SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= cesb0017
         (851 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_A0MNZ0 Cluster: NADPH oxidoreductase; n=1; Bombyx mori|...    53   8e-06
UniRef50_A1XDB3 Cluster: STIP; n=1; Bombyx mori|Rep: STIP - Bomb...    44   0.004
UniRef50_Q9VHY6 Cluster: CG2943-PA; n=4; Sophophora|Rep: CG2943-...    36   0.98 
UniRef50_Q7S4X7 Cluster: Predicted protein; n=1; Neurospora cras...    36   1.3  
UniRef50_Q4RQZ8 Cluster: Chromosome 14 SCAF15003, whole genome s...    36   1.7  
UniRef50_Q54J62 Cluster: Putative uncharacterized protein; n=1; ...    34   4.0  
UniRef50_Q2IX18 Cluster: Putative uncharacterized protein; n=1; ...    34   5.2  
UniRef50_A1GDI9 Cluster: Putative uncharacterized protein; n=1; ...    34   5.2  
UniRef50_A1HUB7 Cluster: Putative uncharacterized protein precur...    33   6.9  

>UniRef50_A0MNZ0 Cluster: NADPH oxidoreductase; n=1; Bombyx
           mori|Rep: NADPH oxidoreductase - Bombyx mori (Silk moth)
          Length = 191

 Score = 53.2 bits (122), Expect = 8e-06
 Identities = 29/52 (55%), Positives = 30/52 (57%)
 Frame = +3

Query: 90  PLSFSPDLLSGSRFRSGGRFCEARLLLGFVLATSSGLSPLNSPTS*GYAGIA 245
           P+ F       SRFRS GRFCEA LLLG VLA S  LSP   P     AGIA
Sbjct: 74  PMKFLAGSSQSSRFRSDGRFCEALLLLGLVLANSLRLSPYELPNRPRVAGIA 125



 Score = 33.9 bits (74), Expect = 5.2
 Identities = 19/47 (40%), Positives = 25/47 (53%)
 Frame = +2

Query: 74  NPQAQPTEFLAGSSQWVAFPIRW*ILRSTALARVRLSNVVRFEPLEL 214
           NP+ QP +FLAGSSQ   F        +  L  + L+N +R  P EL
Sbjct: 69  NPKTQPMKFLAGSSQSSRFRSDGRFCEALLLLGLVLANSLRLSPYEL 115


>UniRef50_A1XDB3 Cluster: STIP; n=1; Bombyx mori|Rep: STIP - Bombyx
           mori (Silk moth)
          Length = 782

 Score = 44.4 bits (100), Expect = 0.004
 Identities = 27/58 (46%), Positives = 35/58 (60%)
 Frame = +3

Query: 42  SLATKGSTSKLTLRHSPLSFSPDLLSGSRFRSGGRFCEARLLLGFVLATSSGLSPLNS 215
           SL T G +++   R  PLSFSPDLLSGSRFR+G  +     +LG      + +SPL S
Sbjct: 380 SLKTTGHSTENEHRCCPLSFSPDLLSGSRFRTGAEY----EMLGLGTIAGNIVSPLLS 433


>UniRef50_Q9VHY6 Cluster: CG2943-PA; n=4; Sophophora|Rep: CG2943-PA
           - Drosophila melanogaster (Fruit fly)
          Length = 915

 Score = 36.3 bits (80), Expect = 0.98
 Identities = 28/93 (30%), Positives = 45/93 (48%), Gaps = 2/93 (2%)
 Frame = -1

Query: 830 YYHSTAGKLANHI*SYK*KKPNLVKFIATTPDGRFKYYLNLFSIT*MLCAVSVIKKITKN 651
           + HS    L +    YK   PNLV F+   PD   K  LNL+ +   + + SV+  +T  
Sbjct: 641 HVHSQGRVLGDRSVLYKYINPNLVAFVTQAPDSTHKSVLNLYLVD--VVSGSVVFTMTHR 698

Query: 650 KIQLLL*I--SLNDLTYKKLRSSNLKHSGVTSV 558
           K++  L I  S N L Y    +  L+ + +T++
Sbjct: 699 KVRAPLSIVHSENWLAYSYF-NEKLRRTEITTI 730


>UniRef50_Q7S4X7 Cluster: Predicted protein; n=1; Neurospora
           crassa|Rep: Predicted protein - Neurospora crassa
          Length = 700

 Score = 35.9 bits (79), Expect = 1.3
 Identities = 16/40 (40%), Positives = 23/40 (57%)
 Frame = +3

Query: 273 KKKNNDDQRSRSPRYGDPIRPPDTPRSQNQPAGSERDTPP 392
           +K ++ D    SPR  DP    D P+++NQPA   R +PP
Sbjct: 11  RKSSDYDLEDLSPRPDDPFLNHDIPQNRNQPAFRRRTSPP 50


