SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= cesb0016
         (985 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_UPI00015B6253 Cluster: PREDICTED: similar to CG33715-PD...    54   4e-06
UniRef50_Q4ABG9 Cluster: CG33715-PE, isoform E; n=7; root|Rep: C...    49   2e-04
UniRef50_Q1ZBS8 Cluster: Hypothetical methyl-accepting chemotaxi...    46   0.001
UniRef50_Q1E372 Cluster: Putative uncharacterized protein; n=1; ...    40   0.098
UniRef50_A6RG76 Cluster: Putative uncharacterized protein; n=1; ...    40   0.13 
UniRef50_Q0F0B7 Cluster: Putative uncharacterized protein; n=1; ...    39   0.23 
UniRef50_Q2S1K2 Cluster: Putative uncharacterized protein; n=1; ...    38   0.30 
UniRef50_Q54I94 Cluster: Putative uncharacterized protein; n=1; ...    38   0.30 
UniRef50_A0YIZ0 Cluster: Putative uncharacterized protein; n=1; ...    38   0.52 
UniRef50_A0BZN6 Cluster: Chromosome undetermined scaffold_14, wh...    38   0.52 
UniRef50_UPI0000E4A7BB Cluster: PREDICTED: similar to retinitis ...    37   0.91 
UniRef50_Q16UJ5 Cluster: Putative uncharacterized protein; n=1; ...    37   0.91 
UniRef50_A2E236 Cluster: Putative uncharacterized protein; n=1; ...    37   0.91 
UniRef50_Q026K6 Cluster: Putative esterase precursor; n=1; Solib...    36   1.2  
UniRef50_A5D7Q8 Cluster: SELPG protein; n=3; Bos taurus|Rep: SEL...    36   1.6  
UniRef50_Q54QC0 Cluster: Myb domain-containing protein; n=1; Dic...    36   1.6  
UniRef50_UPI0000D5592E Cluster: PREDICTED: hypothetical protein;...    36   2.1  
UniRef50_Q9VRV1 Cluster: CG10289-PA; n=3; Sophophora|Rep: CG1028...    36   2.1  
UniRef50_O15403 Cluster: Monocarboxylate transporter 7; n=26; Eu...    36   2.1  
UniRef50_UPI0000EBF232 Cluster: PREDICTED: similar to mucin 16; ...    35   2.8  
UniRef50_A4F8B2 Cluster: Putative ATP-dependent dsDNA exonucleas...    35   2.8  
UniRef50_Q9HE24 Cluster: Related to 26S proteasome-associated ub...    35   2.8  
UniRef50_A2DQS9 Cluster: Putative uncharacterized protein; n=1; ...    35   3.7  
UniRef50_Q7SBP3 Cluster: Predicted protein; n=1; Neurospora cras...    35   3.7  
UniRef50_Q6C5V0 Cluster: Similarity; n=1; Yarrowia lipolytica|Re...    35   3.7  
UniRef50_A7F232 Cluster: Putative uncharacterized protein; n=1; ...    35   3.7  
UniRef50_A6SGG5 Cluster: Putative uncharacterized protein; n=1; ...    35   3.7  
UniRef50_O60841 Cluster: Eukaryotic translation initiation facto...    35   3.7  
UniRef50_UPI000023E603 Cluster: hypothetical protein FG00263.1; ...    34   4.9  
UniRef50_Q82NY6 Cluster: Putative uncharacterized protein; n=1; ...    34   4.9  
UniRef50_Q2UB42 Cluster: Predicted protein; n=1; Aspergillus ory...    34   4.9  
UniRef50_UPI0000E482AB Cluster: PREDICTED: similar to blastula p...    34   6.4  
UniRef50_UPI0000D9B1CD Cluster: PREDICTED: hypothetical protein;...    34   6.4  
UniRef50_A1U9X9 Cluster: Putative uncharacterized protein precur...    34   6.4  
UniRef50_Q400L2 Cluster: MYC2; n=2; lamiids|Rep: MYC2 - Catharan...    34   6.4  
UniRef50_A3LQA1 Cluster: Hypopthetical protein; n=1; Pichia stip...    34   6.4  
UniRef50_Q9YDX9 Cluster: Putative uncharacterized protein; n=1; ...    34   6.4  
UniRef50_UPI0000E105C7 Cluster: hypothetical protein OM2255_1491...    33   8.5  
UniRef50_UPI000066088A Cluster: Homolog of Homo sapiens "Apolipo...    33   8.5  
UniRef50_Q2S242 Cluster: Ftsk/spoiiie family protein; n=2; Bacte...    33   8.5  
UniRef50_A3W0R3 Cluster: Uncharacterized conserved protein; n=1;...    33   8.5  
UniRef50_Q8I2J8 Cluster: Putative uncharacterized protein PFI154...    33   8.5  
UniRef50_Q55FJ7 Cluster: Putative uncharacterized protein; n=1; ...    33   8.5  
UniRef50_A2ERL6 Cluster: Viral A-type inclusion protein, putativ...    33   8.5  
UniRef50_A2DLG0 Cluster: Viral A-type inclusion protein, putativ...    33   8.5  
UniRef50_A6QXZ5 Cluster: Predicted protein; n=1; Ajellomyces cap...    33   8.5  
UniRef50_A5AB01 Cluster: Function: GAPCenA is a GTPase activatin...    33   8.5  
UniRef50_A1C839 Cluster: PT repeat family protein; n=1; Aspergil...    33   8.5  

>UniRef50_UPI00015B6253 Cluster: PREDICTED: similar to CG33715-PD;
            n=1; Nasonia vitripennis|Rep: PREDICTED: similar to
            CG33715-PD - Nasonia vitripennis
          Length = 7697

 Score = 54.4 bits (125), Expect = 4e-06
 Identities = 38/116 (32%), Positives = 50/116 (43%), Gaps = 5/116 (4%)
 Frame = +2

Query: 323  IRNDNKFWVEKHLYHDAECQYFLSMAKKSK-PTSAVGDDFEVKDQNDKDRDPXXXXXXXX 499
            I  ++ FW  KH Y +AE + F ++A++ K        D    D NDKD           
Sbjct: 3410 IAEESGFWPNKHAYEEAERELFEALAREMKIHKKQQAVDSSKNDSNDKDDPSGNSGKGGK 3469

Query: 500  XXXXXXXXXXXXFNST----YLSMDLPGGICSWKDHSSYLSAETPSDSLDSNAEAL 655
                         N T     L  DLPGGI SW D+S+YLS E  ++  D   EAL
Sbjct: 3470 SDSFNESQSSSSNNGTPRTERLVADLPGGIGSWSDYSTYLSLE-KNEHYDDEQEAL 3524


>UniRef50_Q4ABG9 Cluster: CG33715-PE, isoform E; n=7; root|Rep:
            CG33715-PE, isoform E - Drosophila melanogaster (Fruit
            fly)
          Length = 9606

