 265 GILTLKYPIEHGIVTNWDDMEKIWHHTFYN---ELRVAPEEHPVLLTEAPLNPKANREKM 435
           G +   +     ++ NWD ME +  + F     +      + P++LTE   N    R  M
Sbjct: 167 GQVRNAFDPGSSVIGNWDVMEGVLDYIFLKLGVDGANGSVDRPIVLTEPIANLGYTRRMM 226

Query: 436 TQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLD 615
            +I+FE ++ PA+   I ++ S   +  T G+V+ S    +H +P+    AL     RL+
Sbjct: 227 NEILFECYSAPAVAYGIDSLFSYRYNRGTDGLVISSSHASTHVIPVLNSKALLSNSSRLE 286

Query: 616 LAGR----DLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALD 744
              R      T++++   TE   +     ++E  R ++E+   + L+
Sbjct: 287 DRNRVIQYPFTEHVVVEKTEEELARIAERKKESGRRLQEQAAKIRLE 333


>UniRef50_UPI0000E477BD Cluster: PREDICTED: similar to
           uncharacterized hypothalamus protein HARP11; n=1;
           Strongylocentrotus purpuratus|Rep: PREDICTED: similar to
           uncharacterized hypothalamus protein HARP11 -
           Strongylocentrotus purpuratus
          Length = 481

 Score = 80.2 bits (189), Expect = 5e-14
 Identities = 54/213 (25%), Positives = 101/213 (47%)
 Frame = +1

Query: 88  EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRG 267
           E  A V D G+   K GFAG+ +PRA  PS +   +   V+        ++ D + ++  
Sbjct: 12  EKTAAVFDIGAAYTKVGFAGETSPRATIPSKIKLSKTDKVV--------HIWDYSSTEE- 62

Query: 268 ILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIM 447
                          +D + +  HH ++  L V P +  V++ E+ L P   R+ + ++ 
Sbjct: 63  --------------LYDALVEFLHHVYFRHLLVNPRDRRVVVCESILCPTQFRQTLAKVF 108

Query: 448 FETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGR 627
           F+ +  P++  A   + +L+  G  T +VLD+G   +  +P+YEGY +  A+  L L GR
Sbjct: 109 FKRYEVPSILFAPSHLTTLFTLGINTALVLDAGYNETVVLPVYEGYPIIKAVESLPLGGR 168

Query: 628 DLTDYLMKILTERGYSFTTTAEREIVRDIKEKL 726
            + + L + L E G       E++ +  + +K+
Sbjct: 169 AIHENLERQLKETGTIKENGEEQKPLLSVMDKI 201


>UniRef50_Q5K9I3 Cluster: Protein-vacuolar targeting-related
           protein, putative; n=1; Filobasidiella neoformans|Rep:
           Protein-vacuolar targeting-related protein, putative -
           Cryptococcus neoformans (Filobasidiella neoformans)
          Length = 724

 Score = 80.2 bits (189), Expect = 5e-14
 Identities = 51/240 (21%), Positives = 115/240 (47%), Gaps = 5/240 (2%)
 Frame = +1

Query: 82  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQ----GVMVGMGQKDSYVGDE 249
           D +  A+ +DNG+   +AGF+    P     ++V R + +     V++  G  D+    +
Sbjct: 27  DGQSPAICIDNGAHSWRAGFSSSSTPYIDRINMVSRYKERKFGKNVLLFGGDTDA----D 82

Query: 250 AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPE-EHPVLLTEAPLNPKANR 426
           A S+    ++    +  ++   D +E     TF       P+ +HP+++TE   NP  +R
Sbjct: 83  ANSRSNARSM---FDGDLLIQGDMLECALDFTFCQLGIDTPQIQHPIVMTERLANPLFSR 139

Query: 427 EKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAIL 606
              ++++FE +N P++   + ++ +    G+  G+ ++ G   +  +PI++G AL +   
Sbjct: 140 AMTSELLFELYNAPSVAFGVDSLFAFSRQGKKDGLTINLGHQATTIIPIFDGQALVNRSK 199

Query: 607 RLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL 786
           R+   G   ++ ++K+   +  SF     +     +  + CY + D+++E+ T    ++L
Sbjct: 200 RIPWGGSQASELMLKLAQLKYPSFPVKVTQSQATFMYRETCYFSTDYDEELRTLEVPANL 259


>UniRef50_Q4P2E8 Cluster: Actin-related protein 4; n=1; Ustilago
           maydis|Rep: Actin-related protein 4 - Ustilago maydis
           (Smut fungus)
          Length = 534

 Score = 80.2 bits (189), Expect = 5e-14
 Identities = 40/112 (35%), Positives = 67/112 (59%), Gaps = 1/112 (0%)
 Frame = +1

Query: 376 EHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGV 555
           EHP+LLTE   N + +REK+T++ FET  +PA Y+A ++VLS +A+G+ + +V+D G   
Sbjct: 181 EHPLLLTEPAWNSRESREKLTELAFETLGSPAFYLANRSVLSSFAAGKPSSLVIDVGSTN 240

Query: 556 SHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTE-RGYSFTTTAEREIVR 708
             T+PI +G+ L   I R +  G  +   L+  L   RG +F     + +++
Sbjct: 241 VSTIPIVDGFILRKGIYRHNNGGEAINRALLYSLHHGRGATFAGVTPQYVIK 292



 Score = 41.1 bits (92), Expect = 0.031
 Identities = 17/34 (50%), Positives = 23/34 (67%)
 Frame = +1

Query: 85  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVG 186
           +E+ ALV+D G    + G+AG+DAPR V PS  G
Sbjct: 8   DEINALVIDAGHSSSRVGWAGEDAPRVVLPSYYG 41


>UniRef50_A7RTR6 Cluster: Predicted protein; n=1; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 210

 Score = 79.4 bits (187), Expect = 9e-14
 Identities = 38/108 (35%), Positives = 64/108 (59%)
 Frame = +1

Query: 415 KANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALP 594
           K  +E++ +I+   F   A+Y+  Q++L++Y+    +GIV+D GD +   +P+ EG  + 
Sbjct: 44  KMLQEELVEILLGYFRVQAVYLQEQSILAMYSYSAVSGIVVDVGDHID-VIPVVEGCIIE 102

Query: 595 HAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVA 738
               RL   GR +TD L + LTE+G+ F +  E  + R IKE+ CYV+
Sbjct: 103 SGATRLPYGGRQVTDTLARHLTEKGHRFFSEVETYVARLIKEQACYVS 150


>UniRef50_A4S172 Cluster: Predicted protein; n=3; Ostreococcus|Rep:
           Predicted protein - Ostreococcus lucimarinus CCE9901
          Length = 503

 Score = 79.0 bits (186), Expect = 1e-13
 Identities = 52/178 (29%), Positives = 85/178 (47%), Gaps = 15/178 (8%)
 Frame = +1

Query: 271 LTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMF 450
           L L+ P + G V +W+   +I        L V P    +++TE P      RE + +++F
Sbjct: 88  LALRRPCDRGYVVHWEQQREILDDALRRTLGVDPTRCDLIITEPPFALPRTREALDEMVF 147

Query: 451 ETFNTPAMYVAIQAVLS------LYASGRT---------TGIVLDSGDGVSHTVPIYEGY 585
           E F      V   A L+      + A  R          +G+VLD G   +H     +G 
Sbjct: 148 EYFGFRRALVTTPAKLTKRFADFVDAKKRDAKDLCVVARSGVVLDCGFSFAHATAFVDGT 207

Query: 586 ALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEM 759
            +P  I RL+L G+ LT+YL ++++ R ++     E  ++ D+KEK+CYVA D   E+
Sbjct: 208 EVPRGIKRLNLGGKALTNYLKELVSFRQWNMMD--ESAVIEDVKEKMCYVADDALAEL 263


>UniRef50_A5K109 Cluster: Actin, putative; n=4; Plasmodium|Rep:
           Actin, putative - Plasmodium vivax
          Length = 493

 Score = 79.0 bits (186), Expect = 1e-13
 Identities = 39/97 (40%), Positives = 60/97 (61%)
 Frame = +1

Query: 358 LRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVL 537
           L +  EEHP+LL+E  ++    R +MT+I+FETFN PA+Y A +A L+ ++ GR+  +V+
Sbjct: 134 LNLKIEEHPILLSEENIHNHRVRAEMTEILFETFNIPAVYFAKKAKLTAFSLGRSNALVI 193

Query: 538 DSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLM 648
           D G    +  P+YEGY L    L+  + G D  D L+
Sbjct: 194 DIGGSSLNVTPVYEGYVLQRNSLQFGVGG-DYFDRLI 229


>UniRef50_Q5AXH1 Cluster: Actin-like protein arp6; n=5;
           Trichocomaceae|Rep: Actin-like protein arp6 - Emericella
           nidulans (Aspergillus nidulans)
          Length = 479

 Score = 79.0 bits (186), Expect = 1e-13
 Identities = 75/268 (27%), Positives = 124/268 (46%), Gaps = 49/268 (18%)
 Frame = +1

Query: 103 VVDNGSGMCKAGFAGDDAPR----------AVFPSIVGRPRHQGVMVGMGQKDSYVGDEA 252
           ++DNG+   KAG+A D  P           A  P+ + + R     VG     + +G   
Sbjct: 26  IIDNGAYNMKAGYAPDSQPLDDEEIALSACAAIPNAIVKTRANRTYVG-----AQIGTNV 80

Query: 253 QSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNE-------LRVA-PEEHPVLLTEAPL 408
                +L  + P+E G   NW+  ++IW ++F++E       L +A PE+  ++ TEAP 
Sbjct: 81  TDWNEML-FRRPVEKGYTVNWEAQKEIWENSFFDERTVRSKELHIADPEDVTIIFTEAPN 139

Query: 409 NPKANREKMTQIMFETF------------------NTPAMYVAIQAVLSLY--------- 507
              A ++   +I+ E +                  NT     A   + SL+         
Sbjct: 140 ALPALQKNADEIIMEEWGFGGYLRCVVGMAKPFALNTGPSLNAWNEIQSLFEDSVLSQPR 199

Query: 508 --ASGRTTGIVLDSGDGVSHTV--PIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYS 675
             AS     +V+DSG   SHTV  P+Y G  L   I RLDL G+ LT+YL ++++ R Y+
Sbjct: 200 AVASPAECLLVVDSG--YSHTVITPVYRGRPLQRGIRRLDLGGKHLTNYLKELVSMRQYN 257

Query: 676 FTTTAEREIVRDIKEKLCYVALDFEQEM 759
                E  I+ ++KE +C+V+ DF +++
Sbjct: 258 MVD--ETYIMNEVKESVCFVSNDFNRDL 283


>UniRef50_UPI0000EBF019 Cluster: PREDICTED: similar to ribosomal
           protein L10; n=1; Bos taurus|Rep: PREDICTED: similar to
           ribosomal protein L10 - Bos taurus
          Length = 289

 Score = 78.2 bits (184), Expect = 2e-13
 Identities = 40/87 (45%), Positives = 54/87 (62%)
 Frame = +1

Query: 100 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTL 279
           LVVD G   CK GF  D+    V P+    P+HQ  MVG+GQKDSY+G + Q +  + T 
Sbjct: 4   LVVDCGFDTCKTGFTEDNTLSCV-PTHRLVPQHQDCMVGVGQKDSYMGGKIQGRLSVQTP 62

Query: 280 KYPIEHGIVTNWDDMEKIWHHTFYNEL 360
           +YP+E GI+T+ DD+ KIW     N+L
Sbjct: 63  EYPMEQGIITHPDDVGKIWITIAINQL 89


>UniRef50_Q8ILM5 Cluster: Actin, putative; n=1; Plasmodium
           falciparum 3D7|Rep: Actin, putative - Plasmodium
           falciparum (isolate 3D7)
          Length = 522

 Score = 77.4 bits (182), Expect = 4e-13
 Identities = 36/85 (42%), Positives = 55/85 (64%)
 Frame = +1

Query: 373 EEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDG 552
           EEHP+LLTE  ++    RE+MT+I+FE +N PA+Y A +A L+ ++ GR+T +V+D G  
Sbjct: 146 EEHPILLTEFNMHNHKIREQMTEILFEKYNIPALYFAKKAKLTSFSLGRSTSLVIDIGYN 205

Query: 553 VSHTVPIYEGYALPHAILRLDLAGR 627
                P+YEGY L    L  ++ G+
Sbjct: 206 SLDINPVYEGYVLQKNSLEYNIGGQ 230


>UniRef50_UPI00006CBDF1 Cluster: Actin family protein; n=1;
           Tetrahymena thermophila SB210|Rep: Actin family protein
           - Tetrahymena thermophila SB210
          Length = 400

 Score = 75.4 bits (177), Expect = 2e-12
 Identities = 38/119 (31%), Positives = 62/119 (52%)
 Frame = +1

Query: 289 IEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTP 468
           +  G+V NW+             +++ P E P+ L E  L+ K  R+K  + +FE+ N  
Sbjct: 79  LSQGMVNNWEQASNFIEQINKKLMQINPSETPLFLIEQALSTKDVRQKCVEAVFESMNFA 138

Query: 469 AMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYL 645
           A+++    VLS Y   + T +++DSG   ++ VPI EGY     ++R D+AG  LT  L
Sbjct: 139 ALFIHKAPVLSSYVLAKETILLVDSGAYSTYVVPIVEGYVNQKGVIRSDIAGEYLTKSL 197


>UniRef50_O94241 Cluster: Actin-like protein arp6; n=1;
           Schizosaccharomyces pombe|Rep: Actin-like protein arp6 -
           Schizosaccharomyces pombe (Fission yeast)
          Length = 401

 Score = 75.4 bits (177), Expect = 2e-12
 Identities = 62/238 (26%), Positives = 110/238 (46%), Gaps = 18/238 (7%)
 Frame = +1

Query: 100 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTL 279
           +V+DNG+   KAGFAG        P+ + R +        G +  ++G+E  +     TL
Sbjct: 8   IVLDNGAYHIKAGFAGGKV--VEIPNCLTRSKD-------GNR-LFLGNELANCNDFTTL 57

Query: 280 KYPIEH--GIVTNWDDMEKIWHHTFYNELRVAPE--EHPVLLTEAPLNPKANREKMTQIM 447
           ++   H  G + +W     +W     N   + P   ++ +LLT+      +      Q++
Sbjct: 58  QFRRAHEKGYLVHWSTETAVWDLVMRNVGVMEPSMADYSLLLTQPVFTMPSIEHNTIQLV 117

Query: 448 FETFNTPAMYVAIQAVLSLYASGRTT--------------GIVLDSGDGVSHTVPIYEGY 585
           FE F   A      A L  +  G  T               +V+DSG   +H +P+ +  
Sbjct: 118 FEEFQFDAYLPCTPAELIPWDHGSFTMNQEDAYTGQHGECVLVIDSGYSFTHIIPVIDFS 177

Query: 586 ALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEM 759
               A+ R+D+ G+ LT+YL ++++ R Y+     E  IV +IKE +CYV+ +F+++M
Sbjct: 178 VQEQAVKRVDVGGKLLTNYLKEVISYRKYNM--MEETYIVNEIKESVCYVSQNFKEDM 233


>UniRef50_Q4QD95 Cluster: Actin-related protein 2, putative; n=3;
           Leishmania|Rep: Actin-related protein 2, putative -
           Leishmania major
          Length = 392

 Score = 74.9 bits (176), Expect = 2e-12
 Identities = 45/166 (27%), Positives = 83/166 (50%), Gaps = 21/166 (12%)
 Frame = +1

Query: 223 QKDSYVGDE--AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPE------- 375
           +K +  GD+  A     ++   +P+ +G++ N D M++IW +     L    E       
Sbjct: 10  EKKALCGDDLVATGALAMVEQTHPMRNGVIHNMDAMQEIWDYALCERLPALVETSGGGTA 69

