SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= cesb0015
         (721 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_UPI000051A31E Cluster: PREDICTED: similar to CG5830-PA;...   204   2e-51
UniRef50_O15194 Cluster: CTD small phosphatase-like protein; n=8...   198   1e-49
UniRef50_UPI0000F2E098 Cluster: PREDICTED: similar to CTD (carbo...   194   2e-48
UniRef50_Q7YU53 Cluster: RE52350p; n=3; Sophophora|Rep: RE52350p...   194   2e-48
UniRef50_Q8T3G2 Cluster: Putative uncharacterized protein scpl-1...   173   4e-42
UniRef50_UPI000065F6C4 Cluster: Carboxy-terminal domain RNA poly...   158   1e-37
UniRef50_Q4P2E3 Cluster: Putative uncharacterized protein; n=1; ...   150   4e-35
UniRef50_Q9XYL0 Cluster: Development protein DG1148; n=2; Dictyo...   147   2e-34
UniRef50_Q0U5Q7 Cluster: Putative uncharacterized protein; n=2; ...   141   1e-32
UniRef50_Q6C9F0 Cluster: Yarrowia lipolytica chromosome D of str...   140   4e-32
UniRef50_Q75FA0 Cluster: AAL158Wp; n=1; Eremothecium gossypii|Re...   138   1e-31
UniRef50_A2Q8B1 Cluster: Contig An01c0120, complete genome; n=7;...   138   1e-31
UniRef50_A4QR92 Cluster: Putative uncharacterized protein; n=2; ...   138   1e-31
UniRef50_A7EKQ6 Cluster: Putative uncharacterized protein; n=1; ...   138   2e-31
UniRef50_A6SI90 Cluster: Plasma membrane phosphatase required fo...   138   2e-31
UniRef50_Q6FVU1 Cluster: Candida glabrata strain CBS138 chromoso...   135   9e-31
UniRef50_Q09695 Cluster: Uncharacterized protein C2F7.02c; n=1; ...   135   9e-31
UniRef50_Q5KB63 Cluster: Protein phosphatase, putative; n=1; Fil...   134   2e-30
UniRef50_Q00XL8 Cluster: Protein phosphatase, putative; n=1; Ost...   132   8e-30
UniRef50_Q5S7T6 Cluster: Nuclear LIM factor interactor-interacti...   131   1e-29
UniRef50_A7TFL4 Cluster: Putative uncharacterized protein; n=1; ...   131   2e-29
UniRef50_Q07949 Cluster: Probable phosphatase PSR2; n=2; Sacchar...   131   2e-29
UniRef50_A3LNJ1 Cluster: Predicted protein; n=3; Saccharomycetac...   129   6e-29
UniRef50_Q07800 Cluster: Phosphatase PSR1; n=4; Saccharomycetale...   128   2e-28
UniRef50_A5DY31 Cluster: Putative uncharacterized protein; n=2; ...   126   4e-28
UniRef50_A3FQA3 Cluster: Putative uncharacterized protein; n=2; ...   118   2e-25
UniRef50_Q54M72 Cluster: Putative uncharacterized protein; n=2; ...   114   2e-24
UniRef50_A7TPN5 Cluster: Putative uncharacterized protein; n=1; ...   113   4e-24
UniRef50_A7QP65 Cluster: Chromosome chr1 scaffold_136, whole gen...   108   1e-22
UniRef50_Q4N0T1 Cluster: Nuclear LIM interactor-interacting fact...   108   1e-22
UniRef50_Q2HD78 Cluster: Putative uncharacterized protein; n=1; ...   108   1e-22
UniRef50_Q7QXW9 Cluster: GLP_479_51161_49863; n=1; Giardia lambl...   107   4e-22
UniRef50_UPI00006CC009 Cluster: NLI interacting factor-like phos...   105   8e-22
UniRef50_UPI00006CDD92 Cluster: NLI interacting factor-like phos...   104   3e-21
UniRef50_Q86S75 Cluster: Putative uncharacterized protein; n=3; ...   100   3e-20
UniRef50_A0CSK3 Cluster: Chromosome undetermined scaffold_26, wh...   100   3e-20
UniRef50_A2G9Z3 Cluster: NLI interacting factor-like phosphatase...    99   1e-19
UniRef50_A2ARL6 Cluster: CTD (Carboxy-terminal domain RNA polyme...    99   1e-19
UniRef50_Q8IYI9 Cluster: CTDSPL2 protein (CTD (Carboxy-terminal ...    99   1e-19
UniRef50_Q0JKL9 Cluster: Os01g0665300 protein; n=4; BEP clade|Re...    97   3e-19
UniRef50_Q54GB2 Cluster: Putative uncharacterized protein; n=1; ...    97   4e-19
UniRef50_A7RK91 Cluster: Predicted protein; n=2; Eumetazoa|Rep: ...    96   7e-19
UniRef50_Q9FXF4 Cluster: F1N18.17 protein; n=3; Arabidopsis thal...    96   9e-19
UniRef50_A2FGV6 Cluster: NLI interacting factor-like phosphatase...    96   9e-19
UniRef50_A7QQJ7 Cluster: Chromosome undetermined scaffold_143, w...    95   2e-18
UniRef50_A0DAA6 Cluster: Chromosome undetermined scaffold_43, wh...    95   2e-18
UniRef50_A7QNU7 Cluster: Chromosome undetermined scaffold_134, w...    95   2e-18
UniRef50_Q5S7T3 Cluster: Putative nuclear LIM interactor-interac...    94   3e-18
UniRef50_A2G0V4 Cluster: NLI interacting factor-like phosphatase...    94   4e-18
UniRef50_A6R5B2 Cluster: Carboxy-terminal domain RNA polymerase ...    94   4e-18
UniRef50_UPI0000E479C0 Cluster: PREDICTED: similar to CTD (carbo...    93   8e-18
UniRef50_A0BL21 Cluster: Chromosome undetermined scaffold_113, w...    92   1e-17
UniRef50_UPI0000D5691E Cluster: PREDICTED: similar to CTD (carbo...    91   2e-17
UniRef50_Q00VM1 Cluster: TFIIF-interacting CTD phosphatase, incl...    91   3e-17
UniRef50_Q8VY28 Cluster: Putative uncharacterized protein At5g46...    90   4e-17
UniRef50_UPI0000DB7CDC Cluster: PREDICTED: similar to CTD (carbo...    90   6e-17
UniRef50_UPI00015B4F0F Cluster: PREDICTED: similar to conserved ...    89   1e-16
UniRef50_Q9FK73 Cluster: Arabidopsis thaliana genomic DNA, chrom...    89   1e-16
UniRef50_Q0P4B2 Cluster: Zgc:153196; n=2; Danio rerio|Rep: Zgc:1...    89   1e-16
UniRef50_A0DJT1 Cluster: Chromosome undetermined scaffold_53, wh...    87   3e-16
UniRef50_Q4Q9N6 Cluster: Putative uncharacterized protein; n=3; ...    85   1e-15
UniRef50_UPI000155399B Cluster: PREDICTED: hypothetical protein;...    85   2e-15
UniRef50_Q4Q9H6 Cluster: Nuclear lim interactor-interacting fact...    85   2e-15
UniRef50_A2DY53 Cluster: Putative uncharacterized protein; n=1; ...    84   3e-15
UniRef50_A0E2M8 Cluster: Chromosome undetermined scaffold_75, wh...    84   3e-15
UniRef50_A0DPK8 Cluster: Chromosome undetermined scaffold_59, wh...    84   3e-15
UniRef50_UPI0000549063 Cluster: PREDICTED: hypothetical protein;...    82   1e-14
UniRef50_A2DNP9 Cluster: NLI interacting factor-like phosphatase...    82   1e-14
UniRef50_Q871J4 Cluster: Related to nuclear envelope protein NEM...    81   2e-14
UniRef50_Q4DGU0 Cluster: Putative uncharacterized protein; n=1; ...    81   4e-14
UniRef50_Q0JL24 Cluster: Os01g0629400 protein; n=4; Oryza sativa...    79   1e-13
UniRef50_A0E487 Cluster: Chromosome undetermined scaffold_78, wh...    79   1e-13
UniRef50_A0C0L1 Cluster: Chromosome undetermined scaffold_14, wh...    78   3e-13
UniRef50_Q6FN41 Cluster: Similar to sp|P38757 Saccharomyces cere...    77   3e-13
UniRef50_Q4P7E4 Cluster: Putative uncharacterized protein; n=1; ...    77   4e-13
UniRef50_O95476 Cluster: Serine/threonine-protein phosphatase du...    77   4e-13
UniRef50_A7TS54 Cluster: Putative uncharacterized protein; n=1; ...    77   6e-13
UniRef50_Q57ZA0 Cluster: Putative uncharacterized protein; n=1; ...    76   1e-12
UniRef50_Q750M6 Cluster: AGL070Wp; n=1; Eremothecium gossypii|Re...    75   1e-12
UniRef50_A1CQG6 Cluster: NIF domain protein; n=9; Eurotiomycetid...    75   1e-12
UniRef50_A7AN33 Cluster: Dullard-like phosphatase domain contain...    75   2e-12
UniRef50_UPI000023CDF5 Cluster: hypothetical protein FG10302.1; ...    75   2e-12
UniRef50_Q5KIG7 Cluster: Nuclear envelope-endoplasmic reticulum ...    75   2e-12
UniRef50_A2FKQ9 Cluster: NLI interacting factor-like phosphatase...    74   3e-12
UniRef50_UPI00006CA416 Cluster: NLI interacting factor-like phos...    74   4e-12
UniRef50_A0DXS4 Cluster: Chromosome undetermined scaffold_69, wh...    73   5e-12
UniRef50_A0CQU0 Cluster: Chromosome undetermined scaffold_24, wh...    73   5e-12
UniRef50_O59718 Cluster: NLI interacting factor family; n=1; Sch...    73   9e-12
UniRef50_Q0UTG3 Cluster: Putative uncharacterized protein; n=1; ...    72   1e-11
UniRef50_A2E6G6 Cluster: NLI interacting factor-like phosphatase...    71   2e-11
UniRef50_Q8SUC7 Cluster: Putative uncharacterized protein ECU10_...    71   2e-11
UniRef50_P38757 Cluster: Nuclear envelope morphology protein 1; ...    71   2e-11
UniRef50_A2FJD8 Cluster: NLI interacting factor-like phosphatase...    70   5e-11
UniRef50_Q6CD87 Cluster: Yarrowia lipolytica chromosome C of str...    70   5e-11
UniRef50_UPI00006CCC91 Cluster: NLI interacting factor-like phos...    69   1e-10
UniRef50_A0DXE4 Cluster: Chromosome undetermined scaffold_68, wh...    68   2e-10
UniRef50_Q23QU2 Cluster: NLI interacting factor-like phosphatase...    68   3e-10
UniRef50_A0BQ25 Cluster: Chromosome undetermined scaffold_12, wh...    67   5e-10
UniRef50_Q241B6 Cluster: NLI interacting factor-like phosphatase...    66   1e-09
UniRef50_A2FHG5 Cluster: NLI interacting factor-like phosphatase...    65   1e-09
UniRef50_A0E0T6 Cluster: Chromosome undetermined scaffold_72, wh...    65   1e-09
UniRef50_Q8I3U9 Cluster: Nif-like protein, putative; n=6; Plasmo...    64   3e-09
UniRef50_UPI0000F2111E Cluster: PREDICTED: hypothetical protein;...    63   6e-09
UniRef50_A0BXV8 Cluster: Chromosome undetermined scaffold_135, w...    63   6e-09
UniRef50_Q7QQZ2 Cluster: GLP_442_14601_13606; n=1; Giardia lambl...    62   1e-08
UniRef50_A6SCV2 Cluster: Putative uncharacterized protein; n=2; ...    62   1e-08
UniRef50_Q9VZS0 Cluster: CG12078-PA; n=1; Drosophila melanogaste...    62   2e-08
UniRef50_A0E7V4 Cluster: Chromosome undetermined scaffold_81, wh...    62   2e-08
UniRef50_A2EX88 Cluster: NLI interacting factor-like phosphatase...    61   2e-08
UniRef50_A2FWF7 Cluster: NLI interacting factor-like phosphatase...    61   3e-08
UniRef50_Q5AMI9 Cluster: Putative uncharacterized protein NEM1; ...    61   3e-08
UniRef50_A0CPA8 Cluster: Chromosome undetermined scaffold_23, wh...    60   4e-08
UniRef50_A0BT20 Cluster: Chromosome undetermined scaffold_126, w...    60   4e-08
UniRef50_Q5S7T2 Cluster: Putative nuclear LIM interactor-interac...    60   5e-08
UniRef50_Q01C48 Cluster: TFIIF-interacting CTD phosphatase, incl...    60   7e-08
UniRef50_Q7JY68 Cluster: AT02326p; n=2; Sophophora|Rep: AT02326p...    60   7e-08
UniRef50_A0DHN8 Cluster: Chromosome undetermined scaffold_50, wh...    60   7e-08
UniRef50_A0DBP6 Cluster: Chromosome undetermined scaffold_44, wh...    59   9e-08
UniRef50_A0D7B8 Cluster: Chromosome undetermined scaffold_4, who...    59   9e-08
UniRef50_Q3LDS8 Cluster: Hypothetical 50.6 kDa protein in RPL14B...    59   1e-07
UniRef50_Q6CMP7 Cluster: Kluyveromyces lactis strain NRRL Y-1140...    59   1e-07
UniRef50_A0DJD2 Cluster: Chromosome undetermined scaffold_53, wh...    58   2e-07
UniRef50_UPI00004985D1 Cluster: nuclear LIM interactor-interacti...    58   3e-07
UniRef50_UPI00006CB6E4 Cluster: NLI interacting factor-like phos...    57   4e-07
UniRef50_Q23DG5 Cluster: NLI interacting factor-like phosphatase...    57   4e-07
UniRef50_A5E3L7 Cluster: Putative uncharacterized protein; n=1; ...    57   4e-07
UniRef50_A7ATL2 Cluster: NLI interacting factor-like phosphatase...    57   5e-07
UniRef50_A2DRH4 Cluster: NLI interacting factor-like phosphatase...    56   7e-07
UniRef50_Q22U86 Cluster: NLI interacting factor-like phosphatase...    56   9e-07