>UniRef50_Q4RQZ8 Cluster: Chromosome 14 SCAF15003, whole genome
           shotgun sequence; n=2; Tetraodontidae|Rep: Chromosome 14
           SCAF15003, whole genome shotgun sequence - Tetraodon
           nigroviridis (Green puffer)
          Length = 569

 Score = 35.5 bits (78), Expect = 1.7
 Identities = 22/53 (41%), Positives = 25/53 (47%)
 Frame = +3

Query: 240 IASQGYQLR*EKKKNNDDQRSRSPRYGDPIRPPDTPRSQNQPAGSERDTPPTG 398
           +A Q  QLR  K+   D      P   DPIRPPD   S  Q   +E   PPTG
Sbjct: 68  LALQSIQLRSVKRPGKDSD----PAQSDPIRPPDPGLSLLQDPQAETLEPPTG 116


>UniRef50_Q54J62 Cluster: Putative uncharacterized protein; n=1;
           Dictyostelium discoideum AX4|Rep: Putative
           uncharacterized protein - Dictyostelium discoideum AX4
          Length = 248

 Score = 34.3 bits (75), Expect = 4.0
 Identities = 18/49 (36%), Positives = 30/49 (61%), Gaps = 2/49 (4%)
 Frame = -3

Query: 648 NTTSPLN--LIK*FNVQKIKIVELETLRRYICLYTYRNKTISAYYIIRS 508
           NT S LN   IK   +  ++I+E +   +Y   Y+YRNK++SA Y++ +
Sbjct: 61  NTVSFLNNVTIKFTRILMMEIIESKFFEKYRNNYSYRNKSVSAKYVLET 109


>UniRef50_Q2IX18 Cluster: Putative uncharacterized protein; n=1;
           Rhodopseudomonas palustris HaA2|Rep: Putative
           uncharacterized protein - Rhodopseudomonas palustris
           (strain HaA2)
          Length = 762

 Score = 33.9 bits (74), Expect = 5.2
 Identities = 25/81 (30%), Positives = 32/81 (39%)
 Frame = +3

Query: 153 EARLLLGFVLATSSGLSPLNSPTS*GYAGIASQGYQLR*EKKKNNDDQRSRSPRYGDPIR 332
           +AR L G +  T     P   PT   +AG    G           D QR  +P  G P +
Sbjct: 669 QARTLAG-IAWTDDNAVPAQRPTGL-FAGTIPVGTAAT-GAPDEQDRQRGSTPTSGGPTQ 725

Query: 333 PPDTPRSQNQPAGSERDTPPT 395
           P     S   P  + R+TPPT
Sbjct: 726 PASAKPSYKPPKRAARETPPT 746


>UniRef50_A1GDI9 Cluster: Putative uncharacterized protein; n=1;
           Salinispora arenicola CNS205|Rep: Putative
           uncharacterized protein - Salinispora arenicola CNS205
          Length = 358

 Score = 33.9 bits (74), Expect = 5.2
 Identities = 17/38 (44%), Positives = 21/38 (55%)
 Frame = +3

Query: 294 QRSRSPRYGDPIRPPDTPRSQNQPAGSERDTPPTGLLL 407
           +R R PR+  P RP  TP  ++QP    R   PT LLL
Sbjct: 149 RRHRRPRHHRPRRPHHTPHHRHQPRTHRRLRSPTKLLL 186


>UniRef50_A1HUB7 Cluster: Putative uncharacterized protein
           precursor; n=1; Thermosinus carboxydivorans Nor1|Rep:
           Putative uncharacterized protein precursor - Thermosinus
           carboxydivorans Nor1
          Length = 115

 Score = 33.5 bits (73), Expect = 6.9
 Identities = 25/68 (36%), Positives = 28/68 (41%)
 Frame = +3

Query: 168 LGFVLATSSGLSPLNSPTS*GYAGIASQGYQLR*EKKKNNDDQRSRSPRYGDPIRPPDTP 347
           LG V    SGL+ L              G  +R EK    DD  S  P   DP  PP   
Sbjct: 49  LGLVTGLGSGLTGLVYVLIFNLIAPLIGGIAIRVEKLTAPDDAASAEPT-ADPAPPPPDV 107

Query: 348 RSQNQPAG 371
            SQ+QPAG
Sbjct: 108 DSQHQPAG 115


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 810,336,466
Number of Sequences: 1657284
Number of extensions: 16430386
Number of successful extensions: 46357
Number of sequences better than 10.0: 9
Number of HSP's better than 10.0 without gapping: 43486
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 46271
length of database: 575,637,011
effective HSP length: 100
effective length of database: 409,908,611
effective search space used: 75013275813
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).