Query: 376 ------------EHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGR 519
                       E P+LL+E P      R  + ++ FE +   A+    Q +LSL+A+G 
Sbjct: 70  RWRYEDGLEWLQERPLLLSEPPNMSLRQRCDLLELFFEKYGLSAIQTVQQGILSLFANGT 129

Query: 520 TTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKIL 657
             G+V++ G+G+SH  P+++G+ L  A   + +AGR +T+ L ++L
Sbjct: 130 ERGVVVECGEGLSHCTPVFDGFVLATAQRVVGVAGRAVTERLGQVL 175


>UniRef50_Q19R70 Cluster: Actin-like protein 3; n=4; Leishmania|Rep:
           Actin-like protein 3 - Leishmania major
          Length = 519

 Score = 72.1 bits (169), Expect(2) = 3e-12
 Identities = 67/233 (28%), Positives = 107/233 (45%), Gaps = 43/233 (18%)
 Frame = +1

Query: 100 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQG----VMVGMGQKDSY------VGDE 249
           L++D GS   K+G      P    P++VG P++      V     Q  S       VG +
Sbjct: 29  LILDLGSRTIKSGLHTATTPHLT-PALVGTPKYPRCLPQVSSSFNQSSSISTSCFVVGSD 87

Query: 250 AQSKRGILTLKYPIEHG-IVTNWDDMEKIWHHTFYNELRVAP-----------EEHPVL- 390
           A S+RG+L L  PI+HG ++ +W     +   +  N L V P           E   V+ 
Sbjct: 88  AASRRGVLRLSRPIQHGGVIMDWVGTRPLLRQSIQNAL-VPPSSSLAVRQPLEEGEDVIY 146

Query: 391 -LTEAPLNPKANREKMTQIMFETFNTPAM-----------------YVAIQAVLSLYASG 516
            L E+P   +  R ++ +++FE  +  A+                 +  +  +L+LYA+G
Sbjct: 147 SLVESPYASRPQRARLAELLFEGPDQEAVMSDSGKQQRVGPRAAGVFCGVGPLLALYATG 206

Query: 517 RTTGIVLDSGDGVSHTVPIYEGYALPHAILR-LDLA-GRDLTDYLMKILTERG 669
           +TTG+V+D GDG   T    +GY LP  + R  D A G  +T YL ++L + G
Sbjct: 207 QTTGVVVDVGDGAVSTAAAADGYVLPQCLQREADGATGAAVTSYLTRLLYQSG 259



 Score = 22.6 bits (46), Expect(2) = 3e-12
 Identities = 13/36 (36%), Positives = 20/36 (55%), Gaps = 2/36 (5%)
 Frame = +1

Query: 682 TTAEREIVRDIKEKLCYVALD--FEQEMATAASSSS 783
           T  ERE+V  +KE  C V+    F  + + AA+ +S
Sbjct: 294 TQQERELVYALKEACCSVSATPLFSTKSSLAAADAS 329


>UniRef50_A7TM96 Cluster: Putative uncharacterized protein; n=1;
           Vanderwaltozyma polyspora DSM 70294|Rep: Putative
           uncharacterized protein - Vanderwaltozyma polyspora DSM
           70294
          Length = 488

 Score = 74.5 bits (175), Expect = 3e-12
 Identities = 53/189 (28%), Positives = 91/189 (48%), Gaps = 8/189 (4%)
 Frame = +1

Query: 100 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTL 279
           +V+ NG+    AGF+  + P+ + PS   + +    + G       + DE  ++  I T+
Sbjct: 9   VVIHNGTSTTIAGFSNSEIPKCIIPSSYLKKKDGSFVFGTFDMMDSLEDEG-AESDIFTI 67

Query: 280 KYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANR-------EKMT 438
               + G+  NW+ +EK W + F  +L+  P E PVL+T  P +   N        E+  
Sbjct: 68  -VDSQLGVPYNWEALEKQWEYIFEKQLKCDPTELPVLIT-IPSSISKNEDIENKVIEQYC 125

Query: 439 QIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLD-SGDGVSHTVPIYEGYALPHAILRLD 615
           +I FE F  P + +  +++      G+ T +V+D SG G S T PI +G  + + I++  
Sbjct: 126 KIAFEKFKIPYLQIVNESLSISLGLGKKTSLVIDISGSGSSVT-PIVDGVIIKNGIVKSK 184

Query: 616 LAGRDLTDY 642
             G D  DY
Sbjct: 185 YGG-DFLDY 192


>UniRef50_Q9NZ32 Cluster: Actin-related protein 10; n=40;
           Eumetazoa|Rep: Actin-related protein 10 - Homo sapiens
           (Human)
          Length = 417

 Score = 74.5 bits (175), Expect = 3e-12
 Identities = 60/229 (26%), Positives = 108/229 (47%), Gaps = 12/229 (5%)
 Frame = +1

Query: 88  EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRG 267
           E  A+V+D G    K GFAG+  PR + PS++ R        GM              + 
Sbjct: 12  EKTAVVIDLGEAFTKCGFAGETGPRCIIPSVIKR-------AGM-------------PKP 51

Query: 268 ILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIM 447
           +  ++Y I    + ++  +++  H  ++  L V P +  V++ E+ L P   RE +T+++
Sbjct: 52  VRVVQYNINTEELYSY--LKEFIHILYFRHLLVNPRDRRVVIIESVLCPSHFRETLTRVL 109

Query: 448 FETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGR 627
           F+ F  P++ +A   +++L   G  + +VLD G   S  +PIYEG  + +    L L G+
Sbjct: 110 FKYFEVPSVLLAPSHLMALLTLGINSAMVLDCGYRESLVLPIYEGIPVLNCWGALPLGGK 169

Query: 628 DLTDYLMKILTERGYSFTTTAERE------------IVRDIKEKLCYVA 738
            L   L   L E+    T+ A+ +            ++ DIK + C+V+
Sbjct: 170 ALHKELETQLLEQCTVDTSVAKEQSLPSVMGSVPEGVLEDIKARTCFVS 218


>UniRef50_Q6BML9 Cluster: Actin-like protein ARP6; n=3;
           Saccharomycetaceae|Rep: Actin-like protein ARP6 -
           Debaryomyces hansenii (Yeast) (Torulaspora hansenii)
          Length = 409

 Score = 73.7 bits (173), Expect = 5e-12
 Identities = 67/235 (28%), Positives = 102/235 (43%), Gaps = 15/235 (6%)
 Frame = +1

Query: 103 VVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDE----AQSKRGI 270
           V+DNGS   KAGF+  DAP           +HQ  +        YVG+E      +  G+
Sbjct: 7   VIDNGSYNIKAGFSNQDAPI----------KHQNALSKARDGLIYVGNEYLVQTNNYSGM 56

Query: 271 LTLKYPIEHGIVTNWDDMEKIWHHTFY----NELRVAPEEHPVLLTEAPLNPKANREKMT 438
           +  K P +HG + +W+  + +W +TF     N+   A   H + LTE P           
Sbjct: 57  I-FKRPYDHGHLISWETEKAVWDYTFNKASPNQELDASITH-LTLTETPFQLPQLSMNTD 114

Query: 439 QIMFETFNTPAMYVAIQAVL-------SLYASGRTTGIVLDSGDGVSHTVPIYEGYALPH 597
           QI+FE +     Y    A L       S  +      +V+DSG   +  VPI        
Sbjct: 115 QIVFEEYGFNEYYRCAPASLVPWLNLGSSESKNNDFTLVVDSGYSGTWIVPIIYQNVYWK 174

Query: 598 AILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMA 762
            + +L + G  L   L +I++ R Y      E  ++  IKEK C++A DFE+ +A
Sbjct: 175 GVKKLPIGGAALNGLLREIISFRHYDIAD--EPVLINTIKEKTCFMATDFEKSLA 227


>UniRef50_Q9FKT0 Cluster: Actin-related protein 8; n=23;
           Magnoliophyta|Rep: Actin-related protein 8 - Arabidopsis
           thaliana (Mouse-ear cress)
          Length = 471

 Score = 71.7 bits (168), Expect = 2e-11
 Identities = 50/157 (31%), Positives = 82/157 (52%), Gaps = 11/157 (7%)
 Frame = +1

Query: 343 TFYNELRVAPEEHPVLLTEAPL-------NPKANREKMTQIMFETF---NTPAMYVAIQA 492
           T +  ++V P   P++++  PL       + KA+R ++   +F      N PA+    QA
Sbjct: 182 TIFTRMQVKPSMQPIVVS-LPLCHFDDTESAKASRRQLKTAIFNVLFDMNVPAVCAVNQA 240

Query: 493 VLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPH-AILRLDLAGRDLTDYLMKILTERG 669
           VL+LYA+ RT+GIV++ G  V   +PI  G  +    +  +      LT +L + + E  
Sbjct: 241 VLALYAARRTSGIVVNIGFQVITILPILHGKVMRQVGVEVIGFGALKLTGFLKEKMQENN 300

Query: 670 YSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSS 780
            SF +      VR +KEKLCYVALD++ E++    +S
Sbjct: 301 ISFQSL---YTVRTLKEKLCYVALDYKAELSKDTQAS 334


>UniRef50_Q75BT7 Cluster: ACR184Cp; n=1; Eremothecium gossypii|Rep:
           ACR184Cp - Ashbya gossypii (Yeast) (Eremothecium
           gossypii)
          Length = 401

 Score = 70.9 bits (166), Expect = 3e-11
 Identities = 61/218 (27%), Positives = 98/218 (44%), Gaps = 3/218 (1%)
 Frame = +1

Query: 97  ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILT 276
           A+V+  G     AGF+  D P+ + PS    P     + G+     Y   +A+ +  I T
Sbjct: 6   AVVLHFGKHSTVAGFSNRDLPQCMLPSAYLMPDGGEPVYGL-----YELMQAK-EHDIYT 59

Query: 277 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 456
           L      G+ T+W+ +E+     +  +LRV PEE PV +T  P      R +  +++   
Sbjct: 60  LFD--NRGVPTDWEMLERFCRWIYATQLRVGPEELPVCITVPPDLSATVRSQFHELVLCK 117

Query: 457 FNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 636
              P + +  + +    + GR+T +V+D G       PI +G  +   ILR   AG  L 
Sbjct: 118 LRAPVLQLISEPLAVTLSLGRSTALVVDVGASKVTVTPIVDGSVVKTGILRSRYAGDFLD 177

Query: 637 DYLMKILTER--GYS-FTTTAEREIVRDIKEKLCYVAL 741
             LMK L +R  G S +     R  +RD K  +  V+L
Sbjct: 178 FQLMKALDDRPDGTSLYHWQQSRTWMRDFKNTMLQVSL 215


>UniRef50_Q5BXM4 Cluster: SJCHGC05761 protein; n=1; Schistosoma
           japonicum|Rep: SJCHGC05761 protein - Schistosoma
           japonicum (Blood fluke)
          Length = 246

 Score = 69.7 bits (163), Expect = 8e-11
 Identities = 49/192 (25%), Positives = 89/192 (46%)
 Frame = +1

Query: 88  EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRG 267
           E  A+V D G+   K GFAG+  PR + P+ +  P         G+K S    + + +  
Sbjct: 33  EKTAVVFDIGTVYTKCGFAGETGPRFIIPTAITLPT--------GEKKSISSCDGKDE-- 82

Query: 268 ILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIM 447
                         N D ++   ++ +Y  L V P++  V++ E+ L P + +E +  + 
Sbjct: 83  --------------NRDFLKTFLYNIYYRYLLVNPKDRRVVVVESILRPSSFKEVLADVF 128

Query: 448 FETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGR 627
           F  F  P++  A   +++L+  G ++ IVLD G   +  +P+YEGY L +A     L  +
Sbjct: 129 FNHFEAPSVLFAASHLMALFTLGISSAIVLDCGYIDAQVLPVYEGYTLLNAWQSAQLGSK 188

Query: 628 DLTDYLMKILTE 663
            + + +   L E
Sbjct: 189 RIHENIKCYLKE 200


>UniRef50_Q7QTA6 Cluster: GLP_15_20269_21672; n=1; Giardia lamblia
           ATCC 50803|Rep: GLP_15_20269_21672 - Giardia lamblia
           ATCC 50803
          Length = 467

 Score = 69.3 bits (162), Expect = 1e-10
 Identities = 57/199 (28%), Positives = 87/199 (43%), Gaps = 13/199 (6%)
 Frame = +1

Query: 88  EVAALVVDNGSGMCKAGFAGDDAPRAVFPS-IVGRPRHQG---VMVGMGQKDSYVGDEAQ 255
           E    VVD GS   +AG AG D P  V PS IVG     G     +   Q  SY+ DE  
Sbjct: 11  EAPVNVVDLGSFEIRAGVAGLDGPTYVRPSFIVGESLPSGGAAEAISSDQAISYLPDERY 70

Query: 256 SKRGI--LTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEE-------HPVLLTEAPL 408
             + +    +   I +G VT  D    + +  F    R            +P+ L +   
Sbjct: 71  LFKPMPNRVVSQIIANGCVTREDQFSSLCNLLFNGSSRCKSHAFRELDPGYPMALFQPHF 130

Query: 409 NPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYA 588
                R+ +   +FET + PA+Y+  Q   + Y+ G+TT +V+D G G +   PI +G+ 
Sbjct: 131 VQPLERDLIASCLFETHSIPALYIGDQEAAAAYSVGKTTALVIDVGYGKTVVSPIVDGHC 190

Query: 589 LPHAILRLDLAGRDLTDYL 645
           +     R D+ G+ L + L
Sbjct: 191 IHSKSYRSDVTGKLLHEIL 209


>UniRef50_Q9UTQ7 Cluster: SWI/SNF and RSC complex subunit Arp9; n=1;
           Schizosaccharomyces pombe|Rep: SWI/SNF and RSC complex
           subunit Arp9 - Schizosaccharomyces pombe (Fission yeast)
          Length = 523

 Score = 68.9 bits (161), Expect = 1e-10
 Identities = 44/149 (29%), Positives = 70/149 (46%), Gaps = 4/149 (2%)
 Frame = +1

Query: 286 PIEHGIVTNWDDMEKIWHHTFYNELRVAPEE----HPVLLTEAPLNPKANREKMTQIMFE 453
           PI+ G V +W+ ++  W H  Y+ L   P +    +PV L         +RE  TQ  FE
Sbjct: 113 PIQRGRVVDWEALKAFWKH-LYSLLLKDPNDTTFRYPVCLVIPTYWSLYDRELATQFFFE 171

Query: 454 TFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDL 633
               P   +A + ++ LYA G   G+V+D G   +   PI +G  +  A  +L L GR +
Sbjct: 172 ECQVPGFTIAYEPLMGLYAIGILHGLVIDIGYEKTDITPILDGQIIFTATQQLPLGGRYM 231

Query: 634 TDYLMKILTERGYSFTTTAEREIVRDIKE 720
           T +L  +L E   +  ++ +     DI E
Sbjct: 232 TQHLQNLLRESLPTLKSSGQYVSKEDITE 260


>UniRef50_Q54KZ7 Cluster: Putative uncharacterized protein; n=1;
           Dictyostelium discoideum AX4|Rep: Putative
           uncharacterized protein - Dictyostelium discoideum AX4
          Length = 490

 Score = 68.5 bits (160), Expect = 2e-10
 Identities = 59/242 (24%), Positives = 117/242 (48%), Gaps = 26/242 (10%)
 Frame = +1

Query: 100 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTL 279
           L++DNG    K        P  + P+ VG+ +++   + MG++     D ++ +      
Sbjct: 31  LIIDNGGHTLKIATNNPSQPHIIVPNQVGKVKNEKHQI-MGEELINYNDPSEVRS----- 84