UniRef50_Q22RH8 Cluster: NLI interacting factor-like phosphatase...    56   9e-07
UniRef50_A0EHC1 Cluster: Chromosome undetermined scaffold_97, wh...    56   9e-07
UniRef50_Q22YQ1 Cluster: NLI interacting factor-like phosphatase...    55   2e-06
UniRef50_A3GGD6 Cluster: Nuclear Envelope Morphology; n=3; Sacch...    55   2e-06
UniRef50_Q7RSX6 Cluster: NLI interacting factor, putative; n=2; ...    55   2e-06
UniRef50_A0DDM7 Cluster: Chromosome undetermined scaffold_47, wh...    55   2e-06
UniRef50_A0BWL2 Cluster: Chromosome undetermined scaffold_132, w...    55   2e-06
UniRef50_Q5CP88 Cluster: ENSANGP00000011443; n=2; Cryptosporidiu...    54   3e-06
UniRef50_Q22R94 Cluster: NLI interacting factor-like phosphatase...    54   4e-06
UniRef50_Q23JH8 Cluster: NLI interacting factor-like phosphatase...    54   5e-06
UniRef50_A0DAV8 Cluster: Chromosome undetermined scaffold_43, wh...    54   5e-06
UniRef50_A0DXP2 Cluster: Chromosome undetermined scaffold_69, wh...    53   6e-06
UniRef50_A0CAF1 Cluster: Chromosome undetermined scaffold_161, w...    53   6e-06
UniRef50_A0BIM9 Cluster: Chromosome undetermined scaffold_11, wh...    53   6e-06
UniRef50_Q4WI16 Cluster: Import inner membrane translocase subun...    53   6e-06
UniRef50_A0DNV3 Cluster: Chromosome undetermined scaffold_58, wh...    53   8e-06
UniRef50_A0DB36 Cluster: Chromosome undetermined scaffold_44, wh...    52   1e-05
UniRef50_Q9W0S3 Cluster: Import inner membrane translocase subun...    52   1e-05
UniRef50_Q23DN3 Cluster: NLI interacting factor-like phosphatase...    52   1e-05
UniRef50_Q22GY6 Cluster: NLI interacting factor-like phosphatase...    52   1e-05
UniRef50_A4VD36 Cluster: Putative uncharacterized protein; n=1; ...    52   1e-05
UniRef50_A0DTY0 Cluster: Chromosome undetermined scaffold_63, wh...    52   1e-05
UniRef50_Q0V6C1 Cluster: Putative uncharacterized protein; n=1; ...    52   2e-05
UniRef50_UPI0000E496F3 Cluster: PREDICTED: similar to Translocas...    51   2e-05
UniRef50_A7QHR1 Cluster: Chromosome chr8 scaffold_99, whole geno...    51   2e-05
UniRef50_A7Q3I0 Cluster: Chromosome chr13 scaffold_48, whole gen...    51   2e-05
UniRef50_Q22N55 Cluster: NLI interacting factor-like phosphatase...    51   2e-05
UniRef50_A1ZCM3 Cluster: Development protein; n=1; Microscilla m...    51   3e-05
UniRef50_Q9N6I5 Cluster: Putative uncharacterized protein; n=3; ...    51   3e-05
UniRef50_A0CYD9 Cluster: Chromosome undetermined scaffold_31, wh...    51   3e-05
UniRef50_Q9W4V8 Cluster: Import inner membrane translocase subun...    51   3e-05
UniRef50_A0CN10 Cluster: Chromosome undetermined scaffold_22, wh...    50   4e-05
UniRef50_UPI00006CB5CE Cluster: NLI interacting factor-like phos...    50   6e-05
UniRef50_A7Q966 Cluster: Chromosome chr19 scaffold_66, whole gen...    50   6e-05
UniRef50_A0D6Q6 Cluster: Chromosome undetermined scaffold_4, who...    50   6e-05
UniRef50_A7TQU6 Cluster: Putative uncharacterized protein; n=1; ...    50   6e-05
UniRef50_A0EHH2 Cluster: Chromosome undetermined scaffold_97, wh...    50   8e-05
UniRef50_Q7R5U8 Cluster: GLP_81_145711_146535; n=1; Giardia lamb...    49   1e-04
UniRef50_A0DRY1 Cluster: Chromosome undetermined scaffold_61, wh...    49   1e-04
UniRef50_Q4DR97 Cluster: Putative uncharacterized protein; n=3; ...    49   1e-04
UniRef50_Q23KI9 Cluster: NLI interacting factor-like phosphatase...    49   1e-04
UniRef50_A0DYN1 Cluster: Chromosome undetermined scaffold_7, who...    49   1e-04
UniRef50_Q02776 Cluster: Import inner membrane translocase subun...    49   1e-04
UniRef50_Q3ZCQ8 Cluster: Import inner membrane translocase subun...    48   3e-04
UniRef50_UPI00003C0364 Cluster: PREDICTED: similar to CG2713-PA;...    47   4e-04
UniRef50_A5B8A7 Cluster: Putative uncharacterized protein; n=1; ...    47   4e-04
UniRef50_Q95QG8 Cluster: Putative uncharacterized protein fcp-1;...    47   4e-04
UniRef50_Q8MQY2 Cluster: SD01014p; n=4; Diptera|Rep: SD01014p - ...    47   5e-04
UniRef50_Q4Q5S6 Cluster: Putative uncharacterized protein; n=3; ...    46   7e-04
UniRef50_A0CYV8 Cluster: Chromosome undetermined scaffold_31, wh...    46   7e-04
UniRef50_Q0F1Q7 Cluster: Putative uncharacterized protein; n=1; ...    46   0.001
UniRef50_Q4Q377 Cluster: NLI-interacting factor, putative; n=7; ...    46   0.001
UniRef50_A0BX31 Cluster: Chromosome undetermined scaffold_133, w...    46   0.001
UniRef50_Q4PEW9 Cluster: Import inner membrane translocase subun...    45   0.002
UniRef50_Q874C1 Cluster: Import inner membrane translocase subun...    45   0.002
UniRef50_Q98SN2 Cluster: CTD phosphatase; n=10; Tetrapoda|Rep: C...    45   0.002
UniRef50_Q4FWB8 Cluster: Putative uncharacterized protein; n=3; ...    45   0.002
UniRef50_Q16EJ3 Cluster: RNA polymerase ii ctd phosphatase; n=1;...    45   0.002
UniRef50_Q5KNV7 Cluster: Import inner membrane translocase subun...    45   0.002
UniRef50_UPI00006CA83D Cluster: NLI interacting factor-like phos...    44   0.003
UniRef50_Q0BYG6 Cluster: Phosphoprotein phosphatase; n=1; Hyphom...    44   0.003
UniRef50_A5BUL8 Cluster: Putative uncharacterized protein; n=1; ...    44   0.003
UniRef50_A0E8L2 Cluster: Chromosome undetermined scaffold_83, wh...    44   0.003
UniRef50_UPI0000498B9D Cluster: phosphatase; n=1; Entamoeba hist...    44   0.004
UniRef50_A2DKK7 Cluster: NLI interacting factor-like phosphatase...    44   0.004
UniRef50_Q8SV03 Cluster: RNA polymerase II subunit A C-terminal ...    44   0.004
UniRef50_UPI00006CAF35 Cluster: NLI interacting factor-like phos...    44   0.005
UniRef50_UPI00006CAA86 Cluster: NLI interacting factor-like phos...    44   0.005
UniRef50_UPI00015B45FB Cluster: PREDICTED: similar to conserved ...    43   0.007
UniRef50_A0BT40 Cluster: Chromosome undetermined scaffold_126, w...    43   0.007
UniRef50_Q9Y5B0 Cluster: RNA polymerase II subunit A C-terminal ...    43   0.007
UniRef50_A0EDA0 Cluster: Chromosome undetermined scaffold_9, who...    43   0.009
UniRef50_A0DXE0 Cluster: Chromosome undetermined scaffold_68, wh...    42   0.012
UniRef50_A0DQH2 Cluster: Chromosome undetermined scaffold_6, who...    42   0.012
UniRef50_Q5BZ31 Cluster: SJCHGC03357 protein; n=1; Schistosoma j...    42   0.015
UniRef50_A7AM05 Cluster: Protein phosphatase family protein; n=1...    42   0.015
UniRef50_Q7QZ65 Cluster: GLP_22_23484_22576; n=1; Giardia lambli...    42   0.020
UniRef50_Q4E2U9 Cluster: Putative uncharacterized protein; n=2; ...    41   0.035
UniRef50_A0DR00 Cluster: Chromosome undetermined scaffold_6, who...    41   0.035
UniRef50_O13636 Cluster: Import inner membrane translocase subun...    41   0.035
UniRef50_UPI0000519ABE Cluster: PREDICTED: similar to CG12252-PA...    40   0.047
UniRef50_UPI0000E494F0 Cluster: PREDICTED: similar to CG5830-PA,...    40   0.062
UniRef50_Q388H5 Cluster: Putative uncharacterized protein; n=1; ...    40   0.062
UniRef50_A7AQ81 Cluster: Putative uncharacterized protein; n=1; ...    40   0.062
UniRef50_Q6BVY9 Cluster: Import inner membrane translocase subun...    40   0.062
UniRef50_UPI0000E48F15 Cluster: PREDICTED: similar to SD01014p; ...    40   0.082
UniRef50_Q5S7T7 Cluster: Import inner membrane translocase subun...    40   0.082
UniRef50_A0DPW6 Cluster: Chromosome undetermined scaffold_6, who...    39   0.11 
UniRef50_Q8IBI8 Cluster: Putative uncharacterized protein PF07_0...    38   0.19 
UniRef50_Q4UIJ8 Cluster: Putative uncharacterized protein; n=2; ...    38   0.19 
UniRef50_A0DYU6 Cluster: Chromosome undetermined scaffold_7, who...    38   0.19 
UniRef50_Q22647 Cluster: Import inner membrane translocase subun...    38   0.19 
UniRef50_UPI0000D56AA7 Cluster: PREDICTED: similar to CG12252-PA...    38   0.25 
UniRef50_Q8NJS0 Cluster: RNA polymerase II C-terminal domain pho...    38   0.25 
UniRef50_UPI00006D007D Cluster: NLI interacting factor-like phos...    37   0.44 
UniRef50_Q7RIY6 Cluster: NLI interacting factor, putative; n=4; ...    37   0.44 
UniRef50_Q55AP7 Cluster: Putative uncharacterized protein; n=2; ...    37   0.44 
UniRef50_A0CD30 Cluster: Chromosome undetermined scaffold_169, w...    37   0.44 
UniRef50_Q3TF86 Cluster: 17 days embryo kidney cDNA, RIKEN full-...    37   0.58 
UniRef50_Q55FU7 Cluster: Putative uncharacterized protein; n=1; ...    37   0.58 
UniRef50_A5K9Z0 Cluster: Putative uncharacterized protein; n=4; ...    36   0.76 
UniRef50_Q2H1T0 Cluster: Predicted protein; n=1; Chaetomium glob...    36   0.76 
UniRef50_UPI000023E490 Cluster: hypothetical protein FG06023.1; ...    36   1.0  
UniRef50_Q01AF0 Cluster: Chromosome 04 contig 1, DNA sequence; n...    36   1.0  
UniRef50_Q4E136 Cluster: Nuclear lim interactor-interacting fact...    36   1.0  
UniRef50_Q9P376 Cluster: RNA polymerase II subunit A C-terminal ...    36   1.0  
UniRef50_UPI0000D56B64 Cluster: PREDICTED: similar to CG2713-PA;...    36   1.3  
UniRef50_UPI00006CC9FF Cluster: NLI interacting factor-like phos...    36   1.3  
UniRef50_Q6CDV7 Cluster: Import inner membrane translocase subun...    36   1.3  
UniRef50_UPI00006CCA92 Cluster: hypothetical protein TTHERM_0028...    35   2.3  
UniRef50_Q4SUU0 Cluster: Chromosome undetermined SCAF13842, whol...    34   3.1  
UniRef50_Q6C770 Cluster: Yarrowia lipolytica chromosome E of str...    34   3.1  
UniRef50_UPI00006CB701 Cluster: NLI interacting factor-like phos...    34   4.1  
UniRef50_Q1FIZ6 Cluster: Phosphoesterase, RecJ-like:Phosphoester...    34   4.1  
UniRef50_Q54IJ8 Cluster: Putative uncharacterized protein; n=1; ...    34   4.1  
UniRef50_Q01916 Cluster: IpiB3 protein precursor; n=3; Phytophth...    33   5.4  
UniRef50_A5AFP2 Cluster: Putative uncharacterized protein; n=1; ...    33   5.4  
UniRef50_Q4D0U8 Cluster: Putative uncharacterized protein; n=2; ...    33   5.4  
UniRef50_Q22WR0 Cluster: NLI interacting factor-like phosphatase...    33   5.4  
UniRef50_UPI000150A05F Cluster: NLI interacting factor-like phos...    33   7.1  
UniRef50_UPI0000E7FEB9 Cluster: PREDICTED: hypothetical protein;...    33   7.1  
UniRef50_UPI0000F30461 Cluster: Formin-2.; n=2; Bos taurus|Rep: ...    33   7.1  
UniRef50_Q01C98 Cluster: CTD phosphatase-like protein 3; n=2; Os...    33   7.1  
UniRef50_A0CWX9 Cluster: Chromosome undetermined scaffold_3, who...    33   7.1  
UniRef50_Q5KKC4 Cluster: Expressed protein; n=2; Filobasidiella ...    33   7.1  
UniRef50_A5DG25 Cluster: Putative uncharacterized protein; n=1; ...    33   7.1  
UniRef50_Q4T331 Cluster: Chromosome undetermined SCAF10126, whol...    33   9.4  
UniRef50_Q56269 Cluster: Serine-rich protein; n=1; Acidithiobaci...    33   9.4  
UniRef50_Q1ASU9 Cluster: GAF sensor signal transduction histidin...    33   9.4  
UniRef50_Q1G0S6 Cluster: Hemocyte-specific integrin alpha subuni...    33   9.4  

