SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= cesb0019
         (837 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_P24646 Cluster: Polyhedrin; n=212; root|Rep: Polyhedrin...   414   e-114
UniRef50_Q6JPH0 Cluster: Polyhedrin, major occlusion body protei...   247   2e-64
UniRef50_A2GVE7 Cluster: CMGC family protein kinase; n=2; Tricho...    35   2.2  
UniRef50_A2FHI5 Cluster: Putative uncharacterized protein; n=5; ...    34   3.8  
UniRef50_O17562 Cluster: Putative uncharacterized protein; n=2; ...    33   6.7  
UniRef50_A2QKS5 Cluster: Putative uncharacterized protein; n=1; ...    33   6.7  
UniRef50_Q1FFI1 Cluster: RNA binding S1; n=7; Clostridiales|Rep:...    33   8.9  
UniRef50_A0DH03 Cluster: Chromosome undetermined scaffold_5, who...    33   8.9  

>UniRef50_P24646 Cluster: Polyhedrin; n=212; root|Rep: Polyhedrin -
           Spodoptera littoralis nuclear polyhedrosis virus (SlNPV)
          Length = 249

 Score =  414 bits (1020), Expect = e-114
 Identities = 182/242 (75%), Positives = 212/242 (87%)
 Frame = +1

Query: 34  YSYTPTIGRTYVYDNKYYKNLGCLIKNAKRKKHLVEHEQEEKQWDLLDNYMVAEDPFLGP 213
           Y+Y+P +G+TYVYDNKYYKNLG +IKNAKRK   +E E +E++ D LD Y+VAEDPF+GP
Sbjct: 8   YNYSPHLGKTYVYDNKYYKNLGHVIKNAKRKHDALEREADERELDHLDKYLVAEDPFMGP 67

Query: 214 GKNQKLTLFKEIRSVKPDTMKLIVNWSGKEFLRETWTRFVEDSFPIVNDQEVMDVYLVAN 393
           GKNQKLTLFKEIR+VKPDTMKLIVNW+GKEFLRETWTRF+EDSFPIVNDQEVMDV+LV N
Sbjct: 68  GKNQKLTLFKEIRNVKPDTMKLIVNWNGKEFLRETWTRFMEDSFPIVNDQEVMDVFLVVN 127

Query: 394 LKPTRPNRCYKFLAQHALRWEEDYVPHEVIRIVEPSYVGMNNEYRISLAKKGGGCPIMNI 573
           ++PTRPNRC++FLAQHALR + +YVPH+VIRIVEPSYVG NNEYRISLAKKGGGCP+MN+
Sbjct: 128 MRPTRPNRCFRFLAQHALRCDPEYVPHDVIRIVEPSYVGTNNEYRISLAKKGGGCPVMNL 187

Query: 574 HSEYTNSFESFVNRVIWENFYKPIVYIGTDXXXXXXXXXXXXXXFKIKEFAPDAPLFTGP 753
           H+EYT SFESF+++VIW NFYKPIVY+GTD              FKIKEFAPDAPL+TGP
Sbjct: 188 HAEYTTSFESFIDKVIWYNFYKPIVYVGTDSAEEEEILLEVSLVFKIKEFAPDAPLYTGP 247

Query: 754 AY 759
           AY
Sbjct: 248 AY 249


>UniRef50_Q6JPH0 Cluster: Polyhedrin, major occlusion body protein;
           n=4; Nucleopolyhedrovirus|Rep: Polyhedrin, major
           occlusion body protein - Neodiprion lecontii NPV
          Length = 247

 Score =  247 bits (605), Expect = 2e-64
 Identities = 109/236 (46%), Positives = 159/236 (67%), Gaps = 1/236 (0%)
 Frame = +1

Query: 49  TIGRTYVYDNKYYKNLGCLIKNAKRKKHLVEHEQEEKQWDLLDNYMVAEDPFLGPGKNQK 228
           T  ++Y+YDNKYY+ LG +I +AK++KH  + E+  ++   L+ +++  DP  GPGK+ K
Sbjct: 11  TSAKSYIYDNKYYRGLGDIINSAKKRKHDQDWEKHAEERRALNGFILPLDPRTGPGKHVK 70

Query: 229 LTLFKEIRSVKPDTMKLIVNWSGKEFLRETWTRFVEDSFPIVNDQEVMDVYLVANLKPTR 408
           + +F+E+R++K +TMKL +NWSG+E+LRE WT F+ED+FPI N QE  DV+L     P +
Sbjct: 71  MVMFQEVRNIKANTMKLAINWSGREYLREVWTTFIEDTFPINNYQEFTDVFLEIRCTPNK 130

Query: 409 PNRCYKFLAQHALRWEEDYVPHEVIRIVEPSYVGMNNEYRISLAKKGGGCPIMNIHSEYT 588
            NR Y+FLAQH LR +ED+VP + IR++EP Y+   N   +SL K+ GGCP+M I  ++ 
Sbjct: 131 SNRHYRFLAQHGLRMDEDFVPCDTIRVIEPEYL-QGNTVSLSLLKRDGGCPMMKIRQQFN 189

Query: 589 N-SFESFVNRVIWENFYKPIVYIGTDXXXXXXXXXXXXXXFKIKEFAPDAPLFTGP 753
               E FV+R++W +F++PIVYIGTD              F IKEFAP+AP   GP
Sbjct: 190 ELDLEQFVDRILWCHFHRPIVYIGTDSGEEEEVFIEASLTFIIKEFAPEAPFVNGP 245


>UniRef50_A2GVE7 Cluster: CMGC family protein kinase; n=2;
           Trichomonas vaginalis G3|Rep: CMGC family protein kinase
           - Trichomonas vaginalis G3
          Length = 340