 Score = 48.8 bits (111), Expect = 2e-04
 Identities = 29/74 (39%), Positives = 39/74 (52%), Gaps = 3/74 (4%)
 Frame = +2

Query: 539  NSTYLSMDLPGGICSWKDHSSYLS--AETPSDSLDSNAEALQASATEDILT-TLPTEPVV 709
            +S Y S DLPGG+  W+D S+YL+  AE P   L+S   A   S  E +LT T  T P  
Sbjct: 9295 SSEYRSTDLPGGVGHWRDDSTYLALEAEQPQVKLESVPLAPTISGVESVLTETNTTSPAP 9354

Query: 710  QTPPLQEPAINETT 751
               P+  P  + +T
Sbjct: 9355 APDPVTAPETSPST 9368


>UniRef50_Q1ZBS8 Cluster: Hypothetical methyl-accepting chemotaxis
           protein; n=2; Alteromonadales|Rep: Hypothetical
           methyl-accepting chemotaxis protein - Psychromonas sp.
           CNPT3
          Length = 690

 Score = 46.4 bits (105), Expect = 0.001
 Identities = 32/97 (32%), Positives = 48/97 (49%), Gaps = 5/97 (5%)
 Frame = +2

Query: 623 SDSLDSNAEALQASATE--DILTTLPTEPVVQTPPLQ--EPAINETTRRTPKDDLSND-I 787
           +D + S A   Q S  E   ILTTL ++  V    ++  + +   T + T K  +S D +
Sbjct: 558 ADEVRSLAARTQTSTAEINAILTTLRSDATVAVASMELTKESCQRTAKNTEKVTVSLDHL 617

Query: 788 ETLLVEIRDVQTRLTDLPDESLEATEEVSRRESNFNQ 898
              +VEI D+ T++    +E     EEVSR  SN NQ
Sbjct: 618 TAFIVEINDLSTQIATASEEQSSVNEEVSRNMSNINQ 654


>UniRef50_Q1E372 Cluster: Putative uncharacterized protein; n=1;
           Coccidioides immitis|Rep: Putative uncharacterized
           protein - Coccidioides immitis
          Length = 689

 Score = 39.9 bits (89), Expect = 0.098
 Identities = 31/100 (31%), Positives = 43/100 (43%)
 Frame = +2

Query: 554 SMDLPGGICSWKDHSSYLSAETPSDSLDSNAEALQASATEDILTTLPTEPVVQTPPLQEP 733
           S   P    S+   SS  S  T S + +S+    QA  T ++ TT+PTEP   T P Q  
Sbjct: 552 SSSSPSSSSSYTPDSS--SVSTRSSAPESSRPTSQAETTPEMSTTVPTEPPYPTTPTQTT 609

Query: 734 AINETTRRTPKDDLSNDIETLLVEIRDVQTRLTDLPDESL 853
           ++       P D +     T  +E   V T +  LP  SL
Sbjct: 610 SMTS----HPSDGIPIPPSTTPIEFPGVATAIQPLPWTSL 645


>UniRef50_A6RG76 Cluster: Putative uncharacterized protein; n=1;
           Ajellomyces capsulatus NAm1|Rep: Putative
           uncharacterized protein - Ajellomyces capsulatus NAm1
          Length = 755

 Score = 39.5 bits (88), Expect = 0.13
 Identities = 26/96 (27%), Positives = 42/96 (43%)
 Frame = +2

Query: 629 SLDSNAEALQASATEDILTTLPTEPVVQTPPLQEPAINETTRRTPKDDLSNDIETLLVEI 808
           S  S A  L +  +    +T PTEP     P+   A++   R+     +SN    L  +I
Sbjct: 413 SKQSMASTLNSCESASDASTAPTEP----SPVSISAVDSINRKKKMAGMSNQDRDLHSQI 468

Query: 809 RDVQTRLTDLPDESLEATEEVSRRESNFNQVRRSSR 916
            D+ T LTD+  E     EE+ R      + +++ R
Sbjct: 469 EDLLTALTDMQREQAALAEELQREREEREEDQQTGR 504


>UniRef50_Q0F0B7 Cluster: Putative uncharacterized protein; n=1;
           Mariprofundus ferrooxydans PV-1|Rep: Putative
           uncharacterized protein - Mariprofundus ferrooxydans
           PV-1
          Length = 192

 Score = 38.7 bits (86), Expect = 0.23
 Identities = 23/64 (35%), Positives = 29/64 (45%), Gaps = 3/64 (4%)
 Frame = +2

Query: 584 WKDHSSYLSAETPSDSLDSNAEALQASATEDILTTLPTEPVVQTP---PLQEPAINETTR 754
           W D S  L+  TP  +  S+  A+   AT D+    PT PVV  P   P   P    TTR
Sbjct: 37  WFDFSQLLTTTTPVQNDSSDLPAVPQPATIDLPEPTPTPPVVAAPSPSPAHTPVAKPTTR 96

Query: 755 RTPK 766
            T +
Sbjct: 97  PTSR 100


>UniRef50_Q2S1K2 Cluster: Putative uncharacterized protein; n=1;
            Salinibacter ruber DSM 13855|Rep: Putative
            uncharacterized protein - Salinibacter ruber (strain DSM
            13855)
          Length = 1242

 Score = 38.3 bits (85), Expect = 0.30
 Identities = 29/103 (28%), Positives = 52/103 (50%), Gaps = 3/103 (2%)
 Frame = +2

Query: 617  TPSDSLDSNAEALQASATEDILTTLPTEPVVQTPPLQEPAINETTRRTPKDDLSNDIETL 796
            T SDS  S A+A   SA++      P     Q  P  + + N    R  K+ L+ ++ETL
Sbjct: 782  TASDS--SRADASSPSASDSTGRARPDSLGSQRSPNADSSANPELAREQKE-LAKEMETL 838

Query: 797  LVEIRDVQTRLTDLPD---ESLEATEEVSRRESNFNQVRRSSR 916
            + E++D Q  + D+P    + L+   +  R++    Q+R++S+
Sbjct: 839  MEEMQDAQQDMKDVPSAPKKDLQQMRKQMRKQDLPEQMRQNSQ 881


>UniRef50_Q54I94 Cluster: Putative uncharacterized protein; n=1;
           Dictyostelium discoideum AX4|Rep: Putative
           uncharacterized protein - Dictyostelium discoideum AX4
          Length = 1186

 Score = 38.3 bits (85), Expect = 0.30
 Identities = 25/122 (20%), Positives = 53/122 (43%)
 Frame = +2