>UniRef50_UPI000051A31E Cluster: PREDICTED: similar to CG5830-PA;
           n=3; Coelomata|Rep: PREDICTED: similar to CG5830-PA -
           Apis mellifera
          Length = 293

 Score =  204 bits (498), Expect = 2e-51
 Identities = 95/106 (89%), Positives = 99/106 (93%)
 Frame = +2

Query: 404 KSVMVIDLDETLVHSSFKPINNAHFVVPVEIDGAVHQVYVLKRPHVDEFLRRCGELY*CV 583
           K  MVIDLDETLVHSSFKPINNA FVVPVEIDG VHQVYVLKRP+VDEFL+R GELY CV
Sbjct: 101 KKCMVIDLDETLVHSSFKPINNADFVVPVEIDGTVHQVYVLKRPYVDEFLQRMGELYECV 160

Query: 584 LFTASLAKYADPVADLLDRWGVFRARLFRDSCVFHRGNYVKDLNSL 721
           LFTASLAKYADPVADLLDRWGVFRARLFR+SCV+HRGNYVKDLN L
Sbjct: 161 LFTASLAKYADPVADLLDRWGVFRARLFRESCVYHRGNYVKDLNKL 206



 Score = 83.0 bits (196), Expect = 7e-15
 Identities = 58/116 (50%), Positives = 65/116 (56%), Gaps = 2/116 (1%)
 Frame = +1

Query: 70  MDASSIITQVSRDDEQLNNYGPDRGSSPGVQHNEGDGTPVSGSTPLGGKKSSGTGGFLRS 249
           MDASSIITQVSRDDE L  +   +   P  Q NE     V+ ++P  GKK  G G  LRS
Sbjct: 1   MDASSIITQVSRDDE-LGQFNNGKAQLP--QENE-----VANNSPASGKKPRGRG-LLRS 51

Query: 250 LLCCWXXXXXXXXXXXXXTNSI--DGRASPPLLVMSEHAPRPLLPPVRHQDMHKKC 411
           LLCC              T+S+  DG  SP L   S   PR LLPPVRHQDMHKKC
Sbjct: 52  LLCC-LGRGRGSSSKSSKTSSLQGDGHGSPSLRTGS---PRFLLPPVRHQDMHKKC 103


>UniRef50_O15194 Cluster: CTD small phosphatase-like protein; n=84;
           Coelomata|Rep: CTD small phosphatase-like protein - Homo
           sapiens (Human)
          Length = 276

 Score =  198 bits (483), Expect = 1e-49
 Identities = 90/106 (84%), Positives = 99/106 (93%)
 Frame = +2

Query: 404 KSVMVIDLDETLVHSSFKPINNAHFVVPVEIDGAVHQVYVLKRPHVDEFLRRCGELY*CV 583
           K  +VIDLDETLVHSSFKPI+NA F+VPVEIDG +HQVYVLKRPHVDEFL+R G+L+ CV
Sbjct: 106 KKCVVIDLDETLVHSSFKPISNADFIVPVEIDGTIHQVYVLKRPHVDEFLQRMGQLFECV 165

Query: 584 LFTASLAKYADPVADLLDRWGVFRARLFRDSCVFHRGNYVKDLNSL 721
           LFTASLAKYADPVADLLDRWGVFRARLFR+SCVFHRGNYVKDL+ L
Sbjct: 166 LFTASLAKYADPVADLLDRWGVFRARLFRESCVFHRGNYVKDLSRL 211


>UniRef50_UPI0000F2E098 Cluster: PREDICTED: similar to CTD
           (carboxy-terminal domain, RNA polymerase II, polypeptide
           A) small phosphatase 1,; n=1; Monodelphis domestica|Rep:
           PREDICTED: similar to CTD (carboxy-terminal domain, RNA
           polymerase II, polypeptide A) small phosphatase 1, -
           Monodelphis domestica
          Length = 346

