SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= cesb0018
         (929 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_A0MNZ0 Cluster: NADPH oxidoreductase; n=1; Bombyx mori|...    48   5e-04
UniRef50_Q177P0 Cluster: Transcription initiation factor TFIID s...    36   2.0  
UniRef50_Q4QGZ6 Cluster: Putative uncharacterized protein; n=3; ...    34   6.0  
UniRef50_UPI00015B55AA Cluster: PREDICTED: hypothetical protein;...    33   7.9  

>UniRef50_A0MNZ0 Cluster: NADPH oxidoreductase; n=1; Bombyx
           mori|Rep: NADPH oxidoreductase - Bombyx mori (Silk moth)
          Length = 191

 Score = 47.6 bits (108), Expect = 5e-04
 Identities = 21/22 (95%), Positives = 21/22 (95%)
 Frame = -2

Query: 103 FLLLRLVDELTAHLVLSGYWSP 38
           FLLLR VDELTAHLVLSGYWSP
Sbjct: 154 FLLLRWVDELTAHLVLSGYWSP 175


>UniRef50_Q177P0 Cluster: Transcription initiation factor TFIID
            subunit 1; n=3; Endopterygota|Rep: Transcription
            initiation factor TFIID subunit 1 - Aedes aegypti
            (Yellowfever mosquito)
          Length = 1962

 Score = 35.5 bits (78), Expect = 2.0
 Identities = 18/41 (43%), Positives = 24/41 (58%), Gaps = 1/41 (2%)
 Frame = +1

Query: 496  GPSSSNLIPLGQIKQEPDLHTPS-RRRAKLKPDLKLKVSVC 615
            G S S++ P    +     H+PS R++ KLKPDLKLK   C
Sbjct: 1294 GSSKSSVNPSTPKESHAKEHSPSSRKKVKLKPDLKLKCGAC 1334


>UniRef50_Q4QGZ6 Cluster: Putative uncharacterized protein; n=3;
           Leishmania|Rep: Putative uncharacterized protein -
           Leishmania major
          Length = 1409

 Score = 33.9 bits (74), Expect = 6.0
 Identities = 13/33 (39%), Positives = 19/33 (57%)
 Frame = -1

Query: 278 INIENQSTSTYNCTIDNLSTLSRSVRFRLISTR 180
           + +   +   Y CTIDN S + R +R RL+S R
Sbjct: 609 LQVHEHAPGNYTCTIDNASNMGRMMRERLLSNR 641


>UniRef50_UPI00015B55AA Cluster: PREDICTED: hypothetical protein;
           n=1; Nasonia vitripennis|Rep: PREDICTED: hypothetical
           protein - Nasonia vitripennis
          Length = 683

 Score = 33.5 bits (73), Expect = 7.9
 Identities = 20/46 (43%), Positives = 25/46 (54%), Gaps = 3/46 (6%)
 Frame = +1

Query: 496 GPSSSNLIPLGQI---KQEPDLHTPSRRRAKLKPDLKLKVSVCKVL 624
           G +SS +  +G +   K  PDLHT +RRRA L P    K S  K L
Sbjct: 328 GSASSAIEAIGSVVCHKSLPDLHTSTRRRASLSPRASTKSSSRKQL 373


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 959,493,383
Number of Sequences: 1657284
Number of extensions: 19136168
Number of successful extensions: 41424
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 39937
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 41422
length of database: 575,637,011
effective HSP length: 100
effective length of database: 409,908,611
effective search space used: 85670899699
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).