Query: 620 PSDSLDSNAEALQASATEDILTTLPTEPVVQTPPLQEPAINETTRRTPKDDLSNDIETLL 799
           P+ + + N+E++ +S+  D+  T P  P++        +  ++   T K+DLS    +  
Sbjct: 71  PTVNDNKNSESILSSSPSDVDLTSPPIPIIADSKPTSVSTTKSPSDTEKEDLSPKTTSTT 130

Query: 800 VEIRDVQTRLTDLPDESLEATEEVSRRESNFNQVRRSSRAVGAEDHGVPPEVEVQTLIKN 979
               D   ++ +   E  E  E     +    +V+   + +  E   +PP+   +TL K+
Sbjct: 131 TTKVDEINKIENEEKEKEEEKESEKHTKKEIEKVKEVEKEIQKEAPILPPKSNTETLPKS 190

Query: 980 SS 985
            S
Sbjct: 191 VS 192


>UniRef50_A0YIZ0 Cluster: Putative uncharacterized protein; n=1;
           Lyngbya sp. PCC 8106|Rep: Putative uncharacterized
           protein - Lyngbya sp. PCC 8106
          Length = 623

 Score = 37.5 bits (83), Expect = 0.52
 Identities = 25/89 (28%), Positives = 37/89 (41%), Gaps = 1/89 (1%)
 Frame = +2

Query: 596 SSYLSAETPSDSLDSNAEALQASA-TEDILTTLPTEPVVQTPPLQEPAINETTRRTPKDD 772
           S   +AETP  S ++ AE  +A+  T +       E   +TP   E    ETT  TP++ 
Sbjct: 449 SEEATAETPETSEETTAETTEATPETPENSEETTAETTAETPENSEETTAETTEETPENS 508

Query: 773 LSNDIETLLVEIRDVQTRLTDLPDESLEA 859
                ET      +     T+   E+ EA
Sbjct: 509 EETTAETTAETPEETTAETTEETPETTEA 537


>UniRef50_A0BZN6 Cluster: Chromosome undetermined scaffold_14, whole
           genome shotgun sequence; n=2; Eukaryota|Rep: Chromosome
           undetermined scaffold_14, whole genome shotgun sequence
           - Paramecium tetraurelia
          Length = 1149

 Score = 37.5 bits (83), Expect = 0.52
 Identities = 21/52 (40%), Positives = 30/52 (57%)
 Frame = +2

Query: 257 NQPKEKPIDLNLKTDVKVDIENIRNDNKFWVEKHLYHDAECQYFLSMAKKSK 412
           NQ +EK  DL+LK   +V I   RN  KF + K +YHD   Q+  S+ + +K
Sbjct: 537 NQAEEKKQDLHLKMPERVQINQFRN--KFKITKPVYHDKYDQFDRSIIQATK 586


>UniRef50_UPI0000E4A7BB Cluster: PREDICTED: similar to retinitis
           pigmentosa GTPase regulator-like protein; n=1;
           Strongylocentrotus purpuratus|Rep: PREDICTED: similar to
           retinitis pigmentosa GTPase regulator-like protein -
           Strongylocentrotus purpuratus
          Length = 724

 Score = 36.7 bits (81), Expect = 0.91
 Identities = 25/92 (27%), Positives = 43/92 (46%), Gaps = 1/92 (1%)
 Frame = +2

Query: 617 TPSDSLDSNAEALQASATEDILTTLPTEPVVQTPPLQEPAINETTRRTPKDDLSNDIETL 796
           T  +  + + E  QA +TE+I    P EPV ++    E  + E T   P ++ +   E +
Sbjct: 589 TAEEPKEEHLEESQAESTEEIKEDTPEEPVEESAESTE-EVKEETPEEPVEESTESTEEI 647

Query: 797 LVEI-RDVQTRLTDLPDESLEATEEVSRRESN 889
             E   +     T+L +ES E T+E    E++
Sbjct: 648 KEETPEEPVEESTELTEESKEETQEQPVEETS 679


>UniRef50_Q16UJ5 Cluster: Putative uncharacterized protein; n=1; Aedes
            aegypti|Rep: Putative uncharacterized protein - Aedes
            aegypti (Yellowfever mosquito)
          Length = 1447

 Score = 36.7 bits (81), Expect = 0.91
 Identities = 32/107 (29%), Positives = 47/107 (43%)
 Frame = +2

Query: 665  ATEDILTTLPTEPVVQTPPLQEPAINETTRRTPKDDLSNDIETLLVEIRDVQTRLTDLPD 844
            A +DI T  PTE   + PP  EP+   +T      + SN   TL   + D  +  T LP 
Sbjct: 891  AADDIKTE-PTEE--EPPPPSEPSATSSTVEPSPANTSNSSVTLTANLNDNSSTGTSLPL 947

Query: 845  ESLEATEEVSRRESNFNQVRRSSRAVGAEDHGVPPEVEVQTLIKNSS 985
              ++ +E VS  ES+     ++S          P E   Q LI+ S+
Sbjct: 948  LPIK-SEPVSDEESSHGNADQASVNQALPHTNQPTENANQVLIRTSN 993


>UniRef50_A2E236 Cluster: Putative uncharacterized protein; n=1;
           Trichomonas vaginalis G3|Rep: Putative uncharacterized
           protein - Trichomonas vaginalis G3
          Length = 369

 Score = 36.7 bits (81), Expect = 0.91
 Identities = 27/102 (26%), Positives = 52/102 (50%), Gaps = 5/102 (4%)
 Frame = +2

Query: 605 LSAETPSDSLDSNAEALQASATEDILTTLPTEPVVQTPPLQEPA-INETTRRTPK---DD 772
           ++++TP  SL  N +  + S ++   +   ++PV  TP   +P   N+T  RTP+   D 
Sbjct: 203 IASKTPPRSLRFNVQGEEISGSDPEESAESSQPVPSTPKTDQPKDRNKTPERTPEESWDG 262

Query: 773 LSNDIETLLVEIRDV-QTRLTDLPDESLEATEEVSRRESNFN 895
           +  D   ++V   DV + + T LP ++    +E++R +   N
Sbjct: 263 VWLDPPNVIVRGEDVPEIKETHLPIQTNYVKKEITRVQKAVN 304


>UniRef50_Q026K6 Cluster: Putative esterase precursor; n=1;
           Solibacter usitatus Ellin6076|Rep: Putative esterase
           precursor - Solibacter usitatus (strain Ellin6076)
          Length = 409

 Score = 36.3 bits (80), Expect = 1.2
 Identities = 14/33 (42%), Positives = 21/33 (63%)
 Frame = +3

Query: 330 TITNSGLKNIYTMTPNANISFQWPKNLNQHQPL 428
           T+T  G+KN+Y  T  A++   W KNLN+  P+
Sbjct: 370 TLTEKGVKNVYRETEGAHVWSVWRKNLNETAPM 402