 Score =  194 bits (473), Expect = 2e-48
 Identities = 88/106 (83%), Positives = 98/106 (92%)
 Frame = +2

Query: 404 KSVMVIDLDETLVHSSFKPINNAHFVVPVEIDGAVHQVYVLKRPHVDEFLRRCGELY*CV 583
           K  +VIDLDETLVHSSFKP++NA F++PVEIDG VHQVYVLKRPHVDEFL+R GEL+ CV
Sbjct: 175 KICVVIDLDETLVHSSFKPVSNADFIIPVEIDGMVHQVYVLKRPHVDEFLQRMGELFECV 234

Query: 584 LFTASLAKYADPVADLLDRWGVFRARLFRDSCVFHRGNYVKDLNSL 721
           LFTASLAKYADPVADLLD+WG FRARLFR+SCVFHRGNYVKDL+ L
Sbjct: 235 LFTASLAKYADPVADLLDKWGSFRARLFRESCVFHRGNYVKDLSRL 280


>UniRef50_Q7YU53 Cluster: RE52350p; n=3; Sophophora|Rep: RE52350p -
           Drosophila melanogaster (Fruit fly)
          Length = 329

 Score =  194 bits (472), Expect = 2e-48
 Identities = 88/106 (83%), Positives = 97/106 (91%)
 Frame = +2

Query: 404 KSVMVIDLDETLVHSSFKPINNAHFVVPVEIDGAVHQVYVLKRPHVDEFLRRCGELY*CV 583
           +  MVIDLDETLVHSSFKPI NA F+VPVEIDG VHQVYVLKRPHVDEFL++ GELY CV
Sbjct: 89  RKCMVIDLDETLVHSSFKPIPNADFIVPVEIDGTVHQVYVLKRPHVDEFLQKMGELYECV 148

Query: 584 LFTASLAKYADPVADLLDRWGVFRARLFRDSCVFHRGNYVKDLNSL 721
           LFTASLAKYADPVADLLD+W VFRARLFR+SCV++RGNY+KDLN L
Sbjct: 149 LFTASLAKYADPVADLLDKWNVFRARLFRESCVYYRGNYIKDLNRL 194



 Score = 54.4 bits (125), Expect = 3e-06
 Identities = 46/114 (40%), Positives = 54/114 (47%)
 Frame = +1

Query: 70  MDASSIITQVSRDDEQLNNYGPDRGSSPGVQHNEGDGTPVSGSTPLGGKKSSGTGGFLRS 249
           MDA+SIITQV RDDEQLN Y       P   +++ D   V    P   K+     G   S
Sbjct: 1   MDATSIITQVFRDDEQLNVY-------PSYPNDKDD---VDRLKPQ--KR-----GLFHS 43

Query: 250 LLCCWXXXXXXXXXXXXXTNSIDGRASPPLLVMSEHAPRPLLPPVRHQDMHKKC 411
           LLCCW                IDG  +PP L   +   R LLP VR  DMH+KC
Sbjct: 44  LLCCWRRNRTKTNQNG---TQIDGSTTPPPLPDQQ---RYLLPQVRLTDMHRKC 91


>UniRef50_Q8T3G2 Cluster: Putative uncharacterized protein scpl-1;
           n=4; Caenorhabditis|Rep: Putative uncharacterized
           protein scpl-1 - Caenorhabditis elegans
          Length = 491

 Score =  173 bits (421), Expect = 4e-42
 Identities = 79/106 (74%), Positives = 91/106 (85%)
 Frame = +2

Query: 404 KSVMVIDLDETLVHSSFKPINNAHFVVPVEIDGAVHQVYVLKRPHVDEFLRRCGELY*CV 583
           K  +VIDLDETLVHSSFKP+ N  FV+PVEIDG  HQVYVLKRP+VDEFL + GE + C+
Sbjct: 311 KKCLVIDLDETLVHSSFKPVKNPDFVIPVEIDGVEHQVYVLKRPYVDEFLAKVGEHFECI 370

Query: 584 LFTASLAKYADPVADLLDRWGVFRARLFRDSCVFHRGNYVKDLNSL 721
           LFTASLAKYADPVADLLD+  VFR RLFR++CVFH+GNYVKDL+ L
Sbjct: 371 LFTASLAKYADPVADLLDKKRVFRGRLFREACVFHKGNYVKDLSRL 416


>UniRef50_UPI000065F6C4 Cluster: Carboxy-terminal domain RNA
           polymerase II polypeptide A small phosphatase 1 (EC
           3.1.3.16) (Nuclear LIM interactor-interacting factor 3)
           (NLI-interacting factor 3) (NLI-IF).; n=1; Takifugu
           rubripes|Rep: Carboxy-terminal domain RNA polymerase II
           polypeptide A small phosphatase 1 (EC 3.1.3.16) (Nuclear
           LIM interactor-interacting factor 3) (NLI-interacting
           factor 3) (NLI-IF). - Takifugu rubripes
          Length = 209

 Score =  158 bits (383), Expect = 1e-37
 Identities = 80/131 (61%), Positives = 95/131 (72%), Gaps = 25/131 (19%)
 Frame = +2

Query: 404 KSVMVIDLDETLVHSSFKPINNAHFVVPVEIDGAVHQVYVLKRPHVDEFLRRCGELY*CV 583
           K  +VIDLDETLVHSSF P+++A F++PVEI+G VHQVYVLKRPHVDEFL+R GEL+ CV
Sbjct: 16  KICVVIDLDETLVHSSFTPVSDADFIIPVEIEGTVHQVYVLKRPHVDEFLKRMGELFECV 75

Query: 584 LFTASLAK-------------------------YADPVADLLDRWGVFRARLFRDSCVFH 688
           LFTASL+K                         YADPV+D+LD WG FR RLFR+SCVFH
Sbjct: 76  LFTASLSKVRLPNYQISTSGLNCLLFVLLLLLQYADPVSDMLDTWGAFRNRLFRESCVFH 135

Query: 689 RGNYVKDLNSL 721
           +GNYVKDL+ L
Sbjct: 136 KGNYVKDLSRL 146


>UniRef50_Q4P2E3 Cluster: Putative uncharacterized protein; n=1;
           Ustilago maydis|Rep: Putative uncharacterized protein -
           Ustilago maydis (Smut fungus)
          Length = 631

 Score =  150 bits (363), Expect = 4e-35
 Identities = 70/106 (66%), Positives = 84/106 (79%)
 Frame = +2

Query: 404 KSVMVIDLDETLVHSSFKPINNAHFVVPVEIDGAVHQVYVLKRPHVDEFLRRCGELY*CV 583
           +  +V+DLDETLVHSSFK I NA F+VPVEIDG VH VYV+KRP VDEF+R+ G +Y  V
Sbjct: 463 RKCLVLDLDETLVHSSFKMIQNADFIVPVEIDGTVHNVYVIKRPGVDEFMRQMGLIYEVV 522

Query: 584 LFTASLAKYADPVADLLDRWGVFRARLFRDSCVFHRGNYVKDLNSL 721
           +FTASL+KYADPV D+LD     R RLFR+SC  H+GNYVKDL+ L
Sbjct: 523 VFTASLSKYADPVLDMLDIHHAVRHRLFRESCYNHKGNYVKDLSQL 568


>UniRef50_Q9XYL0 Cluster: Development protein DG1148; n=2;
           Dictyostelium discoideum|Rep: Development protein DG1148
           - Dictyostelium discoideum (Slime mold)
          Length = 306

 Score =  147 bits (357), Expect = 2e-34
 Identities = 68/103 (66%), Positives = 82/103 (79%)
 Frame = +2

Query: 413 MVIDLDETLVHSSFKPINNAHFVVPVEIDGAVHQVYVLKRPHVDEFLRRCGELY*CVLFT 592
           +V+DLDETLVHSSFKP++N  F+VPVEI+G +HQVYV+KRP VD+FLR   E +  V+FT
Sbjct: 139 LVLDLDETLVHSSFKPVHNPDFIVPVEIEGTIHQVYVVKRPFVDDFLRAIAEKFEIVVFT 198

Query: 593 ASLAKYADPVADLLDRWGVFRARLFRDSCVFHRGNYVKDLNSL 721
           ASLAKYADPV D LD   V   RLFR+SC  H+GNYVKDL+ L
Sbjct: 199 ASLAKYADPVLDFLDTGRVIHYRLFRESCHNHKGNYVKDLSRL 241


>UniRef50_Q0U5Q7 Cluster: Putative uncharacterized protein; n=2;
           Pezizomycotina|Rep: Putative uncharacterized protein -
           Phaeosphaeria nodorum (Septoria nodorum)
          Length = 541

 Score =  141 bits (342), Expect = 1e-32
 Identities = 64/106 (60%), Positives = 82/106 (77%)
 Frame = +2

Query: 404 KSVMVIDLDETLVHSSFKPINNAHFVVPVEIDGAVHQVYVLKRPHVDEFLRRCGELY*CV 583
           K  +V+DLDETLVHSSFK ++ A F +PVEI+G  H VYV+KRP VD+F++R GELY  V
Sbjct: 371 KKCLVLDLDETLVHSSFKILHQADFTIPVEIEGQYHNVYVIKRPGVDQFMKRVGELYEVV 430

Query: 584 LFTASLAKYADPVADLLDRWGVFRARLFRDSCVFHRGNYVKDLNSL 721
           +FTAS++KY DP+ D LD  GV   RLFR+SC  H+GNYVKDL+ +
Sbjct: 431 VFTASVSKYGDPLLDQLDIHGVVHHRLFRESCYNHQGNYVKDLSQI 476


>UniRef50_Q6C9F0 Cluster: Yarrowia lipolytica chromosome D of strain
           CLIB122 of Yarrowia lipolytica; n=1; Yarrowia
           lipolytica|Rep: Yarrowia lipolytica chromosome D of
           strain CLIB122 of Yarrowia lipolytica - Yarrowia
           lipolytica (Candida lipolytica)
          Length = 528

 Score =  140 bits (338), Expect = 4e-32
 Identities = 64/106 (60%), Positives = 82/106 (77%)
 Frame = +2

Query: 404 KSVMVIDLDETLVHSSFKPINNAHFVVPVEIDGAVHQVYVLKRPHVDEFLRRCGELY*CV 583
           +  +V+DLDETLVHSSFK I+ A FV+PVEI+G  H VYV+KRP VDEF++R GELY  V
Sbjct: 358 RKCLVLDLDETLVHSSFKYIHQADFVIPVEIEGQYHNVYVIKRPGVDEFMKRVGELYEVV 417