Query: 280 KYPIEHGIVTNWDDMEKIWHHTFY-NELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 456
           + P+E G +TNW   ++IW + F  +++++ P+++ +LLTEAP +    R+ M ++++E 
Sbjct: 85  RNPMEKGYITNWGLEKEIWDYAFKRDDMKIKPQDYNLLLTEAPNSLDDLRKTMYEVVYEQ 144

Query: 457 FNTPAMYVAIQAVLSL---------YASGR----TTGIVLDSGDGVSHTVPIYEGYALPH 597
           +   ++Y+   + L L         Y   +        ++       H V +  GY+  H
Sbjct: 145 YKFKSLYLTTSSTLGLVHIKQQLLQYQQQQHQPPLDASMISLLKSPCHLV-VDCGYSSTH 203

Query: 598 AI-----LRLDLA-------GRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVAL 741
            I      RL+ A       G+ LT+YL +I++ R +      E +++  IKEK C+++ 
Sbjct: 204 IIPHFQNTRLNYAIKRFNIGGKLLTNYLKEIVSFRYWDM--MHETKLMNTIKEKTCFISK 261

Query: 742 DF 747
           DF
Sbjct: 262 DF 263


>UniRef50_Q4YVG6 Cluster: Actin, putative; n=7; Plasmodium|Rep:
           Actin, putative - Plasmodium berghei
          Length = 505

 Score = 68.5 bits (160), Expect = 2e-10
 Identities = 51/190 (26%), Positives = 93/190 (48%), Gaps = 10/190 (5%)
 Frame = +1

Query: 85  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRP-RHQGVMVGMGQKDSYVGDEAQSK 261
           + +  +++D   G  +AG++G+ +PR     I+G P  H   +     K +        K
Sbjct: 3   QNIQTIILDINDGEMRAGYSGECSPRYKSNLILGLPIGHNATL-----KHTIFPLLPDIK 57

Query: 262 RGILTLKYPIEH--------GIVTNWDDMEKIWHHTFYNE-LRVAPEEHPVLLTEAPLNP 414
           R  + L Y I++            N++ MEK++     ++ L V  ++HP+LLTE     
Sbjct: 58  RDNVDLLYGIKYVYSDNNNSKYDINFEAMEKLFEDISGSKALDVNFQDHPILLTEPNKID 117

Query: 415 KANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALP 594
              REK T++MFE++N   M+++ ++VLS Y   RT+G+VL      ++   + +GY   
Sbjct: 118 SRYREKFTELMFESYNVYQMFLSKRSVLSCYGCARTSGLVLSVEKNCTNLCGMQDGYIFQ 177

Query: 595 HAILRLDLAG 624
             I  + + G
Sbjct: 178 KHIEEVPIGG 187


>UniRef50_Q7T3J8 Cluster: Beta actin; n=2; Oncorhynchus|Rep: Beta
           actin - Oncorhynchus nerka (Sockeye salmon)
          Length = 70

 Score = 68.1 bits (159), Expect = 2e-10
 Identities = 29/46 (63%), Positives = 33/46 (71%)
 Frame = +3

Query: 561 HRAHLRRIRTPPRHPASGLSRSRPHRLPHEDPHRARLLVHYHRRAG 698
           H  HLR +R+ PRHPASG  R RPHRLP EDP  ARL +H+H R G
Sbjct: 4   HCTHLRGLRSAPRHPASGSGRPRPHRLPDEDPDGARLQLHHHGRVG 49


>UniRef50_A7AWQ4 Cluster: Actin, putative; n=1; Babesia bovis|Rep:
           Actin, putative - Babesia bovis
          Length = 405

 Score = 68.1 bits (159), Expect = 2e-10
 Identities = 36/101 (35%), Positives = 57/101 (56%)
 Frame = +1

Query: 376 EHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGV 555
           +HP+++TE     K  R+   +I+FE  + PA Y+A +A LS ++ GR + +V+D G G 
Sbjct: 126 QHPMMVTEPTAECKQFRDCTLEILFEQLDVPAAYLAKRATLSAFSVGRQSAMVVDIGAGG 185

Query: 556 SHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSF 678
           S   P++EG +L   I    + G  L   L  IL +RG+ F
Sbjct: 186 SIASPVHEGISLQSTIQTSMVGGNALDMELCDILYKRGHEF 226


>UniRef50_Q6FMT7 Cluster: Similar to sp|Q12406 Saccharomyces
           cerevisiae YPR034w ARP7 Actin-like protein; n=1; Candida
           glabrata|Rep: Similar to sp|Q12406 Saccharomyces
           cerevisiae YPR034w ARP7 Actin-like protein - Candida
           glabrata (Yeast) (Torulopsis glabrata)
          Length = 529

 Score = 68.1 bits (159), Expect = 2e-10
 Identities = 57/203 (28%), Positives = 95/203 (46%), Gaps = 22/203 (10%)
 Frame = +1

Query: 100 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRP-RHQGVMVGMGQKDS----YVG------D 246
           +V+  GS    AGF   D P+   PS   R  R   V +  G++D     YV       D
Sbjct: 8   VVISTGSHRTVAGFNNVDLPQCTIPSSYVRVLRDDDVSMDDGEEDESRYEYVFGLFDMMD 67

Query: 247 EA----QSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNP 414
           EA      K G        +HGI  NW  +E+++ + +  EL+V P E P+++T   L  
Sbjct: 68  EAAFDVNGKGGREVFTIVDDHGIPYNWKALERLYRYIYEKELKVDPSELPLVIT---LPS 124

Query: 415 KANREKMTQIM-------FETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPI 573
             NRE  T+I+       FE    P + + ++ +  + ++G+++ +V+D G       PI
Sbjct: 125 MTNRELETKIVENYMELAFEKLKVPVLQIVVEPLGIMLSTGKSSSLVIDVGATGCTVTPI 184

Query: 574 YEGYALPHAILRLDLAGRDLTDY 642
            +G  L ++I++   AG D  D+
Sbjct: 185 IDGTILRNSIVKSRFAG-DFLDF 206


>UniRef50_Q5JWF8 Cluster: Putative uncharacterized protein C20orf134
           precursor; n=6; Eutheria|Rep: Putative uncharacterized
           protein C20orf134 precursor - Homo sapiens (Human)
          Length = 245

 Score = 67.7 bits (158), Expect = 3e-10
 Identities = 34/99 (34%), Positives = 58/99 (58%), Gaps = 1/99 (1%)
 Frame = +1

Query: 478 VAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKIL 657
           +A  A+L+L ++G  +G+ +++G GV H  PIY G++   A  RL++AG  L+ YL  +L
Sbjct: 1   MASTALLALCSTGAFSGLAVEAGAGVCHATPIYAGHSWHQATFRLNVAGSTLSRYLRDLL 60

Query: 658 TERGYSFTTTA-EREIVRDIKEKLCYVALDFEQEMATAA 771
                     A  R+ +  +K++ CYV+LDFE ++   A
Sbjct: 61  VAANPDLLQQALPRKAITHLKKRSCYVSLDFEGDLRDPA 99


>UniRef50_Q20329 Cluster: Putative uncharacterized protein; n=2;
           Caenorhabditis|Rep: Putative uncharacterized protein -
           Caenorhabditis elegans
          Length = 552

 Score = 66.9 bits (156), Expect = 5e-10
 Identities = 59/224 (26%), Positives = 99/224 (44%), Gaps = 5/224 (2%)
 Frame = +1

Query: 100 LVVDNGSGMCKAGFAGDDA--PRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGIL 273
           L+++ GS   +AG    +   P++ FP+I  R     + VG       +       R I 
Sbjct: 181 LILELGSCSIRAGVLTTEPSLPQSFFPAIAVRTDDGKIFVGEDAYRPEIRHNGDFVRPIS 240

Query: 274 TLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFE 453
                +E   +    D+ K        EL+V P ++ VLL+     P     ++ QI  E
Sbjct: 241 ATDPSVERYSIDK--DVLKAVIGKVTKELKVEPWKYKVLLSIPQNIPTVLIGELLQICLE 298

Query: 454 TFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDL 633
                +  +  Q  L LYA   TTG+V+D G+ V + VP+ +GY +  AI  +    + +
Sbjct: 299 DIKFQSAGITRQPSLILYAYDVTTGVVVDIGERV-NIVPVIDGYVVESAICSIPYGSQQM 357

Query: 634 TDYLMKILTERG---YSFTTTAEREIVRDIKEKLCYVALDFEQE 756
            D L   L+      Y+F +  E+ I+R   E+  YV  D+++E
Sbjct: 358 GDSLRASLSAHNKGLYAFQSPVEKLILRFALEQTTYVPEDYQKE 401


>UniRef50_Q4P4D4 Cluster: Putative uncharacterized protein; n=1;
           Ustilago maydis|Rep: Putative uncharacterized protein -
           Ustilago maydis (Smut fungus)
          Length = 544

 Score = 66.9 bits (156), Expect = 5e-10
 Identities = 61/246 (24%), Positives = 103/246 (41%), Gaps = 12/246 (4%)
 Frame = +1

Query: 76  MCDEEVAALVVDNGSGMCKAGFAGDDA---PRAVFPSIVGRPRHQGVMVGMGQKDSY--- 237
           M   E   +++  GS    AG+   +    P     + VG PR             Y   
Sbjct: 1   MTAREARTVIIVTGSHTITAGYGIHEILKRPSISLTARVGLPRSSASTSSSSSPPDYKQY 60

Query: 238 -VG---DEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPV-LLTEA 402
            VG   D+A+ +   + + +P+  G V +W  M  +W++  ++ L +    +   +L   
Sbjct: 61  LVGSALDQAERRGDDVAIFWPMRKGYVRDWQQMIALWNYVLFHLLPIRRSHNDSNILISL 120

Query: 403 PLN-PKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYE 579
           PL   +A    +TQI FE FN+ A+ +A + +LS Y  G     V+D G       P+ E
Sbjct: 121 PLPVSRATHAYLTQIFFEHFNSAAITIAEKPLLSCYGVGSMNACVVDLGYESCDVSPVIE 180

Query: 580 GYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEM 759
                +A ++ D+  R    YL  +L  R  S    A + ++R  ++     AL  E E 
Sbjct: 181 CLVQSNANVKTDVGTRHCILYLAHLL-RRDQSL-VKAIQTLLRYTRKASSPAALSHESEQ 238

Query: 760 ATAASS 777
           A   S+
Sbjct: 239 AALRSA 244


>UniRef50_Q54JY2 Cluster: Putative uncharacterized protein; n=1;
           Dictyostelium discoideum AX4|Rep: Putative
           uncharacterized protein - Dictyostelium discoideum AX4
          Length = 475

 Score = 66.5 bits (155), Expect = 7e-10
 Identities = 46/190 (24%), Positives = 86/190 (45%), Gaps = 2/190 (1%)
 Frame = +1

Query: 94  AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGIL 273
           +++V++ G    K G++ + +PR + P+ +        + G    D++  +       I 
Sbjct: 5   SSIVLEIGGRYTKCGYSPESSPRFIIPTNLLPLNISSYLSGGASFDNFKKEITSDNETIT 64

Query: 274 TL-KYPIEHGIVTNWDDMEKIWHHT-FYNELRVAPEEHPVLLTEAPLNPKANREKMTQIM 447
           T  + P +    +   +   I+  T F N L    +E  +++ E    P+  RE M  ++
Sbjct: 65  TTNQIPTKLPTQSQLKESLFIFFKTIFLNYLLCKSDERKIIIVENIFLPRLFRESMVSVL 124

Query: 448 FETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGR 627
           FE +  P + V I    SL  + RTT +++DSG   +  +PIYEG  +  A   + L   
Sbjct: 125 FEQYRVP-LIVFINPTASLIPTLRTTALLIDSGFSETRVLPIYEGVGILKAYKSISLGSE 183

Query: 628 DLTDYLMKIL 657
            L + L + L
Sbjct: 184 SLINQLKQYL 193


>UniRef50_Q4P230 Cluster: Putative uncharacterized protein; n=1;
           Ustilago maydis|Rep: Putative uncharacterized protein -
           Ustilago maydis (Smut fungus)
          Length = 692

 Score = 66.5 bits (155), Expect = 7e-10
 Identities = 51/195 (26%), Positives = 86/195 (44%), Gaps = 5/195 (2%)
 Frame = +1

Query: 100 LVVDNGSGMCKAGFAGDDAPRAVFPSI-VGRPRHQGVMVGMGQ--KDSY-VGDEAQSKRG 267
           +++D GS   K GF+G+  PRA+ PS+   +P    + +       D Y VG+       
Sbjct: 86  IILDIGSRYSKFGFSGEPRPRAIVPSVSFSQPSTSYLHLDKSDCNTDPYKVGETLWDLDS 145

Query: 268 ILTLKYPIEHGI-VTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQI 444
            L     +      T    + ++    F   L V P++  VL+ E P+   + +E + Q+
Sbjct: 146 ELCADDQLRRAKRATVLAQLTQLLRTAFIQHLMVDPKQRKVLVVENPMLSSSIQEMICQV 205

Query: 445 MFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAG 624
           +F     P++      +LSL A G  TG+V++ G   +  +P+Y G  L   +     AG
Sbjct: 206 LFNNLQVPSVSFVPAPLLSLLAVGCITGLVVEVGYLEATLMPVYYGRPLMSHVASTSRAG 265

Query: 625 RDLTDYLMKILTERG 669
           R L   L  +L   G
Sbjct: 266 RRLNARLRHLLLRHG 280


>UniRef50_A5E5Q2 Cluster: Putative uncharacterized protein; n=1;
           Lodderomyces elongisporus NRRL YB-4239|Rep: Putative
           uncharacterized protein - Lodderomyces elongisporus
           (Yeast) (Saccharomyces elongisporus)
          Length = 541

 Score = 66.1 bits (154), Expect = 9e-10
 Identities = 45/185 (24%), Positives = 93/185 (50%), Gaps = 2/185 (1%)
 Frame = +1

Query: 85  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKR 264
           +E+ A+++D G+   + G+AGDD P+ +  S  G+   QG  V         G+     R
Sbjct: 13  DEINAIILDIGTHTTRIGYAGDDFPKIITTSNYGKTS-QGTKV--------YGENIDVLR 63

Query: 265 GILTLKYPI-EHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQ 441
              T  +PI  + ++T+WD     + + ++  L++   + P+++TE   +    R+ + +
Sbjct: 64  SGGTTVHPIVTNSLITDWDAAMDQFAY-YFKLLKIEQNDQPIMITEPIWSTYEYRKTLVE 122

Query: 442 IMFETFNTPAMY-VAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDL 618
            ++  F+ PA+Y + + + +S +  GR   +V+D G   +   P+ +G  L  + +R   
Sbjct: 123 KIYAKFDFPALYLIKVPSCIS-FQQGRPNCLVVDVGYESASVTPVVDGICLIKSSVRTPY 181

Query: 619 AGRDL 633
           AG+ L
Sbjct: 182 AGKFL 186


>UniRef50_Q7SHR0 Cluster: Actin-related protein 4; n=16;
           Pezizomycotina|Rep: Actin-related protein 4 - Neurospora
           crassa
          Length = 469

 Score = 65.7 bits (153), Expect = 1e-09
 Identities = 32/93 (34%), Positives = 54/93 (58%)
 Frame = +1

Query: 376 EHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGV 555
           E+P+L+TEAP N    REK  +I  ET+  PA +++   VL+ +A+G+ T +V+D G   
Sbjct: 145 ENPLLMTEAPWNSPKAREKAIEISMETWGVPAFWLSKTPVLAAFAAGKATALVIDVGGAN 204

Query: 556 SHTVPIYEGYALPHAILRLDLAGRDLTDYLMKI 654
           +    I++G  L  +I R  + G  L+  + K+
Sbjct: 205 TSVTAIHDGMVLKRSIQRSPVGGVWLSSQICKM 237



 Score = 47.6 bits (108), Expect = 4e-04
 Identities = 28/93 (30%), Positives = 43/93 (46%)
 Frame = +1