 Score = 35.1 bits (77), Expect = 2.2
 Identities = 21/69 (30%), Positives = 37/69 (53%), Gaps = 1/69 (1%)
 Frame = +1

Query: 112 NAKRKKHLVEHEQEEKQWDLLDNYMVAEDPFLGPGKNQKLTLFKEIRSVKPD-TMKLIVN 288
           N ++     +H+  E QW+L DNY + +   +G GK    T+FK +   + +  +K++V 
Sbjct: 20  NQQKGPEWYDHKSYEPQWNLPDNYSLIKK--VGRGKYS--TVFKAVHKRRTECAIKILVP 75

Query: 289 WSGKEFLRE 315
              K +LRE
Sbjct: 76  LDPKRYLRE 84


>UniRef50_A2FHI5 Cluster: Putative uncharacterized protein; n=5;
           Trichomonas vaginalis G3|Rep: Putative uncharacterized
           protein - Trichomonas vaginalis G3
          Length = 468

 Score = 34.3 bits (75), Expect = 3.8
 Identities = 16/59 (27%), Positives = 30/59 (50%), Gaps = 2/59 (3%)
 Frame = +1

Query: 295 GKEFLRETWTRFVEDSFPIVNDQEVMDVYLVANLKP--TRPNRCYKFLAQHALRWEEDY 465
           G EFL   +T FV+ ++  +N++   D+Y  A ++    +   C  F A     ++E+Y
Sbjct: 103 GIEFLTNIFTEFVKSTYKEINEENFYDIYDCATIQNDINKVEECISFFASKMNDFQEEY 161


>UniRef50_O17562 Cluster: Putative uncharacterized protein; n=2;
           Caenorhabditis|Rep: Putative uncharacterized protein -
           Caenorhabditis elegans
          Length = 623

 Score = 33.5 bits (73), Expect = 6.7
 Identities = 25/76 (32%), Positives = 35/76 (46%), Gaps = 1/76 (1%)
 Frame = +2

Query: 281 SSTGAAKSFCVKLGPVLLRTASPL*TTKR*WTCTSSPTSNPHAPTGATSSSLNTLLGGKK 460
           SST +  S  +      + T++P  T K   T TS+PTS   + T A  ++ +       
Sbjct: 162 SSTASVSSTILSSTATTMVTSTPT-TEKSSTTTTSTPTSEATSTTTAMITTTSGTTENPT 220

Query: 461 TT-CPTK*SELWSHPT 505
           TT CPTK      HPT
Sbjct: 221 TTDCPTKVCRYGFHPT 236


>UniRef50_A2QKS5 Cluster: Putative uncharacterized protein; n=1;
           Aspergillus niger|Rep: Putative uncharacterized protein
           - Aspergillus niger
          Length = 329

 Score = 33.5 bits (73), Expect = 6.7
 Identities = 20/57 (35%), Positives = 34/57 (59%), Gaps = 1/57 (1%)
 Frame = +2

Query: 281 SSTGAAKSFCVKLGPVLLRTASPL*TTKR*WTCTSSP-TSNPHAPTGATSSSLNTLL 448
           S++ + ++  ++L P++L  ASP  +T   +T T+SP TS P   + ATS  L  +L
Sbjct: 39  SNSSSPRTMHIRLPPLMLPGASPRLSTLEPFTTTTSPSTSFPSPSSSATSDPLADIL 95


>UniRef50_Q1FFI1 Cluster: RNA binding S1; n=7; Clostridiales|Rep:
           RNA binding S1 - Clostridium phytofermentans ISDg
          Length = 279

 Score = 33.1 bits (72), Expect = 8.9
 Identities = 29/125 (23%), Positives = 57/125 (45%), Gaps = 3/125 (2%)
 Frame = +1

Query: 181 YMVAEDPFLGPGKNQKLTLFKEIRSVKPDTMKLIVNWSGKEFLRETWTRFVEDSFPIVND 360
           Y  +ED  +      KLTL KEI  +K   +  I  +      ++ +  F E + P++ D
Sbjct: 56  YKDSEDRPIATQTTPKLTL-KEIAVLKVKEVTTIGAFLDWGIAKDLFLPFKEQTHPVIAD 114

Query: 361 QEVM-DVYLVANLKPTRPNRCYKFLAQHALRWEEDYVPHEVIRIVEP--SYVGMNNEYRI 531
           +EV+  +Y+  + +     + Y  L   +   ++D V   V  I+    ++V ++N+Y  
Sbjct: 115 EEVLVSLYIDKSKRLCATMKIYDMLQTDSPYGKDDKVTGIVYEIIPAFGAFVAVDNKYSA 174

Query: 532 SLAKK 546
            +  K
Sbjct: 175 LIPNK 179


>UniRef50_A0DH03 Cluster: Chromosome undetermined scaffold_5, whole
            genome shotgun sequence; n=1; Paramecium tetraurelia|Rep:
            Chromosome undetermined scaffold_5, whole genome shotgun
            sequence - Paramecium tetraurelia
          Length = 2443

 Score = 33.1 bits (72), Expect = 8.9
 Identities = 14/27 (51%), Positives = 17/27 (62%), Gaps = 4/27 (14%)
 Frame = -3

Query: 91   FCNIYCRTR----KYARWWGCMNNSAY 23
            +CNI+ RTR      A +WGCMN S Y
Sbjct: 1648 YCNIWYRTRYSCENIANYWGCMNTSMY 1674


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 864,833,462
Number of Sequences: 1657284
Number of extensions: 18411990
Number of successful extensions: 52820
Number of sequences better than 10.0: 8
Number of HSP's better than 10.0 without gapping: 49916
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 52740
length of database: 575,637,011
effective HSP length: 100
effective length of database: 409,908,611
effective search space used: 72963732758
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).