Query: 584 LFTASLAKYADPVADLLDRWGVFRARLFRDSCVFHRGNYVKDLNSL 721
           +FTAS++KY DP+ D LD   V   RLFR+SC  H+GNY+K+L+ L
Sbjct: 418 VFTASVSKYGDPLLDQLDIHNVVHHRLFRESCYNHQGNYIKNLSQL 463


>UniRef50_Q75FA0 Cluster: AAL158Wp; n=1; Eremothecium gossypii|Rep:
           AAL158Wp - Ashbya gossypii (Yeast) (Eremothecium
           gossypii)
          Length = 478

 Score =  138 bits (335), Expect = 1e-31
 Identities = 61/106 (57%), Positives = 83/106 (78%)
 Frame = +2

Query: 404 KSVMVIDLDETLVHSSFKPINNAHFVVPVEIDGAVHQVYVLKRPHVDEFLRRCGELY*CV 583
           +  +V+DLDETLVHSSFK ++ A FV+PVEID  VH VYV+KRP VDEFL+R GEL+  V
Sbjct: 308 RKCLVLDLDETLVHSSFKYLHTADFVIPVEIDNQVHNVYVIKRPGVDEFLKRVGELFEVV 367

Query: 584 LFTASLAKYADPVADLLDRWGVFRARLFRDSCVFHRGNYVKDLNSL 721
           +FTAS+++Y DP+ D+LD++     RLFRDSC  + GNY+K+L+ +
Sbjct: 368 VFTASVSRYGDPLLDILDQYKAVHHRLFRDSCYNYEGNYIKNLSQI 413


>UniRef50_A2Q8B1 Cluster: Contig An01c0120, complete genome; n=7;
           Eurotiomycetidae|Rep: Contig An01c0120, complete genome
           - Aspergillus niger
          Length = 585

 Score =  138 bits (335), Expect = 1e-31
 Identities = 62/106 (58%), Positives = 80/106 (75%)
 Frame = +2

Query: 404 KSVMVIDLDETLVHSSFKPINNAHFVVPVEIDGAVHQVYVLKRPHVDEFLRRCGELY*CV 583
           +  +V+DLDETLVHSSFK +  A F +PVEI+G  H +YV+KRP VD+F++R GELY  V
Sbjct: 415 RKCLVLDLDETLVHSSFKVLERADFTIPVEIEGQYHNIYVIKRPGVDQFMKRVGELYEVV 474

Query: 584 LFTASLAKYADPVADLLDRWGVFRARLFRDSCVFHRGNYVKDLNSL 721
           +FTAS++KY DP+ D LD   V   RLFRDSC  H+GNYVKDL+ +
Sbjct: 475 VFTASVSKYGDPLLDQLDIHNVVHHRLFRDSCYNHQGNYVKDLSQV 520


>UniRef50_A4QR92 Cluster: Putative uncharacterized protein; n=2;
           Sordariomycetes|Rep: Putative uncharacterized protein -
           Magnaporthe grisea (Rice blast fungus) (Pyricularia
           grisea)
          Length = 505

 Score =  138 bits (334), Expect = 1e-31
 Identities = 63/106 (59%), Positives = 81/106 (76%)
 Frame = +2

Query: 404 KSVMVIDLDETLVHSSFKPINNAHFVVPVEIDGAVHQVYVLKRPHVDEFLRRCGELY*CV 583
           K  +V+DLDETLVHSSFK ++ A F +PVEI+G  H VYV+KRP VD+F++R GELY  V
Sbjct: 335 KKCLVLDLDETLVHSSFKILHQADFTIPVEIEGNYHNVYVIKRPGVDQFMKRVGELYEVV 394

Query: 584 LFTASLAKYADPVADLLDRWGVFRARLFRDSCVFHRGNYVKDLNSL 721
           +FTAS++KY DP+ D LD   V   RLFR+SC  H+GNYVKDL+ +
Sbjct: 395 VFTASVSKYGDPLLDQLDIHNVVHHRLFRESCYNHQGNYVKDLSQV 440


>UniRef50_A7EKQ6 Cluster: Putative uncharacterized protein; n=1;
           Sclerotinia sclerotiorum 1980|Rep: Putative
           uncharacterized protein - Sclerotinia sclerotiorum 1980
          Length = 584

 Score =  138 bits (333), Expect = 2e-31
 Identities = 63/106 (59%), Positives = 81/106 (76%)
 Frame = +2

Query: 404 KSVMVIDLDETLVHSSFKPINNAHFVVPVEIDGAVHQVYVLKRPHVDEFLRRCGELY*CV 583
           K  +V+DLDETLVHSSFK ++ A F +PVEI+G  H VYV+KRP VD+F++R GELY  V
Sbjct: 414 KKCLVLDLDETLVHSSFKILHQADFTIPVEIEGQFHNVYVIKRPGVDQFMKRVGELYEVV 473

Query: 584 LFTASLAKYADPVADLLDRWGVFRARLFRDSCVFHRGNYVKDLNSL 721
           +FTAS++KY DP+ D LD   V   RLFR+SC  H+GNYVKDL+ +
Sbjct: 474 VFTASVSKYGDPLLDQLDIHHVVHHRLFRESCYNHQGNYVKDLSQV 519


>UniRef50_A6SI90 Cluster: Plasma membrane phosphatase required for
           sodium stress response; n=1; Botryotinia fuckeliana
           B05.10|Rep: Plasma membrane phosphatase required for
           sodium stress response - Botryotinia fuckeliana B05.10
          Length = 580

 Score =  138 bits (333), Expect = 2e-31
 Identities = 63/106 (59%), Positives = 81/106 (76%)
 Frame = +2

Query: 404 KSVMVIDLDETLVHSSFKPINNAHFVVPVEIDGAVHQVYVLKRPHVDEFLRRCGELY*CV 583
           K  +V+DLDETLVHSSFK ++ A F +PVEI+G  H VYV+KRP VD+F++R GELY  V
Sbjct: 410 KKCLVLDLDETLVHSSFKILHQADFTIPVEIEGQFHNVYVIKRPGVDQFMKRVGELYEVV 469

Query: 584 LFTASLAKYADPVADLLDRWGVFRARLFRDSCVFHRGNYVKDLNSL 721
           +FTAS++KY DP+ D LD   V   RLFR+SC  H+GNYVKDL+ +
Sbjct: 470 VFTASVSKYGDPLLDQLDIHHVVHHRLFRESCYNHQGNYVKDLSQV 515


>UniRef50_Q6FVU1 Cluster: Candida glabrata strain CBS138 chromosome
           D complete sequence; n=1; Candida glabrata|Rep: Candida
           glabrata strain CBS138 chromosome D complete sequence -
           Candida glabrata (Yeast) (Torulopsis glabrata)
          Length = 447

 Score =  135 bits (327), Expect = 9e-31
 Identities = 60/106 (56%), Positives = 82/106 (77%)
 Frame = +2

Query: 404 KSVMVIDLDETLVHSSFKPINNAHFVVPVEIDGAVHQVYVLKRPHVDEFLRRCGELY*CV 583
           K  +V+DLDETLVHSSFK ++ A FV+PV+ID  +H VYV+KRP VDEFL+R GELY  V
Sbjct: 277 KKCLVLDLDETLVHSSFKYLHTADFVLPVDIDDQIHNVYVIKRPGVDEFLQRVGELYEVV 336

Query: 584 LFTASLAKYADPVADLLDRWGVFRARLFRDSCVFHRGNYVKDLNSL 721
           +FTAS+++Y DP+ D+LD+      RLFRD+C  + GNY+K+L+ +
Sbjct: 337 VFTASVSRYGDPLLDVLDKSNNIHHRLFRDACYTYEGNYIKNLSQI 382


>UniRef50_Q09695 Cluster: Uncharacterized protein C2F7.02c; n=1;
           Schizosaccharomyces pombe|Rep: Uncharacterized protein
           C2F7.02c - Schizosaccharomyces pombe (Fission yeast)
          Length = 325

 Score =  135 bits (327), Expect = 9e-31
 Identities = 64/106 (60%), Positives = 81/106 (76%)
 Frame = +2

Query: 404 KSVMVIDLDETLVHSSFKPINNAHFVVPVEIDGAVHQVYVLKRPHVDEFLRRCGELY*CV 583
           K  +++DLDETLVHSSFK I  A FVV +EIDG  H V V+KRP VDEFL++ G+++  V
Sbjct: 157 KKCLILDLDETLVHSSFKYIEPADFVVSIEIDGLQHDVRVVKRPGVDEFLKKMGDMFEIV 216

Query: 584 LFTASLAKYADPVADLLDRWGVFRARLFRDSCVFHRGNYVKDLNSL 721
           +FTASLAKYADPV D+LD   V R RLFR++C  + GN+VKDL+ L
Sbjct: 217 VFTASLAKYADPVLDMLDHSHVIRHRLFREACCNYEGNFVKDLSQL 262


>UniRef50_Q5KB63 Cluster: Protein phosphatase, putative; n=1;
           Filobasidiella neoformans|Rep: Protein phosphatase,
           putative - Cryptococcus neoformans (Filobasidiella
           neoformans)
          Length = 613

 Score =  134 bits (324), Expect = 2e-30
 Identities = 62/106 (58%), Positives = 79/106 (74%)
 Frame = +2

Query: 404 KSVMVIDLDETLVHSSFKPINNAHFVVPVEIDGAVHQVYVLKRPHVDEFLRRCGELY*CV 583
           +  +V+DLDETL+HSSFK +  A ++VPVEI+  VH VYV+KRP VD FL    ++Y  V
Sbjct: 445 RKCLVLDLDETLLHSSFKQLPTADYIVPVEIESQVHNVYVIKRPGVDHFLTEMAKIYEIV 504

Query: 584 LFTASLAKYADPVADLLDRWGVFRARLFRDSCVFHRGNYVKDLNSL 721
           +FTASL+KYADPV D+LD   V   RLFR+SC  H+GNYVKDL+ L
Sbjct: 505 VFTASLSKYADPVLDMLDENRVVAHRLFRESCYNHKGNYVKDLSQL 550


>UniRef50_Q00XL8 Cluster: Protein phosphatase, putative; n=1;
           Ostreococcus tauri|Rep: Protein phosphatase, putative -
           Ostreococcus tauri
          Length = 324

 Score =  132 bits (319), Expect = 8e-30
 Identities = 64/106 (60%), Positives = 79/106 (74%)
 Frame = +2

Query: 404 KSVMVIDLDETLVHSSFKPINNAHFVVPVEIDGAVHQVYVLKRPHVDEFLRRCGELY*CV 583
           K  +V+DLDETLVHSSFKP+ N++F+VPVEIDG++  VYV+KRP VD FLR   + +  V
Sbjct: 128 KPCLVLDLDETLVHSSFKPVPNSNFIVPVEIDGSMTDVYVIKRPWVDHFLREVAKDWEIV 187