Query: 85  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKR 264
           +EV+ALV+D G    +AG+AG++ P+ V PS  G    + V       D Y+      K 
Sbjct: 20  DEVSALVLDPGYCNTRAGYAGEEMPKQVLPSFYGHINGRDVF-----GDEYI----VPKP 70

Query: 265 GILTLKYPIEHGIVTNWDDMEKIWHHTFYNELR 363
           G     Y     +V +WD   ++W H     L+
Sbjct: 71  GFEVRNYMNRDSVVEDWDAATRMWEHVLVKRLQ 103


>UniRef50_Q0J891 Cluster: Os08g0128300 protein; n=5; Oryza
           sativa|Rep: Os08g0128300 protein - Oryza sativa subsp.
           japonica (Rice)
          Length = 257

 Score = 64.5 bits (150), Expect = 3e-09
 Identities = 27/77 (35%), Positives = 43/77 (55%)
 Frame = +1

Query: 526 GIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIV 705
           G+V+D GDG  H VP+  GY +  +I     +G D+T +++++L ERG         +I 
Sbjct: 6   GVVVDIGDGAPHVVPVVNGYVIGSSIKSFPFSGSDVTQFVLQLLQERGELIAPEDSLDIA 65

Query: 706 RDIKEKLCYVALDFEQE 756
           R +KE  CY + D  +E
Sbjct: 66  RRVKEMYCYTSSDIVKE 82


>UniRef50_Q5CWA5 Cluster: Actin; n=2; Cryptosporidium|Rep: Actin -
           Cryptosporidium parvum Iowa II
          Length = 389

 Score = 64.5 bits (150), Expect = 3e-09
 Identities = 34/119 (28%), Positives = 62/119 (52%)
 Frame = +1

Query: 370 PEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGD 549
           P+++PV+L E P  P      + QI+ E +  P +    + ++SL+ +G  TGIV+D G 
Sbjct: 93  PKDYPVILLERPFFPIELSNYIKQILLENYQVPGVKRISEPIVSLFTTGFKTGIVVDIGT 152

Query: 550 GVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKL 726
             +   PIY+GY + + + ++   G D  D+  K + E    +    E +I+++I   L
Sbjct: 153 NETIVCPIYDGYPIEYNV-KIINCGYD--DFKKKFMNELFSQYKEKPEEDIIKEISNDL 208


>UniRef50_UPI00006CC3F4 Cluster: Actin family protein; n=1;
           Tetrahymena thermophila SB210|Rep: Actin family protein
           - Tetrahymena thermophila SB210
          Length = 725

 Score = 63.7 bits (148), Expect = 5e-09
 Identities = 46/228 (20%), Positives = 102/228 (44%), Gaps = 8/228 (3%)
 Frame = +1

Query: 100 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTL 279
           +++D GSG+ KAG+     P     S++ + +     +      S + D    K      
Sbjct: 47  ILIDYGSGITKAGWGNSTKPDLSVQSLLSKSKDSKTSITQALTSSKIKDVDLFKGNY--- 103

Query: 280 KYPIEHGIVTNWDDMEKIWHHTFYNELRVAPE--EHPVLLTEAPLNPKANREKMTQIMFE 453
           + P E  I+  +  +E + +   +NE+ V     +HP+++TE   NP+  R+ + +  FE
Sbjct: 104 RSPYERNIIQQFGLLENL-NDFIFNEIGVVESKVDHPLIITEPVANPEYCRQNLLEQYFE 162

Query: 454 TFNTPAMYVAIQAVL-SLYASGR-----TTGIVLDSGDGVSHTVPIYEGYALPHAILRLD 615
            +  P++ + +     + Y  G+      T +++  G    H +P+  G  +   I R++
Sbjct: 163 CYEIPSVMIGVDTFFATFYEFGQDRYQSETCLIISIGHTTCHIIPMVNGQIIFEEIKRIN 222

Query: 616 LAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEM 759
           +   +  + L K L  +        + + V+ I    C VA+++++++
Sbjct: 223 VGYFNSFEVLYKQLILKNNHQKHHLDYQTVQAIHLNNCSVAVNYDEQL 270


>UniRef50_Q4UIK3 Cluster: Actin, putative; n=2; Theileria|Rep:
           Actin, putative - Theileria annulata
          Length = 468

 Score = 63.7 bits (148), Expect = 5e-09
 Identities = 48/179 (26%), Positives = 87/179 (48%), Gaps = 15/179 (8%)
 Frame = +1

Query: 100 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPR---HQGVMV----GMGQKD-SYV----- 240
           L++D G+   + G AGD  P    P ++G+P     +G +     G GQ    Y      
Sbjct: 5   LILDFGTVSFRVGRAGDKNPTFFVPPVIGKPLMKDSKGDLCDFTGGSGQNPLEYTIFPLN 64

Query: 241 -GDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTF-YNELRVAPEEHPVLLTEAPLNP 414
             D+  +   I  + Y  E+G   N   +E++         +  + ++ PV+++E  L+ 
Sbjct: 65  PRDKHDNVIPISAITYG-ENGFEVNQSLLERLLDGCLGVKGMDESLQDTPVIVSEPSLHN 123

Query: 415 KANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYAL 591
              R+  T+++FETF    +++  ++ LS YAS  T+G+V+D G   ++  P+ EGY L
Sbjct: 124 PKFRQNFTELLFETFKVENVFLCKRSALSCYASACTSGVVVDIGGSCTNIAPVLEGYTL 182


>UniRef50_A2D880 Cluster: Actin family protein; n=1; Trichomonas
           vaginalis G3|Rep: Actin family protein - Trichomonas
           vaginalis G3
          Length = 410

 Score = 63.3 bits (147), Expect = 7e-09
 Identities = 54/207 (26%), Positives = 92/207 (44%), Gaps = 11/207 (5%)
 Frame = +1

Query: 97  ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKR--GI 270
           ALV D GS   + G+AGD  P  V PS   +      M   G++    G E   K    I
Sbjct: 10  ALVYDFGSSCVRFGYAGDAYPLYVVPSSSVQ------MFQDGEEKIRFGSEWFEKNLPDI 63

Query: 271 LTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKAN--------- 423
              +   ++G++T  D +   +           P ++PVL+++  +  K           
Sbjct: 64  QINQMVDDNGMITESDMLFTFFDWVLSVHQIEEPTQNPVLISQPTVITKLTGNKNGITKW 123

Query: 424 REKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAI 603
           RE +   +FE  N PA+ +   A L+ YA G  TG+V+D G   +  +P++EG+ +  ++
Sbjct: 124 RETLASCIFEFANHPALCLQHDASLACYAHGIHTGVVVDYGWSCARAIPVFEGHPITQSV 183

Query: 604 LRLDLAGRDLTDYLMKILTERGYSFTT 684
               L G +LT+ L + + +      T
Sbjct: 184 QIHPLGGLELTNLLFEKMKQNNKQIYT 210


>UniRef50_A4RLB1 Cluster: Putative uncharacterized protein; n=1;
           Magnaporthe grisea|Rep: Putative uncharacterized protein
           - Magnaporthe grisea (Rice blast fungus) (Pyricularia
           grisea)
          Length = 445

 Score = 63.3 bits (147), Expect = 7e-09
 Identities = 29/99 (29%), Positives = 56/99 (56%)
 Frame = +1

Query: 358 LRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVL 537
           L +A  E+P+L+TE+P N    REK  ++  E +  PA ++    VL+ +A+G+ T +V+
Sbjct: 95  LELALGENPLLMTESPWNTPKAREKAIELAMEGWGVPAFWLTKTPVLAAFAAGKATALVV 154

Query: 538 DSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKI 654
           D G   +    +++G  L  ++ R  + G  L+D + ++
Sbjct: 155 DCGGANTSVTAVHDGMVLKRSVQRSQVGGLWLSDQIRRM 193


>UniRef50_Q3M0W2 Cluster: Actin 4-2; n=3; Paramecium
           tetraurelia|Rep: Actin 4-2 - Paramecium tetraurelia
          Length = 345

 Score = 62.5 bits (145), Expect = 1e-08
 Identities = 55/229 (24%), Positives = 102/229 (44%), Gaps = 2/229 (0%)
 Frame = +1

Query: 76  MCDEEVAALVVDNGSGMCKAGFAGDDAPR-AVFPSIVGRPRHQGVMVGMGQKDSYVGDEA 252
           M  +E+ ++V D G+   +AGF GDD PR + F       +     +G G          
Sbjct: 1   MNSDEIISVVADIGNLYTRAGFTGDDFPRWSTFSKCTETMQFGDEALGYGNGQ------- 53

Query: 253 QSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK 432
                +L +  P    +  N   ++K+     + +L V  +++ +LL       K + +K
Sbjct: 54  -----VLDILQPFNPDLYENL--LKKM-----FEKLGVQSKDYSLLLANN-FQTKHDLQK 100

Query: 433 MTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL 612
           + +I+FE+   P  +    A LS +++GR+T ++LD G   +    +++GY L    ++ 
Sbjct: 101 VVEILFESVEIPNFFTIRNAALSTFSAGRSTALILDIGAYSTTASAVHDGYTLLKTQIQA 160

Query: 613 DLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKE-KLCYVALDFEQE 756
            + G  L D   + +      F  T    + RDIK+  L Y  +D  Q+
Sbjct: 161 PIGGEILNDPFRQFVVGEYNQFKKTC---LARDIKQGLLTYEQIDSTQQ 206


>UniRef50_A3FQE6 Cluster: Putative uncharacterized protein; n=2;
           Cryptosporidium|Rep: Putative uncharacterized protein -
           Cryptosporidium parvum Iowa II
          Length = 396

 Score = 61.7 bits (143), Expect = 2e-08
 Identities = 48/211 (22%), Positives = 101/211 (47%), Gaps = 25/211 (11%)
 Frame = +1

Query: 94  AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGD-EAQSKRGI 270
           +++++D G+   +AG+ GDD PR+V P+ +G P  +  ++   +  + +   +   KR  
Sbjct: 15  SSIILDIGTQSIRAGYGGDDLPRSVVPTCIGIPNKEVDLIDSNRLCNTIFPLKPWEKRDY 74

Query: 271 LTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPE---EHPVLLTE-----APLNPKANR 426
           + + +P+++ I     +  + +      EL ++ +        LT+      PL+ + N 
Sbjct: 75  IEVLHPLQYNIQEKAIEFNEEYLTKIIQELSLSQKFTNSTSSFLTKHNYIFEPLDDRMNG 134

Query: 427 E----------------KMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVS 558
           +                K+ +I FE     +++ + + VLS +A GRT+GIV+D G  VS
Sbjct: 135 QTLLIPIHSTSNPNNSIKLAEIAFEKLEVASLFTSRRPVLSCFACGRTSGIVVDIGASVS 194

Query: 559 HTVPIYEGYALPHAILRLDLAGRDLTDYLMK 651
           +   + +G+ +  +I    +AG  L + + K
Sbjct: 195 NVSCVQDGHCIQGSIQEYPVAGDFLDNEIYK 225


>UniRef50_A3FQH9 Cluster: Actin-like protein, putative; n=2;
           Cryptosporidium|Rep: Actin-like protein, putative -
           Cryptosporidium parvum Iowa II
          Length = 367

 Score = 60.9 bits (141), Expect = 4e-08
 Identities = 52/219 (23%), Positives = 97/219 (44%), Gaps = 12/219 (5%)
 Frame = +1

Query: 160 RAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWH 339
           R  FP+ +G+ R +  +        Y  D+  S     +   P   G++ +      IW 
Sbjct: 11  RHCFPNCIGKVRRKDKI--------YTSDQIYSLNEYFSY-CPFSEGLLIDVSMENDIWE 61

Query: 340 HTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASG- 516
           + F N++ ++P +  +L+TE  LNP + +  + +I+FE F      V     +S +A   
Sbjct: 62  YIF-NKMNISPGDIGLLVTEPFLNPSSLQHSLFEIIFEQFGFNKAIVTNPPAISQFAFNP 120

Query: 517 -----------RTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTE 663
                          ++LD G     +VP ++G  +  A  RLD+ G  L   L   L+ 
Sbjct: 121 QLIPNTEQQVINPCYLILDCGYQCCFSVPFFQGSPIYKACRRLDIGGYHLDLALKNFLSL 180

Query: 664 RGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSS 780
           R    + ++   IV  IKE  CY++ +F+ +++ +  +S
Sbjct: 181 RQVDLSRSS--LIVSKIKESCCYISKNFDLDISRSPGNS 217


>UniRef50_A0D9D5 Cluster: Chromosome undetermined scaffold_42, whole
           genome shotgun sequence; n=1; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_42,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 94

 Score = 60.9 bits (141), Expect = 4e-08
 Identities = 30/67 (44%), Positives = 42/67 (62%), Gaps = 2/67 (2%)
 Frame = +1

Query: 100 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRP--RHQGVMVGMGQKDSYVGDEAQSKRGIL 273
           ++ D+G+G  K GFAGD+ P   FP++VGRP  R    +     KD  +GDEAQ  RG+L
Sbjct: 5   IIEDSGTGYLKIGFAGDNFPSHSFPAMVGRPTLRADEQLDDANLKDIMIGDEAQPYRGLL 64

Query: 274 TLKYPIE 294
            L +P+E
Sbjct: 65  ELTHPLE 71


>UniRef50_A1CCH7 Cluster: Chromatin remodeling complex subunit
           (Arp9), putative; n=20; Pezizomycotina|Rep: Chromatin
           remodeling complex subunit (Arp9), putative -
           Aspergillus clavatus
          Length = 693

 Score = 60.1 bits (139), Expect = 6e-08
 Identities = 39/133 (29%), Positives = 64/133 (48%), Gaps = 2/133 (1%)
 Frame = +1

Query: 283 YPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN 462
           YPIE+G + +W     +  H  +N L   P   P++L   P+    +RE +TQ +FE F 
Sbjct: 146 YPIENGRIVDWPCFFALLTHV-HNTLS-PPFHTPIMLISEPVWSARDREAITQFVFEKFK 203

Query: 463 TPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAI-LRLDLAGRD-LT 636
           TPA  +   A+   Y  G +T  V+D G        + +     H   + L+  G D +T
Sbjct: 204 TPAFCLMDSALAICYGYGTSTATVIDVGKDKVDVTAVTDFMVNEHGRGVALEGCGGDYMT 263

Query: 637 DYLMKILTERGYS 675
           D L ++L  +G++
Sbjct: 264 DRLWELLRSKGFT 276


>UniRef50_UPI00015B5EE4 Cluster: PREDICTED: similar to Actin-related
           protein 10 homolog (S. cerevisiae); n=1; Nasonia
           vitripennis|Rep: PREDICTED: similar to Actin-related
           protein 10 homolog (S. cerevisiae) - Nasonia vitripennis
          Length = 373

 Score = 59.7 bits (138), Expect = 8e-08
 Identities = 50/213 (23%), Positives = 99/213 (46%), Gaps = 1/213 (0%)
 Frame = +1

Query: 100 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTL 279
           ++ D GS   K G+AG+ APR +  + V  P                  E++  R I + 
Sbjct: 17  IIFDIGSAYTKYGYAGEAAPRGIIRTEVKCP------------------ESKEFRKIFS- 57

Query: 280 KYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETF 459
            Y  E  +   +  + +  H+ F+    ++P++  +++ E+PL P   R  + ++MF  F
Sbjct: 58  -YKDEDDL---YQLLVEFLHYIFFKRTVISPKDIRIVILESPLIPSKFRNTLVKVMFRHF 113

Query: 460 NTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTD 639
              ++ V    ++++   G  T +VLD G   +  +P++EG  +  A   L LA + + +
Sbjct: 114 EVGSLMVLPAHLVTISTLGMDTAMVLDVGYEEATLIPVFEGVPILKAWQALPLASKAVHN 173