>UniRef50_A5D7Q8 Cluster: SELPG protein; n=3; Bos taurus|Rep: SELPG
           protein - Bos taurus (Bovine)
          Length = 472

 Score = 35.9 bits (79), Expect = 1.6
 Identities = 30/97 (30%), Positives = 43/97 (44%), Gaps = 1/97 (1%)
 Frame = +2

Query: 587 KDHSSYLSAETPSDSLDSNAEALQASATEDILT-TLPTEPVVQTPPLQEPAINETTRRTP 763
           KD S+ L+A T  ++L ++    +A +TE  LT  L TEPV        P + E     P
Sbjct: 181 KDPSTELAAAT--EALSTDPVTTEALSTEPRLTEALSTEPVATEVLSTGPRLTEALSTEP 238

Query: 764 KDDLSNDIETLLVEIRDVQTRLTDLPDESLEATEEVS 874
               +   E  L E    + RLT+       ATE +S
Sbjct: 239 AATEALSTEPRLTEALSTEPRLTEALSTEPAATESLS 275


>UniRef50_Q54QC0 Cluster: Myb domain-containing protein; n=1;
            Dictyostelium discoideum AX4|Rep: Myb domain-containing
            protein - Dictyostelium discoideum AX4
          Length = 2381

 Score = 35.9 bits (79), Expect = 1.6
 Identities = 23/81 (28%), Positives = 41/81 (50%), Gaps = 1/81 (1%)
 Frame = +2

Query: 617  TPSDSLDSNAEALQASATEDILTTLPTEPVVQTPPLQEPAINETTRRTPKDDLSNDIETL 796
            TP+ +  ++A  L  ++T    T +P    + TP L  P + ETT   P D+   DI+  
Sbjct: 1442 TPTSTPSTSASTLTPTSTPTS-TPVPAPTSLSTPTLTSPVL-ETTTIIPSDNKEKDIKDG 1499

Query: 797  LVEIRD-VQTRLTDLPDESLE 856
            +  I + + + L ++P  S+E
Sbjct: 1500 IYSISNIISSELLEIPTFSIE 1520


>UniRef50_UPI0000D5592E Cluster: PREDICTED: hypothetical protein;
           n=1; Tribolium castaneum|Rep: PREDICTED: hypothetical
           protein - Tribolium castaneum
          Length = 202

 Score = 35.5 bits (78), Expect = 2.1
 Identities = 22/91 (24%), Positives = 40/91 (43%)
 Frame = +2

Query: 614 ETPSDSLDSNAEALQASATEDILTTLPTEPVVQTPPLQEPAINETTRRTPKDDLSNDIET 793
           ET   + ++  E      +E+     P E      P++EPA  E +     D+ + + E 
Sbjct: 96  ETEPAAEETTEEPAAEETSEEPAAEEPVEEPAAEEPVEEPAAEEPSEEPAADEPAAEEEN 155

Query: 794 LLVEIRDVQTRLTDLPDESLEATEEVSRRES 886
             VE+ D +T L+  P++  E   E  + E+
Sbjct: 156 --VEVNDEETSLSPEPEQEPEPEPEPEQEEN 184


>UniRef50_Q9VRV1 Cluster: CG10289-PA; n=3; Sophophora|Rep:
           CG10289-PA - Drosophila melanogaster (Fruit fly)
          Length = 991

 Score = 35.5 bits (78), Expect = 2.1
 Identities = 22/68 (32%), Positives = 32/68 (47%), Gaps = 1/68 (1%)
 Frame = +2

Query: 734 AINETTRRTP-KDDLSNDIETLLVEIRDVQTRLTDLPDESLEATEEVSRRESNFNQVRRS 910
           A+N+  R    KD+   DIE   +E+   Q      PDE   A EE    E + +QV  +
Sbjct: 463 ALNDAKRAEGGKDEEGGDIE---IEVAAAQEVAAQTPDERQTAAEENQEHEEHMSQVEAA 519

Query: 911 SRAVGAED 934
           + A  +ED
Sbjct: 520 AEATASED 527


>UniRef50_O15403 Cluster: Monocarboxylate transporter 7; n=26;
           Euteleostomi|Rep: Monocarboxylate transporter 7 - Homo
           sapiens (Human)
          Length = 523

 Score = 35.5 bits (78), Expect = 2.1
 Identities = 23/68 (33%), Positives = 38/68 (55%), Gaps = 5/68 (7%)
 Frame = -2

Query: 339 LLSLRMFSMSTFTSVFKLRSIGFSFGWFCFTIGG-----VLSFLSFC*TNNNSASSVAYL 175
           LL++ +F+ +  T  + L S    FG+   TIGG     +L  +S+     +SA+ V Y+
Sbjct: 368 LLTVSLFAFTFATEFWGLMSCSIFFGFMVGTIGGLTFHCLLKMMSWALQKMSSAAGV-YI 426

Query: 174 FIQKLSGL 151
           FIQ ++GL
Sbjct: 427 FIQSIAGL 434


>UniRef50_UPI0000EBF232 Cluster: PREDICTED: similar to mucin 16; n=2;
            Bos taurus|Rep: PREDICTED: similar to mucin 16 - Bos
            taurus
          Length = 5553

 Score = 35.1 bits (77), Expect = 2.8
 Identities = 21/61 (34%), Positives = 31/61 (50%)
 Frame = +2

Query: 584  WKDHSSYLSAETPSDSLDSNAEALQASATEDILTTLPTEPVVQTPPLQEPAINETTRRTP 763
            W + SS + A T S S+     +L  S+ E+I TTLPT  ++ +P   E   +  T   P
Sbjct: 4906 WTESSSAVPATTVSPSVSKLGTSLVTSSREEISTTLPT--LIASPGQVETTASWVTHSEP 4963

Query: 764  K 766
            K
Sbjct: 4964 K 4964


>UniRef50_A4F8B2 Cluster: Putative ATP-dependent dsDNA exonuclease;
           n=1; Saccharopolyspora erythraea NRRL 2338|Rep: Putative
           ATP-dependent dsDNA exonuclease - Saccharopolyspora
           erythraea (strain NRRL 23338)
          Length = 984

 Score = 35.1 bits (77), Expect = 2.8
 Identities = 23/87 (26%), Positives = 36/87 (41%)
 Frame = +2

Query: 668 TEDILTTLPTEPVVQTPPLQEPAINETTRRTPKDDLSNDIETLLVEIRDVQTRLTDLPDE 847
           TE+ LTT   +   +   L++ A     R     DL    E L  ++ +V+TRL     E
Sbjct: 568 TEEQLTTELADLTAERDALRDKAGRSEQRTQRLADLEASTERLSTQVAEVRTRLATSRAE 627

Query: 848 SLEATEEVSRRESNFNQVRRSSRAVGA 928
               +  V  RE+   + R     +GA
Sbjct: 628 HSSLSSTVDEREARLEEARGEFPGIGA 654