Query: 584 LFTASLAKYADPVADLLDRWGVFRARLFRDSCVFHRGNYVKDLNSL 721
           +FTAS+ KYA+PV DLLD   V R RLFR  C   +GNYVKDL  L
Sbjct: 188 VFTASVPKYANPVLDLLDTTKVVRWRLFRKHCYAFQGNYVKDLTCL 233


>UniRef50_Q5S7T6 Cluster: Nuclear LIM factor interactor-interacting
           protein; n=7; Phytophthora|Rep: Nuclear LIM factor
           interactor-interacting protein - Phytophthora sojae
          Length = 336

 Score =  131 bits (317), Expect = 1e-29
 Identities = 61/106 (57%), Positives = 77/106 (72%)
 Frame = +2

Query: 404 KSVMVIDLDETLVHSSFKPINNAHFVVPVEIDGAVHQVYVLKRPHVDEFLRRCGELY*CV 583
           K  +V+DLDETLVHSSF+P  N  FV+PVEIDG +H V+V KRP  +EFL    + Y  V
Sbjct: 165 KMCLVLDLDETLVHSSFRPTPNPDFVIPVEIDGTIHHVFVAKRPGAEEFLVEMAKYYEIV 224

Query: 584 LFTASLAKYADPVADLLDRWGVFRARLFRDSCVFHRGNYVKDLNSL 721
           ++TASL+KYADP+ D LD  GV + RL+R  CV + GNYVKDL+ L
Sbjct: 225 IYTASLSKYADPLLDQLDPEGVIKYRLYRQHCVQYEGNYVKDLSLL 270


>UniRef50_A7TFL4 Cluster: Putative uncharacterized protein; n=1;
           Vanderwaltozyma polyspora DSM 70294|Rep: Putative
           uncharacterized protein - Vanderwaltozyma polyspora DSM
           70294
          Length = 477

 Score =  131 bits (316), Expect = 2e-29
 Identities = 60/106 (56%), Positives = 80/106 (75%)
 Frame = +2

Query: 404 KSVMVIDLDETLVHSSFKPINNAHFVVPVEIDGAVHQVYVLKRPHVDEFLRRCGELY*CV 583
           K  +V+DLDETLVHSSFK I+ A FV+PV ID   HQVYV+KRP VDEFL+R G+++  V
Sbjct: 307 KKCLVLDLDETLVHSSFKYIDTADFVLPVTIDDQTHQVYVIKRPGVDEFLKRVGKIFEVV 366

Query: 584 LFTASLAKYADPVADLLDRWGVFRARLFRDSCVFHRGNYVKDLNSL 721
           +FTAS+++Y DP+ D+LD       RLFR+SC  + GNYVK+L+ +
Sbjct: 367 VFTASVSRYGDPLLDILDSSKSIHHRLFRESCYIYDGNYVKNLSQI 412


>UniRef50_Q07949 Cluster: Probable phosphatase PSR2; n=2;
           Saccharomyces cerevisiae|Rep: Probable phosphatase PSR2
           - Saccharomyces cerevisiae (Baker's yeast)
          Length = 397

 Score =  131 bits (316), Expect = 2e-29
 Identities = 59/106 (55%), Positives = 81/106 (76%)
 Frame = +2

Query: 404 KSVMVIDLDETLVHSSFKPINNAHFVVPVEIDGAVHQVYVLKRPHVDEFLRRCGELY*CV 583
           K  +++DLDETLVHSSFK +++A FV+PVEID  VH VYV+KRP VDEFL R  +LY  V
Sbjct: 227 KKCLILDLDETLVHSSFKYMHSADFVLPVEIDDQVHNVYVIKRPGVDEFLNRVSQLYEVV 286

Query: 584 LFTASLAKYADPVADLLDRWGVFRARLFRDSCVFHRGNYVKDLNSL 721
           +FTAS+++YA+P+ D LD  G    RLFR++C  + GNY+K+L+ +
Sbjct: 287 VFTASVSRYANPLLDTLDPNGTIHHRLFREACYNYEGNYIKNLSQI 332


>UniRef50_A3LNJ1 Cluster: Predicted protein; n=3;
           Saccharomycetaceae|Rep: Predicted protein - Pichia
           stipitis (Yeast)
          Length = 171

 Score =  129 bits (312), Expect = 6e-29
 Identities = 58/106 (54%), Positives = 79/106 (74%)
 Frame = +2

Query: 404 KSVMVIDLDETLVHSSFKPINNAHFVVPVEIDGAVHQVYVLKRPHVDEFLRRCGELY*CV 583
           K  +++DLDETLVHSSFK +  A FV+PVEID  VH VYV+KRP VDEFL++ G+ +  V
Sbjct: 1   KKCLILDLDETLVHSSFKYLRTADFVIPVEIDNQVHHVYVIKRPGVDEFLKKVGQWFEVV 60

Query: 584 LFTASLAKYADPVADLLDRWGVFRARLFRDSCVFHRGNYVKDLNSL 721
           +FTAS++KY DP+ D LD       RLFRDSC  ++GN++K+L+ +
Sbjct: 61  VFTASVSKYGDPLLDKLDFHKAVHHRLFRDSCYNYQGNFIKNLSQI 106


>UniRef50_Q07800 Cluster: Phosphatase PSR1; n=4;
           Saccharomycetales|Rep: Phosphatase PSR1 - Saccharomyces
           cerevisiae (Baker's yeast)
          Length = 427

 Score =  128 bits (308), Expect = 2e-28
 Identities = 59/112 (52%), Positives = 82/112 (73%)
 Frame = +2

Query: 386 DTRTCIKSVMVIDLDETLVHSSFKPINNAHFVVPVEIDGAVHQVYVLKRPHVDEFLRRCG 565
           D  T  K  +++DLDETLVHSSFK + +A FV+ VEID  VH VYV+KRP V+EFL R G
Sbjct: 251 DESTKGKKCLILDLDETLVHSSFKYLRSADFVLSVEIDDQVHNVYVIKRPGVEEFLERVG 310

Query: 566 ELY*CVLFTASLAKYADPVADLLDRWGVFRARLFRDSCVFHRGNYVKDLNSL 721
           +L+  V+FTAS+++Y DP+ D+LD   V   RLFR++C  + GNY+K+L+ +
Sbjct: 311 KLFEVVVFTASVSRYGDPLLDILDTDKVIHHRLFREACYNYEGNYIKNLSQI 362


>UniRef50_A5DY31 Cluster: Putative uncharacterized protein; n=2;
           Saccharomycetales|Rep: Putative uncharacterized protein
           - Lodderomyces elongisporus (Yeast) (Saccharomyces
           elongisporus)
          Length = 507

 Score =  126 bits (305), Expect = 4e-28
 Identities = 58/107 (54%), Positives = 80/107 (74%), Gaps = 1/107 (0%)
 Frame = +2

Query: 404 KSVMVIDLDETLVHSSFKPINNAHFVVPVEIDGAVHQVYVLKRPHVDEFLRRCGELY*CV 583
           +  +++DLDETLVHSSFK +  A FV+PVEID  VH VYV+KRP VDEFLR+ G+ Y  V
Sbjct: 336 RKCLILDLDETLVHSSFKYLRTADFVIPVEIDNQVHHVYVIKRPGVDEFLRKVGQWYEVV 395

Query: 584 LFTASLAKYADPVADLLDRWGV-FRARLFRDSCVFHRGNYVKDLNSL 721
           +FTAS++KY DP+ + LD   +    RLFRDSC  ++GN++K+L+ +
Sbjct: 396 IFTASVSKYGDPLLNKLDLGNLAIHHRLFRDSCYNYQGNFIKNLSQV 442


>UniRef50_A3FQA3 Cluster: Putative uncharacterized protein; n=2;
           Cryptosporidium|Rep: Putative uncharacterized protein -
           Cryptosporidium parvum Iowa II
          Length = 475

 Score =  118 bits (283), Expect = 2e-25
 Identities = 54/106 (50%), Positives = 74/106 (69%)
 Frame = +2

Query: 404 KSVMVIDLDETLVHSSFKPINNAHFVVPVEIDGAVHQVYVLKRPHVDEFLRRCGELY*CV 583
           +  +V+DLDETL+HSSF+PI NA F + +EIDG  + VYVLKRP VD+FL     ++  V
Sbjct: 340 RKTLVLDLDETLIHSSFQPIRNASFTINIEIDGDYYDVYVLKRPGVDKFLNIVSAIFEVV 399

Query: 584 LFTASLAKYADPVADLLDRWGVFRARLFRDSCVFHRGNYVKDLNSL 721
           +FTASL+KYA+P+ D LD       RLFR++C     +Y+KDL+ L
Sbjct: 400 IFTASLSKYANPLLDRLDPMNKCPYRLFRENCTVEGNSYIKDLSKL 445


>UniRef50_Q54M72 Cluster: Putative uncharacterized protein; n=2;
           Dictyostelium discoideum AX4|Rep: Putative
           uncharacterized protein - Dictyostelium discoideum AX4
          Length = 375

 Score =  114 bits (275), Expect = 2e-24
 Identities = 53/106 (50%), Positives = 72/106 (67%)
 Frame = +2

Query: 404 KSVMVIDLDETLVHSSFKPINNAHFVVPVEIDGAVHQVYVLKRPHVDEFLRRCGELY*CV 583
           K  +++DLDETLVHS+ KP+ +    V V I+      YV+KRPHVD FL +  + Y  V
Sbjct: 201 KKTLILDLDETLVHSTLKPVTHHQITVKVLIEDMDCTFYVIKRPHVDYFLEKVSQWYDIV 260

Query: 584 LFTASLAKYADPVADLLDRWGVFRARLFRDSCVFHRGNYVKDLNSL 721
           +FTAS+ +YADP+ D LD   VF+ RLFRDSC+   GN+VKDL+ +
Sbjct: 261 IFTASMQQYADPLLDQLDTHKVFKKRLFRDSCLEKHGNFVKDLSMI 306


>UniRef50_A7TPN5 Cluster: Putative uncharacterized protein; n=1;
           Vanderwaltozyma polyspora DSM 70294|Rep: Putative
           uncharacterized protein - Vanderwaltozyma polyspora DSM
           70294
          Length = 350

 Score =  113 bits (272), Expect = 4e-24
 Identities = 54/107 (50%), Positives = 75/107 (70%), Gaps = 1/107 (0%)
 Frame = +2

Query: 404 KSVMVIDLDETLVHSSFKPINNAHFVVPVEIDGAVHQVYVLKRPHVDEFLRRCGELY*CV 583
           +  +V+DLDETLVHSSFK ++ A FV+PV+ID     VYV+KRP VD FL+   +L+  V
Sbjct: 179 RKCLVLDLDETLVHSSFKYVSTADFVLPVDIDDQFQNVYVIKRPGVDAFLQYTSKLFEVV 238