Query: 640 Y-LMKILTERGYSFTTTAEREIVRDIKEKLCYV 735
             L  +L+E+          +++ DIK + C+V
Sbjct: 174 KGLQDVLSEK------ELNEKLIEDIKVQTCFV 200


>UniRef50_UPI0000D55EE2 Cluster: PREDICTED: similar to actin-related
           protein 10 homolog; n=2; Endopterygota|Rep: PREDICTED:
           similar to actin-related protein 10 homolog - Tribolium
           castaneum
          Length = 370

 Score = 59.3 bits (137), Expect = 1e-07
 Identities = 34/133 (25%), Positives = 66/133 (49%), Gaps = 1/133 (0%)
 Frame = +1

Query: 340 HTFYNELRV-APEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASG 516
           HT Y +  + +P++ P+++ E+ L+P   RE + +++F  +    M +    ++SL   G
Sbjct: 69  HTLYFKYALFSPKDKPIVVVESLLSPTLFRETLAKVLFVHYEISMMLIVPSHLVSLSTLG 128

Query: 517 RTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAER 696
             T +VLD G   +  +P+  G  + HA   L L  + + + L  +L+          E 
Sbjct: 129 AETALVLDVGYIEAVAIPVCFGLPVIHAWQALPLGAQAIHNNLRTLLSSENTGINQLPE- 187

Query: 697 EIVRDIKEKLCYV 735
            ++ DIK + C+V
Sbjct: 188 TVIEDIKVRCCFV 200


>UniRef50_A6RD74 Cluster: Putative uncharacterized protein; n=1;
           Ajellomyces capsulatus NAm1|Rep: Putative
           uncharacterized protein - Ajellomyces capsulatus NAm1
          Length = 731

 Score = 58.8 bits (136), Expect = 1e-07
 Identities = 38/135 (28%), Positives = 63/135 (46%), Gaps = 4/135 (2%)
 Frame = +1

Query: 283 YPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEH-PVLLTEAPLNPKANREKMTQIMFETF 459
           YPI +G +  W     +  H F     ++P  H P++    P+    +RE +TQ +FE F
Sbjct: 163 YPIRNGEIVEWSCFFALLSHIFKT---LSPPFHTPIMFIAQPVWTARDREAITQFVFEKF 219

Query: 460 NTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAI---LRLDLAGRD 630
            TPA  +   A+ + YA G     V+D G G +    + +     H     LR +  G  
Sbjct: 220 QTPAFCLMDSALAACYAYGTVNATVIDIGHGKADVTAVTDFVVNEHGRGFGLR-NCGGEA 278

Query: 631 LTDYLMKILTERGYS 675
           +TD L ++L  +G++
Sbjct: 279 MTDRLEELLGPKGFT 293


>UniRef50_Q4UF64 Cluster: Actin-related protein, putative; n=2;
           Theileria|Rep: Actin-related protein, putative -
           Theileria annulata
          Length = 451

 Score = 58.4 bits (135), Expect = 2e-07
 Identities = 39/150 (26%), Positives = 73/150 (48%), Gaps = 8/150 (5%)
 Frame = +1

Query: 358 LRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVL 537
           L + P  HP+L+ E     K  R+   +++FE     A Y+A +A L+ ++ GR++ +++
Sbjct: 120 LGLDPSIHPILVVEPTAESKQFRDSSLEVIFEQIGACASYLAKRAALTAFSVGRSSALIV 179

Query: 538 DSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYS-FTTTAE------- 693
           D G G     P++EG +L   I    + G  L   L   L    ++ F  +++       
Sbjct: 180 DVGAGGCTVSPVHEGISLQSTIQDSLIGGNTLDLQLANYLFNDNHNMFEPSSDPYKEYLR 239

Query: 694 REIVRDIKEKLCYVALDFEQEMATAASSSS 783
            ++ ++++EK C+   D   E   AA S+S
Sbjct: 240 LQMAKELREKFCF--YDNVTEDTNAADSAS 267


>UniRef50_Q3M0Y1 Cluster: Actin7-2; n=2; Paramecium tetraurelia|Rep:
           Actin7-2 - Paramecium tetraurelia
          Length = 387

 Score = 58.0 bits (134), Expect = 3e-07
 Identities = 46/195 (23%), Positives = 87/195 (44%), Gaps = 1/195 (0%)
 Frame = +1

Query: 100 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTL 279
           ++ + G    + G+AG D P  V PS +     +G M  + Q  +Y         G   +
Sbjct: 15  VIFEFGQQNTRVGYAGTDGPEVVLPSDL-LMDSEGNMKFIEQNSTY------QPIG-FDV 66

Query: 280 KYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEH-PVLLTEAPLNPKANREKMTQIMFET 456
           K  ++ G + ++D  ++   H   N L    E H P    E     K  R K+ +++FE 
Sbjct: 67  KNILQGGQIVDFDIWKEYVEHILNNVL--FQERHFPFFFVENGNVKKETRNKIIEMLFEE 124

Query: 457 FNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 636
            +  +++     +L+ Y  G+   +V+D G   +   PI +G  +   + R D+ G  +T
Sbjct: 125 IDVSSVFFHKNTMLAQYIVGKDNVLVVDCGASHTTITPILDGNVIEKGVFRGDIGGEYIT 184

Query: 637 DYLMKILTERGYSFT 681
           + L  I  ++G +F+
Sbjct: 185 NKLYDIWKQQGLAFS 199


>UniRef50_A7AQU0 Cluster: Actin-related, putative; n=1; Babesia
           bovis|Rep: Actin-related, putative - Babesia bovis
          Length = 508

 Score = 57.2 bits (132), Expect = 4e-07
 Identities = 30/81 (37%), Positives = 45/81 (55%)
 Frame = +1

Query: 529 IVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVR 708
           +VLD G G +H+VP  EG  +  A LR ++ G  L  YL  +   R  +        +V+
Sbjct: 200 LVLDCGFGATHSVPFVEGKPIQRAALRSNIGGSHLNAYLKNVSAIR--TINLEFNELMVQ 257

Query: 709 DIKEKLCYVALDFEQEMATAA 771
            +KE+ CYV+LDF+ E+  AA
Sbjct: 258 HMKEESCYVSLDFDLELRAAA 278


>UniRef50_Q5CS19 Cluster: Actin-like protein; n=2;
           Cryptosporidium|Rep: Actin-like protein -
           Cryptosporidium parvum Iowa II
          Length = 418

 Score = 56.0 bits (129), Expect = 1e-06
 Identities = 27/101 (26%), Positives = 56/101 (55%)
 Frame = +1

Query: 424 REKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAI 603
           +EK+ + + E ++   +      +L+LY+ G+ TGIV+D G   ++  P+ EG +  +  
Sbjct: 159 KEKVNEWLKENYDFNQVTFIPAYLLTLYSYGKETGIVVDIGSFWTNITPVIEGVSDDNYS 218

Query: 604 LRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKL 726
           L + + GR L +Y+  +L+ RG  F+   + + + + K+ L
Sbjct: 219 LSIPIGGRSLEEYMKILLSRRGLKFSGKKDTKFIEETKDDL 259


>UniRef50_A2DKB8 Cluster: Actin family protein; n=1; Trichomonas
           vaginalis G3|Rep: Actin family protein - Trichomonas
           vaginalis G3
          Length = 372

 Score = 55.6 bits (128), Expect = 1e-06
 Identities = 40/140 (28%), Positives = 65/140 (46%), Gaps = 1/140 (0%)
 Frame = +1

Query: 370 PEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGD 549
           P+E  V+LTE P +   + + ++   F+     A+ +  QA  +  +    T I LD G 
Sbjct: 84  PDELRVVLTETPFSSLEHIKYLSDFCFDLLEAQAISIKPQAYFTAISYAINTCICLDIGH 143

Query: 550 GVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLC 729
            V   +P+ + Y +P AI R  LAG  L D     LT      +T  + + VR++KE   
Sbjct: 144 DVMQCIPLVDDYVIPQAIKRSYLAGHSL-DLFTARLTLDMDQISTGEDLKKVREMKETNA 202

Query: 730 YVAL-DFEQEMATAASSSSL 786
            V L +   +MA+   +  L
Sbjct: 203 EVPLPNLRSKMASIEDNEDL 222


>UniRef50_A2G7Z1 Cluster: Actin family protein; n=1; Trichomonas
           vaginalis G3|Rep: Actin family protein - Trichomonas
           vaginalis G3
          Length = 270

 Score = 55.2 bits (127), Expect = 2e-06
 Identities = 36/128 (28%), Positives = 61/128 (47%)
 Frame = +1

Query: 394 TEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPI 573
           TEA L  +  R K+  I F T N+ A++ +     +  AS     +V+D G        +
Sbjct: 13  TEAFLTER-KRRKLADIYFNTLNSSAIFTSSGGYFASVASSNPNSLVIDIGASSGTVQAV 71

Query: 574 YEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQ 753
            +G    +++ R+   G  ++  LMK +   G S  T A    +  IK K CYV+ +F++
Sbjct: 72  LDGVTCKNSVKRMKFGGGQISLNLMKQIF--GDS-PTRASTYAIEGIKRKYCYVSTNFDE 128

Query: 754 EMATAASS 777
           E+ T + S
Sbjct: 129 EIKTFSQS 136


>UniRef50_A0BG81 Cluster: Chromosome undetermined scaffold_105,
           whole genome shotgun sequence; n=1; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_105,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 386

 Score = 55.2 bits (127), Expect = 2e-06
 Identities = 56/227 (24%), Positives = 103/227 (45%), Gaps = 8/227 (3%)
 Frame = +1

Query: 103 VVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLK 282
           V+DNGS   + G   +D  +    +++   +  G M+   + DS   DE+Q    ++T  
Sbjct: 13  VLDNGSYQIRYG---NDVQKHKQLNLIAHLKKTGQMIY--EFDSLF-DESQ----VMTYY 62

Query: 283 YPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN 462
            P   G++ ++D    IW   F N   +  ++  +     P  P     K+  +MFE +N
Sbjct: 63  KPHVRGVLVDFDKQINIWDK-FLNPKLL--KDCSITYPFQPFTPDQVVNKLFDVMFEYYN 119

Query: 463 TPAMYVAIQAVLSLY--------ASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDL 618
             A +  I     LY         S +    ++DS    ++ VPI++G  +   + R+D+
Sbjct: 120 VDA-FCPINTQKMLYYNVLAREGVSRKQFTYIIDSSHSATYLVPIFDGEIMYSGLRRIDI 178

Query: 619 AGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEM 759
            GR LT+ L   ++ +   F       +   IKE LC+V++++ Q+M
Sbjct: 179 GGRLLTNQLKDNISFK--QFDLKNYFLLSSKIKELLCFVSMNYFQDM 223


>UniRef50_A2E0F7 Cluster: Actin family protein; n=1; Trichomonas
           vaginalis G3|Rep: Actin family protein - Trichomonas
           vaginalis G3
          Length = 409

 Score = 54.8 bits (126), Expect = 2e-06
 Identities = 58/202 (28%), Positives = 89/202 (44%), Gaps = 12/202 (5%)
 Frame = +1

Query: 100 LVVDNGSGMCKAGFAGDDAPRAVFPS-IVGRPRHQGVMVGMGQKDSYVGDEAQSKR-GIL 273
           LV D GS   + G+AGD  P    PS I+ R R        G+K    GD   SK    L
Sbjct: 11  LVFDIGSCYTRFGYAGDVQPSFSVPSSIIQRVRD-------GEKTYEFGDSWLSKNMPDL 63

Query: 274 TLKYPIEHG--IVTNWDDMEKIWHHTFYNE-LRVAPEEHPVLLTEAPLNPKAN------- 423
            +   I+    +V +   +   +    Y++ L++ P +HPVLLT+ P     N       
Sbjct: 64  EVVSMIDGSGNLVPDHSQIIPTYLDWTYSKCLQIDPSDHPVLLTQ-PTQITINKGQFENW 122

Query: 424 REKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAI 603
           R+   + +FE  N P + +   + L+  + G  TGIVLD G   +  VPI+EG  L +  
Sbjct: 123 RKSWCEHLFEFANHPYLCLEFDSSLAALSRGLQTGIVLDFGWLYTRIVPIFEGKPLLNVA 182

Query: 604 LRLDLAGRDLTDYLMKILTERG 669
               +      DY+  +  + G
Sbjct: 183 RNYQIGTYTFVDYVETLTNQSG 204


>UniRef50_Q6CJF4 Cluster: Actin-like protein ARP6; n=2;
           Saccharomycetaceae|Rep: Actin-like protein ARP6 -
           Kluyveromyces lactis (Yeast) (Candida sphaerica)
          Length = 415

 Score = 54.4 bits (125), Expect = 3e-06
 Identities = 57/238 (23%), Positives = 106/238 (44%), Gaps = 26/238 (10%)
 Frame = +1

Query: 100 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTL 279
           LV+DNGS   K G +G D P      +    + +     +  +   + D +Q+      +
Sbjct: 6   LVIDNGSYEIKFGESGWDQPLRALNCLT---KDKYSRFHLSNQTKKMRDISQA-----LI 57

Query: 280 KYPIEHGIVTNWDDMEKIWHHTFYNELRVA--------PEEHPVLLTEAPLNPKANREKM 435
           + P E G + +W+   ++W + FYNE             ++H ++++E  +      + M
Sbjct: 58  RRPHELGQLVSWELESEVWDYCFYNEDDFHWNLTHDNDTKDHHLVVSETLMTIPELSKNM 117

Query: 436 TQIMFETFNTPAMYVA-IQAVLSLY-----------ASGRTTG------IVLDSGDGVSH 561
            Q++FE ++  +M+   +   +  Y           A  + T       +V+DSG   + 
Sbjct: 118 DQVIFEEYDFKSMFKGPVAQYIPFYQGQYQDDAMTAAEDKKTSSYKDFQLVIDSGFNCTW 177

Query: 562 TVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYV 735
            VPI +G     AI +LD+ GR LT  L + ++ R Y+     E  +V +IKE+  +V
Sbjct: 178 AVPIIKGVPYYKAIKKLDIGGRFLTGLLQETISFRHYN--VMEETILVNNIKEQCTFV 233


>UniRef50_Q4DEE4 Cluster: Actin-like protein, putative; n=4;
           Trypanosoma|Rep: Actin-like protein, putative -
           Trypanosoma cruzi
          Length = 372

 Score = 53.6 bits (123), Expect = 5e-06
 Identities = 37/144 (25%), Positives = 72/144 (50%), Gaps = 1/144 (0%)
 Frame = +1

Query: 289 IEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANR-EKMTQIMFETFNT 465
           +E G+  N + +E I      N+L+ + ++  +L+     + + +   ++ +++ E   T
Sbjct: 62  LERGMNQNVEQLEYIMG----NKLQCSKDDPLMLVLPEAWHERTDLVRELFRVVLEAGFT 117

Query: 466 PAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYL 645
            A+Y    +V    ASGRT+ +VLD G   + T  + +GYAL + +    LAGR +T  L
Sbjct: 118 SALYCCRPSVAWTLASGRTSAVVLDVGHNQATTTAVLDGYALRNTVASSSLAGRSVTGRL 177

Query: 646 MKILTERGYSFTTTAEREIVRDIK 717
           +++L         + +R  V  I+
Sbjct: 178 IEMLDREQLESLESIKRYRVPSIR 201


>UniRef50_Q5KH55 Cluster: Putative uncharacterized protein; n=2;
           Filobasidiella neoformans|Rep: Putative uncharacterized
           protein - Cryptococcus neoformans (Filobasidiella
           neoformans)
          Length = 613

 Score = 53.6 bits (123), Expect = 5e-06
 Identities = 47/182 (25%), Positives = 75/182 (41%)
 Frame = +1

Query: 115 GSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIE 294
           GS + K GF+G+  PRAVF S     +H          +S  G       G         
Sbjct: 82  GSRIWKVGFSGEPEPRAVFFSQDPDDKHSATEAWDLDMESVHGIHGSRSEG--------- 132