>UniRef50_Q9HE24 Cluster: Related to 26S proteasome-associated
           ubiquitin carboxyl-terminal hydrolase; n=14;
           Pezizomycotina|Rep: Related to 26S proteasome-associated
           ubiquitin carboxyl-terminal hydrolase - Neurospora
           crassa
          Length = 331

 Score = 35.1 bits (77), Expect = 2.8
 Identities = 22/58 (37%), Positives = 26/58 (44%)
 Frame = +2

Query: 752 RRTPKDDLSNDIETLLVEIRDVQTRLTDLPDESLEATEEVSRRESNFNQVRRSSRAVG 925
           RR  + D S     LL  IRD++ R  +  DE L ATEE  R    F    R    VG
Sbjct: 220 RRIARYDASEIRFNLLAMIRDLRIRAREFADEELLATEERKREAWRFENALRRHNFVG 277


>UniRef50_A2DQS9 Cluster: Putative uncharacterized protein; n=1;
           Trichomonas vaginalis G3|Rep: Putative uncharacterized
           protein - Trichomonas vaginalis G3
          Length = 999

 Score = 34.7 bits (76), Expect = 3.7
 Identities = 20/79 (25%), Positives = 35/79 (44%), Gaps = 1/79 (1%)
 Frame = +2

Query: 725 QEPAINETTRRTPKDDLSNDIETLLVEIRDVQT-RLTDLPDESLEATEEVSRRESNFNQV 901
           +E   NE  RR  K+D    ++ L +E+ D +  +  +L     E  EE  R E+   ++
Sbjct: 641 EEEKQNEDARRMKKEDYQKTLDRLKIELADAEEFKTKELARIRKETEEETKRGEAELKKL 700

Query: 902 RRSSRAVGAEDHGVPPEVE 958
           +     + AE      E+E
Sbjct: 701 QLEMNKISAEKGAAIKELE 719


>UniRef50_Q7SBP3 Cluster: Predicted protein; n=1; Neurospora
            crassa|Rep: Predicted protein - Neurospora crassa
          Length = 1365

 Score = 34.7 bits (76), Expect = 3.7
 Identities = 28/95 (29%), Positives = 45/95 (47%), Gaps = 9/95 (9%)
 Frame = +2

Query: 647  EALQASATEDILTTLPTEPVVQTPPLQEPAINETTRRTPKDDLSNDI-ETLLVEIRDVQT 823
            E ++    ED+   L  + V  +    E  +NE     PKDD+  D+ E L  E+ D  T
Sbjct: 1269 EGVKEVVKEDVKQELNEDIVEDSKEDLEEDLNEYLEEGPKDDVKEDLQEDLKDELTDELT 1328

Query: 824  R-----LTDLPDESLE---ATEEVSRRESNFNQVR 904
            R     L D P+E ++    T++V++ E   +Q R
Sbjct: 1329 RDLEGDLKDKPNEDMKPEAETKDVNKEEEAASQAR 1363


>UniRef50_Q6C5V0 Cluster: Similarity; n=1; Yarrowia lipolytica|Rep:
           Similarity - Yarrowia lipolytica (Candida lipolytica)
          Length = 361

 Score = 34.7 bits (76), Expect = 3.7
 Identities = 18/37 (48%), Positives = 22/37 (59%)
 Frame = +2

Query: 614 ETPSDSLDSNAEALQASATEDILTTLPTEPVVQTPPL 724
           E P    DSN+     S TE+I+T  P  PV+QTPPL
Sbjct: 259 EPPLSRTDSNS-----SITEEIMTVSPVSPVLQTPPL 290


>UniRef50_A7F232 Cluster: Putative uncharacterized protein; n=1;
            Sclerotinia sclerotiorum 1980|Rep: Putative
            uncharacterized protein - Sclerotinia sclerotiorum 1980
          Length = 2060

 Score = 34.7 bits (76), Expect = 3.7
 Identities = 26/105 (24%), Positives = 52/105 (49%), Gaps = 7/105 (6%)
 Frame = +2

Query: 593  HSSYLSAETPSDSLDSNAEAL-QASATEDILTTLPTEPVVQTPPLQEPAINETTRRTPKD 769
            HS+Y+  ++ +  L   ++ L +A+A +D+ T    E +++   L E   NET     + 
Sbjct: 749  HSNYILLQSENSELQKRSQILSEAAAKQDLKTQQVAEDLIEAKGLVESMRNETANLKAEK 808

Query: 770  DLSNDIETLLVE----IRDVQTRLTDL--PDESLEATEEVSRRES 886
             L  DI+  L +    + + ++RL  L    ++L+   E+S  E+
Sbjct: 809  KLWKDIQDRLSQDNENLTNERSRLNTLIANQQTLQNERELSESET 853


>UniRef50_A6SGG5 Cluster: Putative uncharacterized protein; n=1;
            Botryotinia fuckeliana B05.10|Rep: Putative
            uncharacterized protein - Botryotinia fuckeliana B05.10
          Length = 2041

 Score = 34.7 bits (76), Expect = 3.7
 Identities = 27/105 (25%), Positives = 51/105 (48%), Gaps = 7/105 (6%)
 Frame = +2

Query: 593  HSSYLSAETPSDSLDSNAEAL-QASATEDILTTLPTEPVVQTPPLQEPAINETTRRTPKD 769
            HS+Y   +T +  L   ++ L +A+A +D+ T    E +++   L E   NET     + 
Sbjct: 749  HSNYTLLQTENSELQKRSQILSEAAAKQDLRTQQVAEDLIEARGLVESMRNETANLKAEK 808

Query: 770  DLSNDIETLLVE----IRDVQTRLTDL--PDESLEATEEVSRRES 886
             L  DI+  L +    + + ++RL  L    ++L+   E+S  E+
Sbjct: 809  KLWKDIQDRLSQDNENLANERSRLNTLIANQQTLQNERELSESET 853


>UniRef50_O60841 Cluster: Eukaryotic translation initiation factor
           5B; n=67; Eumetazoa|Rep: Eukaryotic translation
           initiation factor 5B - Homo sapiens (Human)
          Length = 1220

 Score = 34.7 bits (76), Expect = 3.7
 Identities = 23/77 (29%), Positives = 34/77 (44%), Gaps = 3/77 (3%)
 Frame = +2

Query: 710 QTPPLQEPAINETTRRTPKDD---LSNDIETLLVEIRDVQTRLTDLPDESLEATEEVSRR 880
           +TPP  EP   E T     DD   +++D ET  VE   V   + + P+E  E  EE    
Sbjct: 485 ETPPPVEPEEEEDTEDAGLDDWEAMASDEETEKVEGNTVHIEVKENPEEEEEEEEEEEED 544