Query: 584 LFTASLAKYADPVADLLDRWG-VFRARLFRDSCVFHRGNYVKDLNSL 721
           +FTAS+ KY +P+ D+LD    +   RLFRD+C  + GNY+K+L  L
Sbjct: 239 IFTASVEKYGNPLLDILDSTNDLVHHRLFRDACYNYNGNYIKNLAQL 285


>UniRef50_A7QP65 Cluster: Chromosome chr1 scaffold_136, whole genome
           shotgun sequence; n=16; Viridiplantae|Rep: Chromosome
           chr1 scaffold_136, whole genome shotgun sequence - Vitis
           vinifera (Grape)
          Length = 312

 Score =  108 bits (260), Expect = 1e-22
 Identities = 51/112 (45%), Positives = 77/112 (68%), Gaps = 1/112 (0%)
 Frame = +2

Query: 389 TRTCIKSVMVIDLDETLVHSSFKPINNAHFVVPVEIDGAVHQVYVLKRPHVDEFLRRCGE 568
           TR+C  + +V+DLDETLVHS+ +P ++A F  PV  +   H VYV  RPH+ +F+ R   
Sbjct: 114 TRSCPPTTLVLDLDETLVHSTLEPCDDADFTFPVNFNLKEHMVYVRCRPHLKDFMERVAS 173

Query: 569 LY*CVLFTASLAKYADPVADLLD-RWGVFRARLFRDSCVFHRGNYVKDLNSL 721
           L+  ++FTAS + YA+ + ++LD +   FR R++R+SCVF  GNY+KDL+ L
Sbjct: 174 LFEIIIFTASQSIYAEQLLNVLDPKRRFFRHRVYRESCVFVEGNYLKDLSVL 225


>UniRef50_Q4N0T1 Cluster: Nuclear LIM interactor-interacting factor
           1, putative; n=2; Theileria|Rep: Nuclear LIM
           interactor-interacting factor 1, putative - Theileria
           parva
          Length = 254

 Score =  108 bits (260), Expect = 1e-22
 Identities = 53/109 (48%), Positives = 71/109 (65%)
 Frame = +2

Query: 395 TCIKSVMVIDLDETLVHSSFKPINNAHFVVPVEIDGAVHQVYVLKRPHVDEFLRRCGELY 574
           T  K ++V+DLDETL+HSSF+P NN+ F + +  +G    +Y+ KRP++ EFL      Y
Sbjct: 67  TVRKKMLVLDLDETLIHSSFEPSNNS-FPMQLMQNGVERTIYIGKRPYLSEFLSVVSNFY 125

Query: 575 *CVLFTASLAKYADPVADLLDRWGVFRARLFRDSCVFHRGNYVKDLNSL 721
             V+FTA L  YADPV D +D  GV + RLFRDSC +  G Y+KDL  L
Sbjct: 126 EIVIFTAGLKSYADPVIDFIDPDGVCKRRLFRDSCKYWNGYYIKDLEIL 174


>UniRef50_Q2HD78 Cluster: Putative uncharacterized protein; n=1;
           Chaetomium globosum|Rep: Putative uncharacterized
           protein - Chaetomium globosum (Soil fungus)
          Length = 314

 Score =  108 bits (260), Expect = 1e-22
 Identities = 49/85 (57%), Positives = 64/85 (75%)
 Frame = +2

Query: 467 NAHFVVPVEIDGAVHQVYVLKRPHVDEFLRRCGELY*CVLFTASLAKYADPVADLLDRWG 646
           +A F +PVEI+G  H VYV+KRP VD+F++R GELY  V+FTAS++KY DP+ D LD   
Sbjct: 165 SADFTIPVEIEGNYHNVYVIKRPGVDQFMKRVGELYEVVVFTASVSKYGDPLLDQLDIHK 224

Query: 647 VFRARLFRDSCVFHRGNYVKDLNSL 721
           V   RLFR+SC  H+GNYVKDL+ +
Sbjct: 225 VVHHRLFRESCYNHQGNYVKDLSQV 249


>UniRef50_Q7QXW9 Cluster: GLP_479_51161_49863; n=1; Giardia lamblia
           ATCC 50803|Rep: GLP_479_51161_49863 - Giardia lamblia
           ATCC 50803
          Length = 432

 Score =  107 bits (256), Expect = 4e-22
 Identities = 54/112 (48%), Positives = 73/112 (65%), Gaps = 6/112 (5%)
 Frame = +2

Query: 404 KSVMVIDLDETLVHSSFKPINNAHFVVPVEIDGAV------HQVYVLKRPHVDEFLRRCG 565
           K ++V+DLDETLVHSSF  ++NA  ++P+ I+  V      HQVYV KRP+VDEFL    
Sbjct: 258 KKLLVLDLDETLVHSSFNKVDNADMIIPLSIEDPVSKATISHQVYVYKRPYVDEFLETMA 317

Query: 566 ELY*CVLFTASLAKYADPVADLLDRWGVFRARLFRDSCVFHRGNYVKDLNSL 721
           + Y   +FTASL  Y D V + LD  G+   RL+RDSC+   G +VKD++ L
Sbjct: 318 KYYELAIFTASLRVYCDAVMEKLDPNGLCVHRLYRDSCIQSNGVFVKDMSIL 369


>UniRef50_UPI00006CC009 Cluster: NLI interacting factor-like
           phosphatase family protein; n=1; Tetrahymena thermophila
           SB210|Rep: NLI interacting factor-like phosphatase
           family protein - Tetrahymena thermophila SB210
          Length = 699

 Score =  105 bits (253), Expect = 8e-22
 Identities = 46/106 (43%), Positives = 73/106 (68%)
 Frame = +2

Query: 404 KSVMVIDLDETLVHSSFKPINNAHFVVPVEIDGAVHQVYVLKRPHVDEFLRRCGELY*CV 583
           K  +++DLDETLVHSSF+P+ N+ + + +++      ++V KRP V+ FL +  E +  V
Sbjct: 175 KKTLILDLDETLVHSSFQPMGNSDYTLSIKVQNIPFTIHVKKRPGVEYFLEKASEYFEVV 234

Query: 584 LFTASLAKYADPVADLLDRWGVFRARLFRDSCVFHRGNYVKDLNSL 721
           ++TASLA+YADPV DL+D       RLFR++C  ++G +VKDL+ +
Sbjct: 235 IYTASLAEYADPVCDLIDPKRYVSYRLFRENCTNYQGLFVKDLSKI 280


>UniRef50_UPI00006CDD92 Cluster: NLI interacting factor-like
           phosphatase family protein; n=1; Tetrahymena thermophila
           SB210|Rep: NLI interacting factor-like phosphatase
           family protein - Tetrahymena thermophila SB210
          Length = 721

 Score =  104 bits (249), Expect = 3e-21
 Identities = 49/104 (47%), Positives = 68/104 (65%)
 Frame = +2

Query: 404 KSVMVIDLDETLVHSSFKPINNAHFVVPVEIDGAVHQVYVLKRPHVDEFLRRCGELY*CV 583
           K  ++IDLDETLVHSSF  I NA F + + +      VYV KRP  + FL    + Y  +
Sbjct: 241 KKSLIIDLDETLVHSSFTVIQNADFTLQITVQNMPFIVYVKKRPGCEFFLEELSKYYELI 300

Query: 584 LFTASLAKYADPVADLLDRWGVFRARLFRDSCVFHRGNYVKDLN 715
           ++TASL++YADPV D +D+ GV   RLFR++C  + G +VKDL+
Sbjct: 301 IYTASLSEYADPVMDRIDKNGVCSLRLFRENCTLYNGVFVKDLS 344


>UniRef50_Q86S75 Cluster: Putative uncharacterized protein; n=3;
           Caenorhabditis|Rep: Putative uncharacterized protein -
           Caenorhabditis elegans
          Length = 312

 Score =  100 bits (240), Expect = 3e-20
 Identities = 53/112 (47%), Positives = 69/112 (61%), Gaps = 1/112 (0%)
 Frame = +2

Query: 389 TRTCIKSVMVIDLDETLVHSSFKPINNAHFVVPVEIDGAVHQVYVLKRPHVDEFLRRCGE 568
           TR+  +  +V+DLDETLVH S  P++NA  V PV      +QVYV  RPH+  FL R  +
Sbjct: 59  TRSTPEYTLVLDLDETLVHCSLTPLDNATMVFPVVFQNITYQVYVRLRPHLRTFLSRMAK 118

Query: 569 LY*CVLFTASLAKYADPVADLLD-RWGVFRARLFRDSCVFHRGNYVKDLNSL 721
            +  ++FTAS   YA+ + D+LD R    R RLFR+ CV   GNYVKDL  L
Sbjct: 119 TFEIIIFTASKKVYANKLCDILDPRKNHIRHRLFREHCVCVFGNYVKDLTIL 170


>UniRef50_A0CSK3 Cluster: Chromosome undetermined scaffold_26, whole
           genome shotgun sequence; n=1; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_26,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 337

 Score =  100 bits (240), Expect = 3e-20
 Identities = 48/106 (45%), Positives = 70/106 (66%)
 Frame = +2

Query: 404 KSVMVIDLDETLVHSSFKPINNAHFVVPVEIDGAVHQVYVLKRPHVDEFLRRCGELY*CV 583
           +  +VIDLDETLVHSSF  I++  F++ +++  A + +YV  RP  +EFL +  E Y   
Sbjct: 66  RKTLVIDLDETLVHSSFNYISDPDFILKIKVMNANYTIYVRIRPGAEEFLIKMAEFYEIF 125

Query: 584 LFTASLAKYADPVADLLDRWGVFRARLFRDSCVFHRGNYVKDLNSL 721
           +FTAS+ +YA+PV D +D+ GV   RLFR +C    G +VKDL+ L
Sbjct: 126 IFTASICEYANPVIDRIDQKGVCALRLFRPNCSILNGVFVKDLSKL 171


>UniRef50_A2G9Z3 Cluster: NLI interacting factor-like phosphatase
           family protein; n=1; Trichomonas vaginalis G3|Rep: NLI
           interacting factor-like phosphatase family protein -
           Trichomonas vaginalis G3
          Length = 242

 Score = 99.1 bits (236), Expect = 1e-19
 Identities = 51/104 (49%), Positives = 66/104 (63%)
 Frame = +2