Query: 295 HGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAM 474
            G +     ++K+   TF   L    ++  V++ E    P   +E +   +F+    P++
Sbjct: 133 -GRLIGVRIVQKL-RETFIKHLLADSKQRKVVIAENTFLPTYIKEYIAHTLFDNLRVPSV 190

Query: 475 YVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKI 654
                ++L+L A GR TG+V+D G   +   P+Y    L        LAGR L   L  +
Sbjct: 191 AFTPSSLLALAACGRITGLVVDVGWLETTITPVYSSRPLFPLSRSTPLAGRRLHTRLRSL 250

Query: 655 LT 660
           L+
Sbjct: 251 LS 252


>UniRef50_UPI0000E80C06 Cluster: PREDICTED: hypothetical protein;
           n=1; Gallus gallus|Rep: PREDICTED: hypothetical protein
           - Gallus gallus
          Length = 65

 Score = 53.2 bits (122), Expect = 7e-06
 Identities = 28/59 (47%), Positives = 33/59 (55%)
 Frame = +2

Query: 86  KKLPRW**TMAPVCARPVSQEMMLLAPCSPRSWEGPAIRA*WSVWDRRTLM*EMRHRAK 262
           +KL  W  TMA VCAR     MM    CS   W+ P I+  W VW RRT M EM+ RA+
Sbjct: 2   RKLLPWWWTMALVCARQALLGMMPPGLCSLPLWDAPGIKVSWWVWGRRTAMWEMKPRAR 60


>UniRef50_Q3M0X1 Cluster: Actin-like protein 1-1; n=3; Paramecium
           tetraurelia|Rep: Actin-like protein 1-1 - Paramecium
           tetraurelia
          Length = 658

 Score = 52.8 bits (121), Expect = 9e-06
 Identities = 46/198 (23%), Positives = 84/198 (42%), Gaps = 9/198 (4%)
 Frame = +1

Query: 100 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVG-MGQKDSYVGDEAQSKRGILT 276
           +++D G+   KAG+A    P  V  S + + +        + Q D+ V    +S      
Sbjct: 17  ILIDYGASTIKAGYATSQTPDVVIRSYINKFKDSNTQSNQIAQWDTDVFKNYRS------ 70

Query: 277 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPE---EHPVLLTEAPLNPKANREKMTQIM 447
              P E  ++ +   +E++    F   L+        HP++LTE        R  + + M
Sbjct: 71  ---PFEKNLIQHSGALEQLNDFVF-ERLQAGKHGRVNHPIILTECFATTDLARMIVLEQM 126

Query: 448 FETFNTPAMYVAIQAVLSLY-----ASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL 612
           FE +  P + + + A+ S++     A  + T +++  GD   H VPI  G  +   I RL
Sbjct: 127 FECYQVPNVMLGVDALFSVFQDDLEAYLKQTQLIVHLGDQTVHVVPIVNGQVIYSNIKRL 186

Query: 613 DLAGRDLTDYLMKILTER 666
           +L G +   Y  + +  R
Sbjct: 187 NLGGLNSLKYFYQTIQLR 204


>UniRef50_Q00UL2 Cluster: Alpha amylase 1; n=3; Ostreococcus|Rep:
           Alpha amylase 1 - Ostreococcus tauri
          Length = 913

 Score = 51.6 bits (118), Expect = 2e-05
 Identities = 25/33 (75%), Positives = 28/33 (84%)
 Frame = -1

Query: 179 IEGNTARGASSPAKPALHIPEPLSTTNAATSSS 81
           ++GNTA GASSPAKPAL IPEPLS T+A TS S
Sbjct: 1   MDGNTAFGASSPAKPALTIPEPLSHTSAETSPS 33


>UniRef50_A2DVJ3 Cluster: Actin family protein; n=1; Trichomonas
           vaginalis G3|Rep: Actin family protein - Trichomonas
           vaginalis G3
          Length = 394

 Score = 51.2 bits (117), Expect = 3e-05
 Identities = 53/204 (25%), Positives = 82/204 (40%), Gaps = 9/204 (4%)
 Frame = +1

Query: 82  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 261
           D    ALV D GS M +AGFAG   P     S++      G++   G K+  +GD+    
Sbjct: 5   DNTYHALVYDLGSAMFRAGFAGSAYPEI---SVISA----GMVKEEGSKEFLIGDDNILS 57

Query: 262 RGILTLKYPI--EHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLN-------P 414
           + +     P+  E G+++N D +     +T        P     + T+ P +        
Sbjct: 58  KRLHNEIIPLVDESGLISNPDILSSFLQYTHQRLNEDDPHSMSAIFTQ-PAHMIVDSDFA 116

Query: 415 KANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALP 594
           K  R  + Q  FET +   + +   A+L  YA    T  V+D G      VP+ EG  L 
Sbjct: 117 KTWRTNIAQTAFETMDYANICITSDALLGAYAHCYHTATVIDFGWSSIRVVPVVEGKPLL 176

Query: 595 HAILRLDLAGRDLTDYLMKILTER 666
             +      G  L+  L+  L  R
Sbjct: 177 GCVRYHICGGMVLSQMLVDRLKSR 200


>UniRef50_Q10CH7 Cluster: Actin-related protein 7, putative,
           expressed; n=5; Oryza sativa|Rep: Actin-related protein
           7, putative, expressed - Oryza sativa subsp. japonica
           (Rice)
          Length = 398

 Score = 50.8 bits (116), Expect = 4e-05
 Identities = 24/46 (52%), Positives = 31/46 (67%)
 Frame = +1

Query: 415 KANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDG 552
           +A RE++ Q+MFE FN    Y + QAVLSLYA GR +G  +D G G
Sbjct: 156 QALREQLAQLMFEKFNVSGFYDSEQAVLSLYAVGRISGCTVDIGHG 201



 Score = 41.1 bits (92), Expect = 0.031
 Identities = 33/109 (30%), Positives = 51/109 (46%), Gaps = 2/109 (1%)
 Frame = +1

Query: 97  ALVVDNGSGMCKAGFA-GDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGIL 273
           A+VVD GS + KAG A  D +P  V PS           + +  +D  +GD A  +  + 
Sbjct: 3   AVVVDAGSKLLKAGIALPDQSPSLVMPS----------KMKLEVEDGQMGDGAVVEEVV- 51

Query: 274 TLKYPIEHGIVTNWDDMEKIWHHTFYNELR-VAPEEHPVLLTEAPLNPK 417
               P+  G V +WD ME + ++  Y+ +     +E  +L TE    PK
Sbjct: 52  ---QPVVRGFVKDWDAMEDLLNYVLYSNIGWEIGDEGQILFTEPLFTPK 97


>UniRef50_Q0UJ41 Cluster: Putative uncharacterized protein; n=1;
           Phaeosphaeria nodorum|Rep: Putative uncharacterized
           protein - Phaeosphaeria nodorum (Septoria nodorum)
          Length = 645

 Score = 50.0 bits (114), Expect = 7e-05
 Identities = 36/133 (27%), Positives = 58/133 (43%), Gaps = 1/133 (0%)
 Frame = +1

Query: 184 GRPRHQGVMVGMGQKDSYVGDEAQ-SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNEL 360
           G  +     V  G+ D  + +E + S+ G +   +PI+ G + +W     +  H  YN L
Sbjct: 70  GEAQEDAKPVTEGEDDEILWEEDRISEEGAI---WPIQDGRIVDWPCFYALLTHV-YNTL 125

Query: 361 RVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLD 540
              P    +LL   P       EK+TQ  FE F TPA  +   A+ + +A G  T  ++D
Sbjct: 126 N-PPFHTAILLIAQPAWTPREHEKLTQFFFEKFKTPAFGLMDAALATTWAYGVHTATIID 184

Query: 541 SGDGVSHTVPIYE 579
            G   +    + E
Sbjct: 185 VGKNKADVTAVSE 197


>UniRef50_A7EG89 Cluster: Putative uncharacterized protein; n=2;
           Sclerotiniaceae|Rep: Putative uncharacterized protein -
           Sclerotinia sclerotiorum 1980
          Length = 669

 Score = 49.6 bits (113), Expect = 9e-05
 Identities = 30/89 (33%), Positives = 44/89 (49%), Gaps = 1/89 (1%)
 Frame = +1

Query: 283 YPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEH-PVLLTEAPLNPKANREKMTQIMFETF 459
           +P+  G + N        HH  +N+L  +P  H PV+L   P     N E +TQ +FE F
Sbjct: 97  WPLREGRIENLPAFCAFLHHV-HNQL--SPTLHTPVMLIAQPSWTAKNHEDLTQFIFEKF 153

Query: 460 NTPAMYVAIQAVLSLYASGRTTGIVLDSG 546
            TPA+ +   A+ + YA G     V+D G
Sbjct: 154 RTPALCIMDSALATSYAFGIANSTVIDVG 182


>UniRef50_Q38C43 Cluster: Actin-like protein, putative; n=4;
           Trypanosoma|Rep: Actin-like protein, putative -
           Trypanosoma brucei
          Length = 558

 Score = 39.9 bits (89), Expect(2) = 1e-04
 Identities = 23/73 (31%), Positives = 40/73 (54%)
 Frame = +1

Query: 526 GIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIV 705
           G+V+D G   +  VP      L  +I+R+D+ G+ L++ L ++++        T +  +V
Sbjct: 235 GMVVDFGFSSTTVVPYVNFIPLQDSIVRIDVGGKLLSNRLKELISFT--QVNVTEDGWLV 292

Query: 706 RDIKEKLCYVALD 744
             I E+ CYVALD
Sbjct: 293 NHIMEQACYVALD 305



 Score = 28.7 bits (61), Expect(2) = 1e-04
 Identities = 33/142 (23%), Positives = 56/142 (39%), Gaps = 4/142 (2%)
 Frame = +1

Query: 100 LVVDNGSGMCKAGFAGDDAPRAVF-PSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGI-- 270
           LVVDNG  M KA +   D   +     I   P   G    +G+    VG++         
Sbjct: 57  LVVDNGGYMLKALYITSDGKSSFLRGKIAVIPNCVGAASYVGR--GIVGEQLFKLPHFHG 114

Query: 271 LTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLN-PKANREKMTQIM 447
             ++ P++ G + +      IW +     L VA E    L+   P   PK   E +  ++
Sbjct: 115 FMVRRPVDRGFIVDAGLQSYIWEY-LLQHLAVADESEVELVMTVPFGAPKQVGELLHYLV 173

Query: 448 FETFNTPAMYVAIQAVLSLYAS 513
            + F   ++     + L+L +S
Sbjct: 174 AQRFRFRSVTFVSSSFLTLVSS 195


>UniRef50_A7AQB8 Cluster: Actin-related protein, putative; n=1;
           Babesia bovis|Rep: Actin-related protein, putative -
           Babesia bovis
          Length = 463

 Score = 48.0 bits (109), Expect = 3e-04
 Identities = 26/95 (27%), Positives = 45/95 (47%)
 Frame = +1

Query: 385 VLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHT 564
           V+ TE  L+    R  +  ++ E       Y+  +A LS YAS R +GIV+D G   S+ 
Sbjct: 115 VIATEPNLHTPQFRNTLADVLVECQRVNKFYMCKRAALSCYASARGSGIVVDVGGACSNV 174

Query: 565 VPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 669
             + EG+ +   I    + G  +   L+  +++ G
Sbjct: 175 SVVSEGFVIQETIKEEPIGGTIMNRILLNYMSQIG 209


>UniRef50_A4RYY1 Cluster: Predicted protein; n=2; Ostreococcus|Rep:
           Predicted protein - Ostreococcus lucimarinus CCE9901
          Length = 358

 Score = 47.6 bits (108), Expect = 4e-04
 Identities = 53/208 (25%), Positives = 86/208 (41%), Gaps = 4/208 (1%)
 Frame = +1

Query: 103 VVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLK 282
           V+D   G  + G+A D   RA   +  GR R +    G G  D      A+S+       
Sbjct: 9   VLDVVDGDLRGGYALDGVARAPSATRRGRVRAKSAGRGNGSDDGAFDAIARSR------- 61

Query: 283 YPIEHGIVTNWDDMEKIWHHTFYNELR-VAPEEHPVLLTEAPLNPKANREKMTQIMFETF 459
                  V + D  E +     Y +L      E  V+  EA       RE+  ++ FE F
Sbjct: 62  -------VEDVDAYECVVRAMTYGDLGWERGSEGMVVACEASGTSNRTRERTARMFFEEF 114

Query: 460 NTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL--DLAGRDL 633
           N   +    +AV ++YA GR +G+ +D G+       + EG A  H+  R   D  GR +
Sbjct: 115 NVGGLAFLDKAVCAMYACGRASGVAIDVGEQGVECACVVEG-ATAHSTTRRNDDAGGRAM 173

Query: 634 TDYLMK-ILTERGYSFTTTAEREIVRDI 714
              L++ +  ++G +   T   +I R +
Sbjct: 174 DRALVQAVRKKQGIALDLTTASDIRRKL 201


>UniRef50_UPI0000499D03 Cluster: actin; n=1; Entamoeba histolytica
           HM-1:IMSS|Rep: actin - Entamoeba histolytica HM-1:IMSS
          Length = 338

 Score = 47.2 bits (107), Expect = 5e-04
 Identities = 34/147 (23%), Positives = 71/147 (48%), Gaps = 8/147 (5%)
 Frame = +1

Query: 286 PIEHGIVTNWDDMEKIWHHTF-------YNELRVAPEEHPVLLTEAPLNPKANRE-KMTQ 441
           P+  G V +W++++ I+   F       Y+++    ++  V +T  PLN + N   +M Q
Sbjct: 52  PMSRGKVIDWEELQDIFEEVFESFKNSYYDDIL---KDASVFVTH-PLNTQTNFPFQMEQ 107

Query: 442 IMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLA 621
           I+FE F    + +  Q +++L  S +T+G V+ SG  ++      +    P +   +++ 
Sbjct: 108 ILFEYFGVSNVCLKPQPLMALIQSNKTSGYVVQSGSEITQIACYNQMRLEPGSCQNVNIG 167

Query: 622 GRDLTDYLMKILTERGYSFTTTAEREI 702
           G D+T    +   +  Y   T  ++E+
Sbjct: 168 GIDITKDFNQRFHQNLYDIDTDKKKEL 194


>UniRef50_Q29173 Cluster: Cytoplasmic beta-actin; n=1; Sus
           scrofa|Rep: Cytoplasmic beta-actin - Sus scrofa (Pig)
          Length = 115

 Score = 47.2 bits (107), Expect = 5e-04
 Identities = 21/21 (100%), Positives = 21/21 (100%)
 Frame = +1

Query: 691 EREIVRDIKEKLCYVALDFEQ 753
           EREIVRDIKEKLCYVALDFEQ
Sbjct: 1   EREIVRDIKEKLCYVALDFEQ 21


>UniRef50_Q6CPA7 Cluster: Kluyveromyces lactis strain NRRL Y-1140
           chromosome E of strain NRRL Y- 1140 of Kluyveromyces
           lactis; n=1; Kluyveromyces lactis|Rep: Kluyveromyces
           lactis strain NRRL Y-1140 chromosome E of strain NRRL Y-
           1140 of Kluyveromyces lactis - Kluyveromyces lactis
           (Yeast) (Candida sphaerica)
          Length = 438

 Score = 47.2 bits (107), Expect = 5e-04
 Identities = 39/148 (26%), Positives = 72/148 (48%), Gaps = 2/148 (1%)
 Frame = +1

Query: 136 GFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNW 315
           GF+  D P+ + PS     +  G  V +  K   + +    +   +   Y  ++G+  +W
Sbjct: 19  GFSNQDLPQLIVPSQYLAYKRDGSDVKVFGKWEMI-EHCDDESAEIYQLYD-KNGLPNDW 76