Query: 881 ESNFNQVRRSSRAVGAE 931
           E +  +      + G+E
Sbjct: 545 EESEEEEEEEGESEGSE 561


>UniRef50_UPI000023E603 Cluster: hypothetical protein FG00263.1;
           n=1; Gibberella zeae PH-1|Rep: hypothetical protein
           FG00263.1 - Gibberella zeae PH-1
          Length = 845

 Score = 34.3 bits (75), Expect = 4.9
 Identities = 23/78 (29%), Positives = 39/78 (50%)
 Frame = +2

Query: 653 LQASATEDILTTLPTEPVVQTPPLQEPAINETTRRTPKDDLSNDIETLLVEIRDVQTRLT 832
           LQ SA E+  +  P +P V+   +  PA+ E T+    D +++ ++ L  E  D++    
Sbjct: 629 LQESAGEEAKSPTPPQPEVKEESIP-PAVEEVTKGESPDVMASLMDKLDQEHADIEAIKE 687

Query: 833 DLPDESLEATEEVSRRES 886
           DLP   + A  E S  E+
Sbjct: 688 DLPTPPVPAPVEESVPEA 705


>UniRef50_Q82NY6 Cluster: Putative uncharacterized protein; n=1;
           Streptomyces avermitilis|Rep: Putative uncharacterized
           protein - Streptomyces avermitilis
          Length = 476

 Score = 34.3 bits (75), Expect = 4.9
 Identities = 27/114 (23%), Positives = 42/114 (36%), Gaps = 3/114 (2%)
 Frame = +2

Query: 563 LPGGICSWKDHSSYLSAETPSDS---LDSNAEALQASATEDILTTLPTEPVVQTPPLQEP 733
           LP    S K HS    +  PS S   + S+  + + S+ E       TEP    PP  EP
Sbjct: 352 LPPDSSSPKPHSPSSKSPEPSSSSPSVPSSPNSSRESSPESYSEPPTTEPKTTEPPTTEP 411

Query: 734 AINETTRRTPKDDLSNDIETLLVEIRDVQTRLTDLPDESLEATEEVSRRESNFN 895
              E     P+       E    E    +   T+ P   + + E  S  ++ ++
Sbjct: 412 KTTEPPTTEPESTERKTTEPPTTEPPTTEPTTTEPPSPGVVSPETTSESDTTYS 465


>UniRef50_Q2UB42 Cluster: Predicted protein; n=1; Aspergillus
            oryzae|Rep: Predicted protein - Aspergillus oryzae
          Length = 1429

 Score = 34.3 bits (75), Expect = 4.9
 Identities = 20/87 (22%), Positives = 33/87 (37%)
 Frame = +2

Query: 695  TEPVVQTPPLQEPAINETTRRTPKDDLSNDIETLLVEIRDVQTRLTDLPDESLEATEEVS 874
            TEPVV+ P  ++P   ETT   P  DL+ +       + +V         E+ E   + S
Sbjct: 829  TEPVVEEPTSEKPVAEETTAEEPAKDLTKEEPATQEPVSEVPATEDSTTKEATEEPTKAS 888

Query: 875  RRESNFNQVRRSSRAVGAEDHGVPPEV 955
              E    +     +     +H +   V
Sbjct: 889  GPEVAAEEPTTDEKPADVTEHEIKEPV 915


>UniRef50_UPI0000E482AB Cluster: PREDICTED: similar to blastula
           protease-10; n=1; Strongylocentrotus purpuratus|Rep:
           PREDICTED: similar to blastula protease-10 -
           Strongylocentrotus purpuratus
          Length = 999

 Score = 33.9 bits (74), Expect = 6.4
 Identities = 22/74 (29%), Positives = 34/74 (45%), Gaps = 5/74 (6%)
 Frame = +2

Query: 662 SATEDILTTLPT-EPVVQTPPLQEPAINETTRRTP----KDDLSNDIETLLVEIRDVQTR 826
           + TE  +TT PT +PV+ T P  EPA+   T   P    K      + T       V ++
Sbjct: 775 ATTEPTVTTKPTTDPVITTTPTTEPAVTTKTTTAPPVTTKSTTEPPVTTKTTTEPAVTSK 834

Query: 827 LTDLPDESLEATEE 868
            T +P ++ + T E
Sbjct: 835 TTTVPADTSKPTTE 848


>UniRef50_UPI0000D9B1CD Cluster: PREDICTED: hypothetical protein;
           n=1; Macaca mulatta|Rep: PREDICTED: hypothetical protein
           - Macaca mulatta
          Length = 198

 Score = 33.9 bits (74), Expect = 6.4
 Identities = 22/75 (29%), Positives = 41/75 (54%), Gaps = 3/75 (4%)
 Frame = +2

Query: 728 EPAINETTRRTPKDDLSNDIETLLVEIRDV-QTRL--TDLPDESLEATEEVSRRESNFNQ 898
           EP +NET  R  ++  + ++  L +EI  + QT +  T++ D  + AT E S ++    Q
Sbjct: 28  EPQLNETLARLKEEHATLELGRLGIEIHALKQTHVPGTEIEDTGMTATREHS-KDCGSLQ 86

Query: 899 VRRSSRAVGAEDHGV 943
           +R++      +DHG+
Sbjct: 87  LRQAQSQGSRDDHGL 101


>UniRef50_A1U9X9 Cluster: Putative uncharacterized protein
           precursor; n=3; Mycobacterium|Rep: Putative
           uncharacterized protein precursor - Mycobacterium sp.
           (strain KMS)
          Length = 701

 Score = 33.9 bits (74), Expect = 6.4
 Identities = 21/83 (25%), Positives = 39/83 (46%)
 Frame = +2

Query: 635 DSNAEALQASATEDILTTLPTEPVVQTPPLQEPAINETTRRTPKDDLSNDIETLLVEIRD 814
           + + EAL+    +D    +  EPVV+ P ++EP + E       +    D+   +V+   
Sbjct: 72  EPDPEALEGLPDDDGDEPVVEEPVVEEPVVEEPVVVEDDAEKDAEGADPDVTLPIVDPTT 131

Query: 815 VQTRLTDLPDESLEATEEVSRRE 883
            +    + PD +L+ TE+ S  E
Sbjct: 132 FERESRNRPDSTLQ-TEKSSEPE 153


>UniRef50_Q400L2 Cluster: MYC2; n=2; lamiids|Rep: MYC2 -
           Catharanthus roseus (Rosy periwinkle) (Madagascar
           periwinkle)
          Length = 699

 Score = 33.9 bits (74), Expect = 6.4
 Identities = 14/42 (33%), Positives = 26/42 (61%)
 Frame = +2