Query: 316 DDMEKIWHHTFYNELRVAPEEHPV-LLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQA 492
           D M+  W + F + L +  E++PV ++  + LN    +  M Q++   F  P + +  +A
Sbjct: 77  DMMDAQWQYIFQS-LGIQFEDYPVCVVLPSDLNSARRKRFMEQLLGYGF--PMVQLLNEA 133

Query: 493 VLSLYASGRTTGIVLDSG-DGVSHTVPI 573
           V +  + GR++GIV+D G  GV   V I
Sbjct: 134 VCNTLSQGRSSGIVVDIGHSGVKVDVVI 161


>UniRef50_Q0IEG8 Cluster: Actin-related protein 8; n=5;
           Endopterygota|Rep: Actin-related protein 8 - Aedes
           aegypti (Yellowfever mosquito)
          Length = 562

 Score = 47.2 bits (107), Expect = 5e-04
 Identities = 32/170 (18%), Positives = 77/170 (45%), Gaps = 8/170 (4%)
 Frame = +1

Query: 259 KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRV---APEEHPVLLTEAPLNPKANRE 429
           +RG L L   +   +     D++ IW +   + LR+     +++  +L  + +  +A+ +
Sbjct: 152 RRGELNLHKDVGGSMSGVMCDLQDIWEYVLRHRLRIDLKQLKQYKAVLVISDIYNRAHLK 211

Query: 430 KMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILR 609
           ++T ++         ++    V + + +G     V+D GD  +    + +G + P+  +R
Sbjct: 212 ELTSLLLNKIGFGCCFLVQDHVSATFGAGLGYACVVDVGDQKTSISCVEDGISHPNTRVR 271

Query: 610 LDLAGRDLTDYLMKILTERGYSFTTTAERE-----IVRDIKEKLCYVALD 744
           L   G D+T     +L +  + +    +       +++ +KE +C+V LD
Sbjct: 272 LPYGGADITQTFHWMLQKCSFPYKECDQSRPQDAFLLKQLKEDICHVNLD 321


>UniRef50_Q2IL23 Cluster: Putative uncharacterized protein; n=1;
           Anaeromyxobacter dehalogenans 2CP-C|Rep: Putative
           uncharacterized protein - Anaeromyxobacter dehalogenans
           (strain 2CP-C)
          Length = 172

 Score = 46.4 bits (105), Expect = 8e-04
 Identities = 42/126 (33%), Positives = 57/126 (45%), Gaps = 14/126 (11%)
 Frame = +3

Query: 387 PAH*GSPQPQGQQRED-DPDHVRNIQHARHVRRHPSRALAVRVRSYHRYRAGLRRRCLPH 563
           P   G P+   QQR D DP   R ++ A   R  P    AV   ++HR  AG  +    H
Sbjct: 35  PERPGRPRGGEQQRRDQDPGRQRALRPAEQ-RPQP----AVGRAAHHRGHAGGAQHERAH 89

Query: 564 RAHLR-----------RIRTPPRHPASGLSRSRPHRLPHEDP--HRARLLVHYHRRAGNR 704
           + H R           R R  PRHPA   +R R   +P  +P  HRA  L    +RA +R
Sbjct: 90  QRHERPGAEEQERRGGRARHQPRHPAVEAARHRAGEVPRREPAQHRAAQLDQLAQRAAHR 149

Query: 705 S*HQGE 722
           + H+G+
Sbjct: 150 AGHRGQ 155


>UniRef50_A7DLY9 Cluster: Putative uncharacterized protein
           precursor; n=2; Methylobacterium extorquens PA1|Rep:
           Putative uncharacterized protein precursor -
           Methylobacterium extorquens PA1
          Length = 1091

 Score = 45.2 bits (102), Expect = 0.002
 Identities = 28/57 (49%), Positives = 31/57 (54%), Gaps = 2/57 (3%)
 Frame = +3

Query: 468 RHVRRHPSRALAVRVRSYHRYRAGLRRRCLPHRA--HLRRIRTPPRHPASGLSRSRP 632
           RH RRHP R  A      HR   GL R  LPHR   H RR+R P  HP  G +R+RP
Sbjct: 169 RHRRRHPGRLGA------HRGSGGLGRTLLPHRRAPHRRRVR-PQDHPVQGPARTRP 218


>UniRef50_Q8GFF2 Cluster: Putative uncharacterized protein; n=1;
           Streptomyces aureofaciens|Rep: Putative uncharacterized
           protein - Streptomyces aureofaciens
          Length = 579

 Score = 44.8 bits (101), Expect = 0.002
 Identities = 46/136 (33%), Positives = 52/136 (38%), Gaps = 7/136 (5%)
 Frame = +3

Query: 381 PSPAH*GSPQPQ-GQQREDDPDHVRNIQHARHVRRHPSRALAVRVRSYHRYRAGLRRRCL 557
           P P   G    Q GQQR  +P  VR  +    V   P R    R    HR R  LR R L
Sbjct: 38  PEPVRVGPGDRQAGQQRRREPRPVRRPRRGLRVPAPPRRTDQQRGHR-HRQRVRLRERHL 96

Query: 558 ------PHRAHLRRIRTPPRHPASGLSRSRPHRLPHEDPHRARLLVHYHRRAGNRS*HQG 719
                 P   H +R R   RH        RPHR P       R      RR G+R  H G
Sbjct: 97  RGRQPHPRGQHEQRRRQVARHRPP----LRPHRRPRRQHPAQRQHQGQERRVGHREPH-G 151

Query: 720 EAVLRRS*LRAGNGHR 767
           +   +RS    G GHR
Sbjct: 152 DERAQRSRQLHGQGHR 167


>UniRef50_Q5TQV1 Cluster: ENSANGP00000028454; n=1; Anopheles gambiae
           str. PEST|Rep: ENSANGP00000028454 - Anopheles gambiae
           str. PEST
          Length = 278

 Score = 44.8 bits (101), Expect = 0.002
 Identities = 21/49 (42%), Positives = 29/49 (59%)
 Frame = +2

Query: 458 STRPPCTSPSKPCSRCTRPVVPPVSCWTPATVSPTPCPSTKDTHSPTPS 604
           +T+PPCT+  KPC   T+   PP  C  P T +P PCP+T    +P P+
Sbjct: 223 TTQPPCTTTPKPCPTTTK--APP--C--PTTTTPPPCPTTTTPPTPCPT 265



 Score = 35.5 bits (78), Expect = 1.5
 Identities = 20/58 (34%), Positives = 27/58 (46%), Gaps = 3/58 (5%)
 Frame = +2

Query: 458 STRPPCTSPSKPCSR---CTRPVVPPVSCWTPATVSPTPCPSTKDTHSPTPSCVWT*P 622
           +++P  T+ + PC R   CT    P  S   P  V+PT  P  K T +    CV T P
Sbjct: 57  TSQPATTNAAAPCVRRCSCTNRPCPSQSSTVPPCVTPTMPPPCKTTKATAAPCVTTTP 114



 Score = 35.1 bits (77), Expect = 2.0
 Identities = 20/56 (35%), Positives = 24/56 (42%), Gaps = 1/56 (1%)
 Frame = +2

Query: 461 TRPPCTSPSKPCSRCTRPVVPPVSCWTPATVSPTPCPSTKDT-HSPTPSCVWT*PV 625
           T  PC S S     C  P +PP    T AT +P    + K +   P P C  T PV
Sbjct: 76  TNRPCPSQSSTVPPCVTPTMPPPCKTTKATAAPCVTTTPKPSPPPPPPRCNTTTPV 131



 Score = 34.7 bits (76), Expect = 2.7
 Identities = 19/49 (38%), Positives = 24/49 (48%)
 Frame = +2

Query: 458 STRPPCTSPSKPCSRCTRPVVPPVSCWTPATVSPTPCPSTKDTHSPTPS 604
           +T+PPCT+P      CT     P  C  P T    PCP+T  T  P P+
Sbjct: 213 ATKPPCTTPPTTQPPCT---TTPKPC--PTTTKAPPCPTT-TTPPPCPT 255


>UniRef50_Q5AP59 Cluster: Actin-like protein ARP6; n=2;
           Saccharomycetales|Rep: Actin-like protein ARP6 - Candida
           albicans (Yeast)
          Length = 446

 Score = 44.8 bits (101), Expect = 0.002
 Identities = 60/258 (23%), Positives = 104/258 (40%), Gaps = 33/258 (12%)
 Frame = +1

Query: 85  EEVAALVVDNGSGMCKAGF-AGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 261
           E++  LV+DNGS   KAGF  GDD        I           G+    +       + 
Sbjct: 3   EQLQKLVIDNGSYTIKAGFNTGDDDGNDTSTPIKVTNAISKTKDGIIHVGNQYLSHTNNF 62

Query: 262 RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELR-------------------------V 366
            GI   + P E   +T+W+  + IW +T  N L                          +
Sbjct: 63  SGI-QFRRPFEQNNLTSWETEKPIWDYTLDNLLLQTNDQSQSTSSSSSSSLQKHKRGKVI 121

Query: 367 APEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTT-----GI 531
            P++  ++LTE P           QI+FE +     Y  I   L  ++           +
Sbjct: 122 DPDDIHLILTEQPYQLPQLSTNTDQIIFEEYGFNKYYRCIAPSLVPFSVDTNQINDDFVL 181

Query: 532 VLDSGDGVSHTVP-IYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVR 708
           V+DSG   +  VP IY+    P A+ +L + G  L   L ++++ R Y    + +  ++ 
Sbjct: 182 VIDSGFNSTWIVPMIYQQIHWP-AVKKLPIGGNLLNGLLREMISFRHYDI--SEDPILIN 238

Query: 709 DIKEKLCYV-ALDFEQEM 759
            IKE  C++ + +++Q++
Sbjct: 239 TIKESTCFISSSNYQQDL 256


>UniRef50_A5CAW6 Cluster: Putative uncharacterized protein; n=1;
           Vitis vinifera|Rep: Putative uncharacterized protein -
           Vitis vinifera (Grape)
          Length = 451

 Score = 44.0 bits (99), Expect = 0.004
 Identities = 44/157 (28%), Positives = 77/157 (49%), Gaps = 11/157 (7%)
 Frame = +1

Query: 343 TFYNELRVAPEEHPVLLTEAPL-------NPKANREKMTQ----IMFETFNTPAMYVAIQ 489
           T Y+ + V P   P++L+  P+       + KA+R ++ +    ++F+  N PA+    Q
Sbjct: 178 TIYSRMHVKPSAQPIVLS-VPICHYDDNESAKASRRQLKETIHSVLFD-MNVPAVCAINQ 235

Query: 490 AVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 669
           A L+LYA+ +T+GIV++ G    H   I     +P  I R             + + ++ 
Sbjct: 236 ATLALYAAKQTSGIVVNIG---FHCTSI-----VPSKIFR-------------ERMQQQN 274

Query: 670 YSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSS 780
            +F +      VR +KE LCYVA D+E E++    +S
Sbjct: 275 MNFESL---YTVRSLKENLCYVAADYEAELSKDTRAS 308


>UniRef50_Q8IBQ9 Cluster: Putative uncharacterized protein
           PF07_0077; n=2; Plasmodium|Rep: Putative uncharacterized
           protein PF07_0077 - Plasmodium falciparum (isolate 3D7)
          Length = 1032

 Score = 44.0 bits (99), Expect = 0.004
 Identities = 24/78 (30%), Positives = 42/78 (53%), Gaps = 1/78 (1%)
 Frame = +1

Query: 529 IVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREI-V 705
           + +D G   ++ +P  E   + +A+LR  ++G  L  YL   L+   Y        E+ V
Sbjct: 476 LYIDVGFSHTYVLPYIEYKLIEYAVLRTKISGSILNSYLKSTLS---YKHVNLEHNELLV 532

Query: 706 RDIKEKLCYVALDFEQEM 759
            +IKE+ CYV+LD+ +E+
Sbjct: 533 ENIKERACYVSLDYLKEL 550



 Score = 33.9 bits (74), Expect = 4.7
 Identities = 36/161 (22%), Positives = 69/161 (42%), Gaps = 14/161 (8%)
 Frame = +1

Query: 88  EVAALVVDNGSGMCKAG-----------FAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 234
           ++  L++DNG+G+ K G              +  P+ + P+ VG+ R + +         
Sbjct: 8   DIPKLILDNGAGLIKGGILPSYSQIEGSLCEEIEPKFILPNCVGQIRKKNIF-------- 59

Query: 235 YVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTF--YNELRVAPEEHPVLLTEAPL 408
           ++ D  QS       + P   G++ + +   KIW   F   N +     E  + +TE+ L
Sbjct: 60  HISDSCQSICEYFCHR-PHVDGLLLDLELETKIWEKIFSCRNTVGGKINEMGLCVTESYL 118

Query: 409 NPKANREKMTQIMFETFN-TPAMYVAIQAVLSLYASGRTTG 528
            P   ++ + +++FE FN    + V+ Q +L     G   G
Sbjct: 119 TPAYIKQGVIELLFEYFNMNQIVIVSSQTMLPFSYIGLNLG 159


>UniRef50_Q54JV5 Cluster: Putative uncharacterized protein; n=1;
           Dictyostelium discoideum AX4|Rep: Putative
           uncharacterized protein - Dictyostelium discoideum AX4
          Length = 873

 Score = 44.0 bits (99), Expect = 0.004
 Identities = 35/148 (23%), Positives = 61/148 (41%), Gaps = 4/148 (2%)
 Frame = +1

Query: 274 TLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHP----VLLTEAPLNPKANREKMTQ 441
           T    I H + + +DD+ ++W +     L +   +      V +    ++ K+ ++  T 
Sbjct: 276 TFNTGIYHSVQSMFDDITQMWKYAIQRYLNIPSSDLSSYGCVYVVTDNIDRKSLKQITTL 335

Query: 442 IMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLA 621
           ++ E   T  ++       S   S  T   V+D G        + EGY LP+  L L   
Sbjct: 336 LLKELQFTSVLFFQESICSSFGVSMATQSCVIDLGHQKISIACVDEGYLLPNTRLTLGYG 395

Query: 622 GRDLTDYLMKILTERGYSFTTTAEREIV 705
           G  LT  L  +LT    S + T  R++V
Sbjct: 396 GEQLTKLLEYLLTGMDKSDSDTLTRQMV 423


>UniRef50_A5KC80 Cluster: Putative uncharacterized protein; n=1;
           Plasmodium vivax|Rep: Putative uncharacterized protein -
           Plasmodium vivax
          Length = 855

 Score = 44.0 bits (99), Expect = 0.004
 Identities = 25/73 (34%), Positives = 41/73 (56%), Gaps = 3/73 (4%)
 Frame = +1

Query: 550 GVSHT--VPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREI-VRDIKE 720
           G SHT  +P  E   + +AILR  ++   L  YL  +L+   Y        E+ V ++KE
Sbjct: 457 GFSHTYVLPYIEYRLIEYAILRTKVSASILNTYLKNVLS---YKHVNLEHNELLVENVKE 513

Query: 721 KLCYVALDFEQEM 759
           + CYV+LD+E+++
Sbjct: 514 RACYVSLDYERDL 526



 Score = 36.7 bits (81), Expect = 0.66
 Identities = 38/161 (23%), Positives = 71/161 (44%), Gaps = 14/161 (8%)
 Frame = +1

Query: 88  EVAALVVDNGSGMCKAGFA----------GDDA-PRAVFPSIVGRPRHQGVMVGMGQKDS 234
           +V  L++DNG G+ K G            GD+  P+ + P+ VG+ R + ++        
Sbjct: 8   DVPKLILDNGGGLIKGGVLPSYSQMSNSQGDEIEPKFIVPNCVGQVRKKNIV-------- 59

Query: 235 YVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVA--PEEHPVLLTEAPL 408
           ++ D   S       + P   G++ + +   KIW   F  +  V    ++  + +TE+ L
Sbjct: 60  HISDGCYSICEYFCHR-PHVDGLLLDLEMQTKIWERIFSCKQTVGFKIKDMAICITESYL 118

Query: 409 NPKANREKMTQIMFETFN-TPAMYVAIQAVLSLYASGRTTG 528
            P   R+ + +++FE FN    + V+ Q +L     G   G
Sbjct: 119 TPAYIRQGVIELLFEYFNFNQIVVVSSQTMLPFSFIGLNLG 159


>UniRef50_A4S826 Cluster: Predicted protein; n=1; Ostreococcus
           lucimarinus CCE9901|Rep: Predicted protein -
           Ostreococcus lucimarinus CCE9901
          Length = 346

 Score = 43.6 bits (98), Expect = 0.006
 Identities = 21/27 (77%), Positives = 23/27 (85%), Gaps = 1/27 (3%)
 Frame = +1

Query: 76  MCDE-EVAALVVDNGSGMCKAGFAGDD 153
           M DE E++ALV DNGSGM KAGFAGDD
Sbjct: 1   MADEGELSALVCDNGSGMVKAGFAGDD 27


>UniRef50_A7RTR2 Cluster: Predicted protein; n=1; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 202

 Score = 43.6 bits (98), Expect = 0.006
 Identities = 20/44 (45%), Positives = 28/44 (63%)
 Frame = +1

Query: 607 RLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVA 738
           RL   GR +TD L + LTE+G+ F +  E  + R IKE+ CYV+
Sbjct: 1   RLPYGGRQVTDTLARHLTEKGHRFFSEVETYVARLIKEQACYVS 44


>UniRef50_Q0J6K8 Cluster: Os08g0300300 protein; n=1; Oryza sativa
           (japonica cultivar-group)|Rep: Os08g0300300 protein -
           Oryza sativa subsp. japonica (Rice)
          Length = 538

 Score = 43.2 bits (97), Expect = 0.008
 Identities = 36/101 (35%), Positives = 42/101 (41%), Gaps = 5/101 (4%)
 Frame = +3

Query: 399 GSPQPQGQQREDDPDHVRNIQHARHVRRHPSRALAVRVRSYHRYRAGLRRR-----CLPH 563
           G P PQ Q+R     H + + H    R  P     +  R     RA LRRR       PH
Sbjct: 108 GQPLPQHQRRR----HPQPLLHGHQRRLPPGLHARLFRRLLRARRAQLRRRRAVGAVRPH 163

Query: 564 RAHLRRIRTPPRHPASGLSRSRPHRLPHEDPHRARLLVHYH 686
             H R +R P RH A    R+RP   P   P R RLL   H
Sbjct: 164 HPHRRHLRPPRRHAARRPLRTRPR--PRRHP-RLRLLPRRH 201


>UniRef50_A3LE40 Cluster: Glycerol kinase; n=1; Pseudomonas
           aeruginosa 2192|Rep: Glycerol kinase - Pseudomonas
           aeruginosa 2192
          Length = 504

 Score = 42.7 bits (96), Expect = 0.010
 Identities = 35/100 (35%), Positives = 41/100 (41%), Gaps = 3/100 (3%)
 Frame = +3

Query: 405 PQPQGQQREDDPDH--VRNIQHARHVRRHPSRALAVRVRSYHRYRAGLRRRCLPHRAHLR 578
           P P  Q R  DP H  V  +   R  RRH +R      R   R R G ++  LPH    R
Sbjct: 369 PDPWSQGRPPDPRHPGVHRLPDPRRARRHAARCRRTPARPARRRRGGGQQ--LPHAVPGR 426

Query: 579 RIRTPPRHPASGLSRSRPHRLPHEDPHRARL-LVHYHRRA 695
                PRHP      +R HR     P R  L L+   RRA
Sbjct: 427 H----PRHPRGTSGDARDHRPRRRLPGRPGLRLLEQPRRA 462


>UniRef50_Q7RLT3 Cluster: Unnamed protein product; n=2; Plasmodium
           (Vinckeia)|Rep: Unnamed protein product - Plasmodium
           yoelii yoelii
          Length = 893

 Score = 42.7 bits (96), Expect = 0.010
 Identities = 26/73 (35%), Positives = 40/73 (54%), Gaps = 3/73 (4%)
 Frame = +1

Query: 550 GVSHT--VPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREI-VRDIKE 720
           G SHT  +P  E   + +AILR  ++   L  YL   L+   Y        E+ V +IKE
Sbjct: 452 GFSHTYILPYIEYKVIDYAILRTKVSASILNTYLKNTLS---YKHINLEHNELLVENIKE 508

Query: 721 KLCYVALDFEQEM 759
           + CYV+LD+E+++
Sbjct: 509 RACYVSLDYEKDL 521


>UniRef50_Q02817 Cluster: Mucin-2 precursor; n=56; cellular
            organisms|Rep: Mucin-2 precursor - Homo sapiens (Human)
          Length = 5179

 Score = 42.7 bits (96), Expect = 0.010
 Identities = 22/48 (45%), Positives = 28/48 (58%), Gaps = 1/48 (2%)
 Frame = +2

Query: 458  STRPPCTSPSKPCSRCTRPVVPPVSCWT-PATVSPTPCPSTKDTHSPT 598
            +T PP T+PS P    T P+ PP S  T P T +P+P P+T  T  PT
Sbjct: 1531 TTPPPTTTPSPP---TTTPITPPTSTTTLPPTTTPSPPPTTTTTPPPT 1575



 Score = 42.7 bits (96), Expect = 0.010
 Identities = 22/48 (45%), Positives = 28/48 (58%), Gaps = 1/48 (2%)
 Frame = +2

Query: 458  STRPPCTSPSKPCSRCTRPVVPPVSCWT-PATVSPTPCPSTKDTHSPT 598
            +T PP T+PS P    T P+ PP S  T P T +P+P P+T  T  PT
Sbjct: 1610 TTPPPTTTPSPP---TTTPITPPTSTTTLPPTTTPSPPPTTTTTPPPT 1654



 Score = 40.3 bits (90), Expect = 0.054
 Identities = 25/59 (42%), Positives = 32/59 (54%), Gaps = 3/59 (5%)
 Frame = +2

Query: 458  STRPPCTSPSKPCSRCTRPVVPPVSCWT-PATVSPTPCPSTKDTHSP--TPSCVWT*PV 625
            +T PP T+PS P    T P+ PP S  T P T +P+P  +T  T  P  TPS   T P+
Sbjct: 1492 TTPPPTTTPSPP---MTTPITPPASTTTLPPTTTPSPPTTTTTTPPPTTTPSPPTTTPI 1547



 Score = 36.7 bits (81), Expect = 0.66
 Identities = 18/47 (38%), Positives = 26/47 (55%)
 Frame = +2

Query: 458  STRPPCTSPSKPCSRCTRPVVPPVSCWTPATVSPTPCPSTKDTHSPT 598
            +T PP T+PS P +  T P  PP +  +P T +P   P++  T  PT
Sbjct: 1515 TTLPPTTTPSPPTTTTTTP--PPTTTPSPPTTTPITPPTSTTTLPPT 1559



 Score = 36.7 bits (81), Expect = 0.66
 Identities = 18/47 (38%), Positives = 26/47 (55%)
 Frame = +2

Query: 458  STRPPCTSPSKPCSRCTRPVVPPVSCWTPATVSPTPCPSTKDTHSPT 598
            +T PP T+PS P +  T P  PP +  +P T +P   P++  T  PT
Sbjct: 1594 TTPPPTTTPSPPTTTTTTP--PPTTTPSPPTTTPITPPTSTTTLPPT 1638



 Score = 36.3 bits (80), Expect = 0.88
 Identities = 21/56 (37%), Positives = 30/56 (53%), Gaps = 7/56 (12%)
 Frame = +2

Query: 458  STRPPCTSPSKPCSRCTRPV-----VPPVSCWT--PATVSPTPCPSTKDTHSPTPS 604
            +T PP T+PS P +  T P+      PP+S  T  P T +P+P  +T    + TPS
Sbjct: 1430 TTPPPTTTPSPPITTTTTPLPTTTPSPPISTTTTPPPTTTPSPPTTTPSPPTTTPS 1485



 Score = 36.3 bits (80), Expect = 0.88
 Identities = 20/56 (35%), Positives = 30/56 (53%)
 Frame = +2

Query: 458  STRPPCTSPSKPCSRCTRPVVPPVSCWTPATVSPTPCPSTKDTHSPTPSCVWT*PV 625
            +T PP T+PS P +  T P  PP +  +P T + TP P    T +P P+   + P+
Sbjct: 1633 TTLPPTTTPSPPPTTTTTP--PPTTTPSPPTTT-TPSPPITTTTTPPPTTTPSSPI 1685



 Score = 35.9 bits (79), Expect = 1.2
 Identities = 22/53 (41%), Positives = 28/53 (52%)
 Frame = +2

Query: 458  STRPPCTSPSKPCSRCTRPVVPPVSCWTPATVSPTPCPSTKDTHSPTPSCVWT 616
            +T PP T+PS P +  T P  P  +  TP   SPT  PS+  T + TPS   T
Sbjct: 1673 TTPPPTTTPSSPIT--TTPSPPTTTMTTP---SPTTTPSSPITTTTTPSSTTT 1720



 Score = 35.1 bits (77), Expect = 2.0
 Identities = 22/55 (40%), Positives = 28/55 (50%)
 Frame = +2

Query: 458  STRPPCTSPSKPCSRCTRPVVPPVSCWTPATVSPTPCPSTKDTHSPTPSCVWT*P 622
            +T PP T+PS P +  T P  P  +   P T + TP P+T  T SP  S   T P
Sbjct: 1414 TTLPPTTTPSPPTTTTTTP-PPTTTPSPPITTTTTPLPTT--TPSPPISTTTTPP 1465



 Score = 33.9 bits (74), Expect = 4.7
 Identities = 23/63 (36%), Positives = 31/63 (49%), Gaps = 7/63 (11%)
 Frame = +2

Query: 458  STRPPCTSPSKPCSRCTRPVV-----PPVSCWTPATVSPTPCPSTKDTHSP--TPSCVWT 616
            +T  P T+PS P S  T P       PP +  +P T +P+P  +T  T  P  TPS   T
Sbjct: 1446 TTPLPTTTPSPPISTTTTPPPTTTPSPPTTTPSPPTTTPSPPTTTTTTPPPTTTPSPPMT 1505

Query: 617  *PV 625
             P+
Sbjct: 1506 TPI 1508



 Score = 33.9 bits (74), Expect = 4.7
 Identities = 26/92 (28%), Positives = 36/92 (39%), Gaps = 7/92 (7%)
 Frame = +2

Query: 344  PSTMSCVSPPRNTQSCSXXXXXXXXXXXXXXXXXCSKHSTRPPCTSPSKPC------SRC 505
            P T +  SPP  T +                    +  +T  P T+PS P       S  
Sbjct: 1659 PPTTTTPSPPITTTTTPPPTTTPSSPITTTPSPPTTTMTTPSPTTTPSSPITTTTTPSST 1718

Query: 506  TRPVVPPVSCWTPA-TVSPTPCPSTKDTHSPT 598
            T P  PP +  TP+ T +P+P  +T  T  PT
Sbjct: 1719 TTPSPPPTTMTTPSPTTTPSPPTTTMTTLPPT 1750



 Score = 33.5 bits (73), Expect = 6.2
 Identities = 25/84 (29%), Positives = 32/84 (38%)
 Frame = +2

Query: 344  PSTMSCVSPPRNTQSCSXXXXXXXXXXXXXXXXXCSKHSTRPPCTSPSKPCSRCTRPVVP 523
            P T +  +PP  T                      S  +T PP T+PS P    T P  P
Sbjct: 1424 PPTTTTTTPPPTTTPSPPITTTTTPLPTTTPSPPISTTTTPPPTTTPSPP---TTTPSPP 1480

Query: 524  PVSCWTPATVSPTPCPSTKDTHSP 595
              +   P T + TP P+T  T SP
Sbjct: 1481 TTTPSPPTTTTTTPPPTT--TPSP 1502



 Score = 33.5 bits (73), Expect = 6.2
 Identities = 23/85 (27%), Positives = 36/85 (42%)
 Frame = +2

Query: 344  PSTMSCVSPPRNTQSCSXXXXXXXXXXXXXXXXXCSKHSTRPPCTSPSKPCSRCTRPVVP 523
            P T + ++PP +T +                    +  S  P  T+PS P +  T P  P
Sbjct: 1620 PPTTTPITPPTSTTTLPPTTTPSPPPTTTTTPPPTTTPSP-PTTTTPSPPITTTTTPP-P 1677

Query: 524  PVSCWTPATVSPTPCPSTKDTHSPT 598
              +  +P T +P+P  +T  T SPT
Sbjct: 1678 TTTPSSPITTTPSPPTTTMTTPSPT 1702



 Score = 33.5 bits (73), Expect = 6.2
 Identities = 19/55 (34%), Positives = 27/55 (49%)
 Frame = +2

Query: 458  STRPPCTSPSKPCSRCTRPVVPPVSCWTPATVSPTPCPSTKDTHSPTPSCVWT*P 622
            +T  P T+PS P +  T   +PP +  +P T +P P   T  T SP  +   T P
Sbjct: 1729 TTPSPTTTPSPPTTTMT--TLPPTTTSSPLTTTPLPPSITPPTFSPFSTTTPTTP 1781



 Score = 33.1 bits (72), Expect = 8.2
 Identities = 17/61 (27%), Positives = 30/61 (49%), Gaps = 5/61 (8%)
 Frame = +2

Query: 458  STRPPCTSPSKPCSRCTRPVV-----PPVSCWTPATVSPTPCPSTKDTHSPTPSCVWT*P 622
            +T PP T+PS P +    P +     PP +    + ++ TP P T    +P+P+   + P
Sbjct: 1649 TTPPPTTTPSPPTTTTPSPPITTTTTPPPTTTPSSPITTTPSPPTTTMTTPSPTTTPSSP 1708

Query: 623  V 625
            +
Sbjct: 1709 I 1709


>UniRef50_Q5KBY2 Cluster: RNA polymerase II transcription factor,
           putative; n=1; Filobasidiella neoformans|Rep: RNA
           polymerase II transcription factor, putative -
           Cryptococcus neoformans (Filobasidiella neoformans)
          Length = 513

 Score = 42.3 bits (95), Expect = 0.013
 Identities = 42/165 (25%), Positives = 69/165 (41%), Gaps = 7/165 (4%)
 Frame = +1

Query: 190 PRHQGVMVGMGQKDSYVGDEAQSK-RGILTLKYPIE-HGIVTNWDDMEKIWHHTF-YNEL 360
           P   G +VG    +  VG + ++     L L++P   + +  +W+  E I  H      +
Sbjct: 68  PSKSGWLVG----EELVGAQKENNWESSLELRWPFRPNKVADDWEGREYIMSHLLALLGI 123

Query: 361 RVAPEEHPVLLTEAPLNPK---ANREKMTQIMFETFNTPAMYVAIQAVLS-LYASGRTTG 528
            +      +LL   P  P    + +   TQ  FE+ NTP M+  + A LS LYA G TTG
Sbjct: 124 NIQTNSSALLLIPPPSPPTFTLSTQALYTQFAFESLNTP-MFSILPAPLSGLYALGATTG 182

Query: 529 IVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTE 663
           I++  G   S    I +          + +   D   +  ++L E
Sbjct: 183 IMIYIGHEESSAFVITDSIVRWECSTSVQIGQADCESHFEQLLLE 227


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 886,470,087
Number of Sequences: 1657284
Number of extensions: 21848315
Number of successful extensions: 105445
Number of sequences better than 10.0: 500
Number of HSP's better than 10.0 without gapping: 83476
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 101583
length of database: 575,637,011
effective HSP length: 99
effective length of database: 411,565,895
effective search space used: 67085240885
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).