Query: 749 TRRTPKDDLSNDIETLLVEIRDVQTRLTDLPDESLEATEEVS 874
           T  T KD+L N +++L  E+   ++RL   PD+ L+++ + S
Sbjct: 567 TTETDKDELKNQLDSLKKELASKESRLLSSPDQDLKSSNKQS 608


>UniRef50_A3LQA1 Cluster: Hypopthetical protein; n=1; Pichia
           stipitis|Rep: Hypopthetical protein - Pichia stipitis
           (Yeast)
          Length = 686

 Score = 33.9 bits (74), Expect = 6.4
 Identities = 23/101 (22%), Positives = 46/101 (45%), Gaps = 2/101 (1%)
 Frame = +2

Query: 602 YLSAETPSDSLDSNAEALQASATEDILT--TLPTEPVVQTPPLQEPAINETTRRTPKDDL 775
           + S+ETPSDS+ S   + ++S++E+  +  T  +E      P    + +ET+        
Sbjct: 142 FSSSETPSDSISSTETSSESSSSEETSSTETSSSETSSSIEPSSSSSSSETSSSESSSSE 201

Query: 776 SNDIETLLVEIRDVQTRLTDLPDESLEATEEVSRRESNFNQ 898
            +  E+   E+   ++  ++       +TE  S  ES+  Q
Sbjct: 202 VSSTESSSSEVSSTESSSSETSSTESSSTEISSSSESSSTQ 242


>UniRef50_Q9YDX9 Cluster: Putative uncharacterized protein; n=1;
           Aeropyrum pernix|Rep: Putative uncharacterized protein -
           Aeropyrum pernix
          Length = 297

 Score = 33.9 bits (74), Expect = 6.4
 Identities = 23/79 (29%), Positives = 40/79 (50%), Gaps = 3/79 (3%)
 Frame = +2

Query: 656 QASATEDILTTLPTEPVVQTPPLQEPAINETTRRTPKDDLSNDIETLLVEIRDVQTRLTD 835
           QA + ++ L TL ++       +++ +     R T  D+LS +I+ L  + R+V TRL D
Sbjct: 194 QAGSVKEELATLSSKIEEYNERIKKLSEEIEKRSTRIDELSKEIDNLYAKYREVMTRLKD 253

Query: 836 L---PDESLEATEEVSRRE 883
           +       +E +E   RRE
Sbjct: 254 IRIAMARGMELSEVEKRRE 272


>UniRef50_UPI0000E105C7 Cluster: hypothetical protein OM2255_14915;
           n=1; alpha proteobacterium HTCC2255|Rep: hypothetical
           protein OM2255_14915 - alpha proteobacterium HTCC2255
          Length = 73

 Score = 33.5 bits (73), Expect = 8.5
 Identities = 15/34 (44%), Positives = 19/34 (55%)
 Frame = +2

Query: 689 LPTEPVVQTPPLQEPAINETTRRTPKDDLSNDIE 790
           LP EP VQ  P  +PA   T   TP ++ +N IE
Sbjct: 37  LPAEPPVQNQPQTQPAAQPTEPETPSNNTNNAIE 70


>UniRef50_UPI000066088A Cluster: Homolog of Homo sapiens
            "Apolipoprotein B-100 precursor; n=1; Takifugu
            rubripes|Rep: Homolog of Homo sapiens "Apolipoprotein
            B-100 precursor - Takifugu rubripes
          Length = 2980

 Score = 33.5 bits (73), Expect = 8.5
 Identities = 32/95 (33%), Positives = 42/95 (44%), Gaps = 6/95 (6%)
 Frame = +2

Query: 590  DHSSYLSAETPSDSLDSNAEALQASATEDILTTLPTEPVVQTPPL---QEPAI---NETT 751
            D  S L  +    SL+SNA    A  TE+ +  +    VV  P     QE +I   N T 
Sbjct: 1038 DKGSMLQLQMDLPSLESNASFTAALRTEEDV-HMDVNAVVNLPETRYQQEASISYDNNTF 1096

Query: 752  RRTPKDDLSNDIETLLVEIRDVQTRLTDLPDESLE 856
                K DLS+ I  LL  + D + RL  L D  L+
Sbjct: 1097 EVRLKSDLSSRIRKLLPNVEDHRRRLQHLMDLVLD 1131


>UniRef50_Q2S242 Cluster: Ftsk/spoiiie family protein; n=2;
           Bacteroidetes/Chlorobi group|Rep: Ftsk/spoiiie family
           protein - Salinibacter ruber (strain DSM 13855)
          Length = 887

 Score = 33.5 bits (73), Expect = 8.5
 Identities = 22/100 (22%), Positives = 41/100 (41%), Gaps = 1/100 (1%)
 Frame = +2

Query: 617 TPSDSLDSNAEALQASATEDILTT-LPTEPVVQTPPLQEPAINETTRRTPKDDLSNDIET 793
           +P  + DS+A    A   ED     +P E    TP  + PA +      P D+ ++  E 
Sbjct: 283 SPEPAPDSSARTSDADPPEDDAPKDIPDETTASTPAEESPATDSPPPSRPADENASSDEP 342

Query: 794 LLVEIRDVQTRLTDLPDESLEATEEVSRRESNFNQVRRSS 913
                 +     +D PD+ +  T +    E   +++ R++
Sbjct: 343 AAPAPDEPPPDASDGPDDDVSMTIQEQVEEETTDEIERTA 382


>UniRef50_A3W0R3 Cluster: Uncharacterized conserved protein; n=1;
           Roseovarius sp. 217|Rep: Uncharacterized conserved
           protein - Roseovarius sp. 217
          Length = 1236

 Score = 33.5 bits (73), Expect = 8.5
 Identities = 17/59 (28%), Positives = 27/59 (45%)
 Frame = +2

Query: 638 SNAEALQASATEDILTTLPTEPVVQTPPLQEPAINETTRRTPKDDLSNDIETLLVEIRD 814
           S A A QA A +DIL  L    + +       A+    R TP+ ++  D + +L  + D
Sbjct: 374 SVASAAQADAIDDILDALELPEIAEVSTASSDAVLSGIRATPETEVQEDTKDILAGLHD 432


>UniRef50_Q8I2J8 Cluster: Putative uncharacterized protein PFI1540w;
           n=2; Plasmodium|Rep: Putative uncharacterized protein
           PFI1540w - Plasmodium falciparum (isolate 3D7)
          Length = 703

 Score = 33.5 bits (73), Expect = 8.5
 Identities = 27/108 (25%), Positives = 47/108 (43%), Gaps = 2/108 (1%)
 Frame = +2

Query: 20  KIETSGIIENVEREETIEPELSDTLSDAVPINVVDPITNNHINLKPDNFWINKYATDDAE 199
           K ETS  ++NV ++  I+ E+     + +  + +  + +N+ N+K D   +  Y  D  +
Sbjct: 209 KNETSKDVDNVLKKSKIQTEIKTYNQEEINKSNIQILDDNNNNMKED--VMENYKKDGRK 266

Query: 200 XXXXXXXXXXESTPPIVKQNQPKEKPIDLNLKTDVKVDI--ENIRNDN 337
                      +     K  + K  PI LNL   +KV I  +N  N N
Sbjct: 267 NKFFIYHQGSINMSSFFKTKEYKNTPISLNLPDKLKVVIYTDNYVNKN 314


>UniRef50_Q55FJ7 Cluster: Putative uncharacterized protein; n=1;
           Dictyostelium discoideum AX4|Rep: Putative
           uncharacterized protein - Dictyostelium discoideum AX4
          Length = 376

 Score = 33.5 bits (73), Expect = 8.5
 Identities = 23/78 (29%), Positives = 39/78 (50%)
 Frame = +2

Query: 614 ETPSDSLDSNAEALQASATEDILTTLPTEPVVQTPPLQEPAINETTRRTPKDDLSNDIET 793
           ++P     S++E + +S++E +LT  PT+P  Q PP Q P   +   +TP +     I+T
Sbjct: 269 QSPIPISASSSEEVDSSSSE-VLTFPPTQPPTQ-PPTQPP--TQPPTQTPTETPETPIDT 324

Query: 794 LLVEIRDVQTRLTDLPDE 847
                 DV   + D  D+
Sbjct: 325 TTGNSNDVPNPIRDGDDD 342


>UniRef50_A2ERL6 Cluster: Viral A-type inclusion protein, putative;
            n=1; Trichomonas vaginalis G3|Rep: Viral A-type inclusion
            protein, putative - Trichomonas vaginalis G3
          Length = 2832

 Score = 33.5 bits (73), Expect = 8.5
 Identities = 21/83 (25%), Positives = 41/83 (49%), Gaps = 2/83 (2%)
 Frame = +2

Query: 740  NETTRRTPKDDLSNDIETLLVEIRDVQTRLTDLPDESLEATEEVSRRESNFNQVRRSSRA 919
            NE  +R  ++++ ND++     I+D++    DL  E LE   E  +  SN+ ++ + +  
Sbjct: 1013 NELLQRK-QNEMENDLDEKSSRIKDLEDENDDLQKEILELQNENRKISSNYEKISKENNR 1071

Query: 920  VGAEDHGVPPEVE--VQTLIKNS 982
            +  E   +  E E   Q L+ N+
Sbjct: 1072 IEMEMKQIKDENESNKQKLVDNT 1094


>UniRef50_A2DLG0 Cluster: Viral A-type inclusion protein, putative;
           n=1; Trichomonas vaginalis G3|Rep: Viral A-type
           inclusion protein, putative - Trichomonas vaginalis G3
          Length = 3369

 Score = 33.5 bits (73), Expect = 8.5
 Identities = 26/103 (25%), Positives = 43/103 (41%)
 Frame = +2

Query: 593 HSSYLSAETPSDSLDSNAEALQASATEDILTTLPTEPVVQTPPLQEPAINETTRRTPKDD 772
           H    S ET    L  N    + S TE        E + +     E  I+E   +    D
Sbjct: 69  HQQLQSKETEISKLTENVSEREKSFTE------LQEQLEKAKQEHEETISEIKLKLESKD 122

Query: 773 LSNDIETLLVEIRDVQTRLTDLPDESLEATEEVSRRESNFNQV 901
             N+I  L   +  +++ L     ++ E TE +S++ESN N++
Sbjct: 123 --NEINELNSTLSQIRSELEQTNKQNTELTETLSQKESNINEI 163


>UniRef50_A6QXZ5 Cluster: Predicted protein; n=1; Ajellomyces
           capsulatus NAm1|Rep: Predicted protein - Ajellomyces
           capsulatus NAm1
          Length = 875

 Score = 33.5 bits (73), Expect = 8.5
 Identities = 29/78 (37%), Positives = 39/78 (50%), Gaps = 7/78 (8%)
 Frame = +2

Query: 662 SATEDILTTLPTEPVVQTPPLQEPAINETTR----RTP--KDDLSNDIETL-LVEIRDVQ 820
           S+ ED      TEP  QTP  QEP I E       R+P  +++LSN  ET   VE +D +
Sbjct: 247 SSLEDGHEHSQTEPEAQTPRFQEPEIQEPESEGRYRSPSGQENLSNTTETYHFVEAQDYE 306

Query: 821 TRLTDLPDESLEATEEVS 874
            + ++   ES E  E  S
Sbjct: 307 AQ-SEAQSESREFQERRS 323


>UniRef50_A5AB01 Cluster: Function: GAPCenA is a GTPase activating
           protein for Rab6; n=8; Eurotiomycetidae|Rep: Function:
           GAPCenA is a GTPase activating protein for Rab6 -
           Aspergillus niger
          Length = 902

 Score = 33.5 bits (73), Expect = 8.5
 Identities = 26/91 (28%), Positives = 40/91 (43%)
 Frame = +2

Query: 596 SSYLSAETPSDSLDSNAEALQASATEDILTTLPTEPVVQTPPLQEPAINETTRRTPKDDL 775
           +S LS+   S S  S    L +  +    +T PTE    +  +Q+P       +    DL
Sbjct: 532 ASNLSSIRRSTSKQSMTSTLNSVESASDASTAPTE---LSTDVQKPRAKSAISQHKDRDL 588

Query: 776 SNDIETLLVEIRDVQTRLTDLPDESLEATEE 868
              IE LL+ + D+Q +  DL  E  +  EE
Sbjct: 589 HTQIEDLLMALSDLQRQHADLTRELQQEREE 619


>UniRef50_A1C839 Cluster: PT repeat family protein; n=1; Aspergillus
            clavatus|Rep: PT repeat family protein - Aspergillus
            clavatus
          Length = 1885

 Score = 33.5 bits (73), Expect = 8.5
 Identities = 19/64 (29%), Positives = 31/64 (48%)
 Frame = +2

Query: 572  GICSWKDHSSYLSAETPSDSLDSNAEALQASATEDILTTLPTEPVVQTPPLQEPAINETT 751
            G    +   + +  ETP +S+    E +   A +  L T  TE V +TP + EP +N+ T
Sbjct: 1225 GTTKEQPEETLVEQETPKESI---VEEVVVEAPK--LDTTATEAVAETPAVDEPVVNDET 1279

Query: 752  RRTP 763
             + P
Sbjct: 1280 EKEP 1283


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 844,809,061
Number of Sequences: 1657284
Number of extensions: 15939250
Number of successful extensions: 63163
Number of sequences better than 10.0: 48
Number of HSP's better than 10.0 without gapping: 58299
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 62946
length of database: 575,637,011
effective HSP length: 101
effective length of database: 408,251,327
effective search space used: 92264799902
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).