Query: 404 KSVMVIDLDETLVHSSFKPINNAHFVVPVEIDGAVHQVYVLKRPHVDEFLRRCGELY*CV 583
           + V+V+DLDETLVH SF P       +P+ IDG  + VYV KRP +DEFL +   L+  V
Sbjct: 61  QKVLVLDLDETLVHCSFYPPEYHDLTLPIIIDGVQYDVYVQKRPFLDEFLAQIMPLFYVV 120

Query: 584 LFTASLAKYADPVADLLDRWGVFRARLFRDSCVFHRGNYVKDLN 715
           +FTASL  YA+P+ D +        RLFR+SC F  G YVKDL+
Sbjct: 121 VFTASLGPYANPIIDKILPNLPATQRLFRESCSFSNGMYVKDLD 164


>UniRef50_A2ARL6 Cluster: CTD (Carboxy-terminal domain RNA
           polymerase II polypeptide A) small phosphatase like 2;
           n=11; Coelomata|Rep: CTD (Carboxy-terminal domain RNA
           polymerase II polypeptide A) small phosphatase like 2 -
           Mus musculus (Mouse)
          Length = 394

 Score = 98.7 bits (235), Expect = 1e-19
 Identities = 51/112 (45%), Positives = 70/112 (62%), Gaps = 1/112 (0%)
 Frame = +2

Query: 389 TRTCIKSVMVIDLDETLVHSSFKPINNAHFVVPVEIDGAVHQVYVLKRPHVDEFLRRCGE 568
           TR+  +  +V+DLDETLVH S   + +A    PV     ++QVYV  RP   EFL R  +
Sbjct: 210 TRSTPEFSLVLDLDETLVHCSLNELEDAALTFPVLFQDVIYQVYVRLRPFFREFLERMSQ 269

Query: 569 LY*CVLFTASLAKYADPVADLLD-RWGVFRARLFRDSCVFHRGNYVKDLNSL 721
           +Y  +LFTAS   YAD + ++LD +  + R RLFR+ CV  +GNY+KDLN L
Sbjct: 270 MYEIILFTASKKVYADKLLNILDPKKQLVRHRLFREHCVCVQGNYIKDLNIL 321


>UniRef50_Q8IYI9 Cluster: CTDSPL2 protein (CTD (Carboxy-terminal
           domain, RNA polymerase II, polypeptide A) small
           phosphatase like 2, isoform CRA_a); n=34;
           Euteleostomi|Rep: CTDSPL2 protein (CTD (Carboxy-terminal
           domain, RNA polymerase II, polypeptide A) small
           phosphatase like 2, isoform CRA_a) - Homo sapiens
           (Human)
          Length = 466

 Score = 98.7 bits (235), Expect = 1e-19
 Identities = 51/112 (45%), Positives = 70/112 (62%), Gaps = 1/112 (0%)
 Frame = +2

Query: 389 TRTCIKSVMVIDLDETLVHSSFKPINNAHFVVPVEIDGAVHQVYVLKRPHVDEFLRRCGE 568
           TR+  +  +V+DLDETLVH S   + +A    PV     ++QVYV  RP   EFL R  +
Sbjct: 282 TRSTPEFSLVLDLDETLVHCSLNELEDAALTFPVLFQDVIYQVYVRLRPFFREFLERMSQ 341

Query: 569 LY*CVLFTASLAKYADPVADLLD-RWGVFRARLFRDSCVFHRGNYVKDLNSL 721
           +Y  +LFTAS   YAD + ++LD +  + R RLFR+ CV  +GNY+KDLN L
Sbjct: 342 MYEIILFTASKKVYADKLLNILDPKKQLVRHRLFREHCVCVQGNYIKDLNIL 393


>UniRef50_Q0JKL9 Cluster: Os01g0665300 protein; n=4; BEP clade|Rep:
           Os01g0665300 protein - Oryza sativa subsp. japonica
           (Rice)
          Length = 454

 Score = 97.5 bits (232), Expect = 3e-19
 Identities = 49/104 (47%), Positives = 67/104 (64%), Gaps = 1/104 (0%)
 Frame = +2

Query: 404 KSVMVIDLDETLVHSSFKPINNAHFVVPVEIDGAVHQVYVLKRPHVDEFLRRCGELY*CV 583
           K  +V+DLDETLVHS+ +  ++  F  PV  D   H VYV KRPH+  FL++  E++  V
Sbjct: 274 KVTLVLDLDETLVHSTTEQCDDYDFTFPVFFDMKEHMVYVRKRPHLHMFLQKMAEMFEVV 333

Query: 584 LFTASLAKYADPVADLLD-RWGVFRARLFRDSCVFHRGNYVKDL 712
           +FTAS + YAD + D+LD    +F  R FR+SCVF   +Y KDL
Sbjct: 334 IFTASQSVYADQLLDILDPEKKLFSRRYFRESCVFTNTSYTKDL 377


>UniRef50_Q54GB2 Cluster: Putative uncharacterized protein; n=1;
           Dictyostelium discoideum AX4|Rep: Putative
           uncharacterized protein - Dictyostelium discoideum AX4
          Length = 567

 Score = 97.1 bits (231), Expect = 4e-19
 Identities = 44/106 (41%), Positives = 68/106 (64%)
 Frame = +2

Query: 404 KSVMVIDLDETLVHSSFKPINNAHFVVPVEIDGAVHQVYVLKRPHVDEFLRRCGELY*CV 583
           K  +V+DLDETLVH S +P+   H   PV  +   +QV+  KRP  +EFL +  +++  +
Sbjct: 390 KISLVLDLDETLVHCSTEPLEQPHLTFPVFFNNTEYQVFAKKRPFFEEFLHKVSDIFEVI 449

Query: 584 LFTASLAKYADPVADLLDRWGVFRARLFRDSCVFHRGNYVKDLNSL 721
           +FTAS   YA+ + +++D     + RL+RDSCV+  GNY+KDL+ L
Sbjct: 450 IFTASQEVYANKLLNMIDPNNKIKYRLYRDSCVYVDGNYLKDLSVL 495


>UniRef50_A7RK91 Cluster: Predicted protein; n=2; Eumetazoa|Rep:
           Predicted protein - Nematostella vectensis
          Length = 289

 Score = 96.3 bits (229), Expect = 7e-19
 Identities = 54/124 (43%), Positives = 73/124 (58%), Gaps = 1/124 (0%)
 Frame = +2

Query: 353 NMPPDLCYRQ*DTRTCIKSVMVIDLDETLVHSSFKPINNAHFVVPVEIDGAVHQVYVLKR 532
           N PP L  R   TR   +  +V+DLDETLVH S   + +A    PV      +QV+V  R
Sbjct: 89  NRPPVLPLR---TRRTPEFSLVLDLDETLVHCSLNKLEDATLSFPVSYQDITYQVFVRTR 145

Query: 533 PHVDEFLRRCGELY*CVLFTASLAKYADPVADLLD-RWGVFRARLFRDSCVFHRGNYVKD 709
           PH+  FL R  +++  +LFTAS   YAD + ++LD     FR RLFR+ CV  +GNY+KD
Sbjct: 146 PHLKYFLERVSKVFEVILFTASKRVYADKLLNILDPEKKYFRHRLFREHCVCVQGNYIKD 205

Query: 710 LNSL 721
           L+ L
Sbjct: 206 LSIL 209


>UniRef50_Q9FXF4 Cluster: F1N18.17 protein; n=3; Arabidopsis
           thaliana|Rep: F1N18.17 protein - Arabidopsis thaliana
           (Mouse-ear cress)
          Length = 278

 Score = 95.9 bits (228), Expect = 9e-19
 Identities = 51/106 (48%), Positives = 68/106 (64%), Gaps = 2/106 (1%)
 Frame = +2

Query: 404 KSVMVIDLDETLVHSSFKP-IN-NAHFVVPVEIDGAVHQVYVLKRPHVDEFLRRCGELY* 577
           K  + +DLDETLVHS+ +P I  N  F+V ++I+GAV  ++V+KRP V EFL R  + Y 
Sbjct: 102 KRTIFLDLDETLVHSTMEPPIRVNVDFMVRIKIEGAVIPMFVVKRPGVTEFLERISKNYR 161

Query: 578 CVLFTASLAKYADPVADLLDRWGVFRARLFRDSCVFHRGNYVKDLN 715
             +FTA L +YA  V D LD+  V   RL+RDSC    G Y KDL+
Sbjct: 162 VAIFTAGLPEYASQVLDKLDKNRVISQRLYRDSCTEVNGRYAKDLS 207


>UniRef50_A2FGV6 Cluster: NLI interacting factor-like phosphatase
           family protein; n=2; Trichomonas vaginalis G3|Rep: NLI
           interacting factor-like phosphatase family protein -
           Trichomonas vaginalis G3
          Length = 324

 Score = 95.9 bits (228), Expect = 9e-19
 Identities = 47/106 (44%), Positives = 68/106 (64%)
 Frame = +2

Query: 404 KSVMVIDLDETLVHSSFKPINNAHFVVPVEIDGAVHQVYVLKRPHVDEFLRRCGELY*CV 583
           K  +V+DLDETLVHSSF  I +A +   + ++     V+V  RP  ++FLR  G LY  +
Sbjct: 157 KICLVLDLDETLVHSSFLAIPHADYRFNIGVEQNPVGVFVCVRPGAEKFLRELGSLYEII 216

Query: 584 LFTASLAKYADPVADLLDRWGVFRARLFRDSCVFHRGNYVKDLNSL 721
           +FTAS   YADPV D +D+  V + RL+R++C    G++VKDL+ L
Sbjct: 217 IFTASCQVYADPVIDFIDKGRVVKYRLYREACTDFNGSFVKDLSRL 262


>UniRef50_A7QQJ7 Cluster: Chromosome undetermined scaffold_143,
           whole genome shotgun sequence; n=2; Vitis vinifera|Rep:
           Chromosome undetermined scaffold_143, whole genome
           shotgun sequence - Vitis vinifera (Grape)
          Length = 479

 Score = 95.1 bits (226), Expect = 2e-18
 Identities = 49/113 (43%), Positives = 71/113 (62%), Gaps = 1/113 (0%)
 Frame = +2

Query: 386 DTRTCIKSVMVIDLDETLVHSSFKPINNAHFVVPVEIDGAVHQVYVLKRPHVDEFLRRCG 565
           +TR      +V+DLDETLVHS+ +  ++A F  PV  +   H VYV +RP++  FL R  
Sbjct: 300 ETRKKKSITLVLDLDETLVHSTLEHCDDADFTFPVFFNMKDHTVYVKQRPYLHTFLERVA 359

Query: 566 ELY*CVLFTASLAKYADPVADLLDRWG-VFRARLFRDSCVFHRGNYVKDLNSL 721
           E++  V+FTAS + YA+ + D+LD  G  F  R +R+SC+F  G+Y KDL  L
Sbjct: 360 EMFEIVVFTASQSIYAEQLLDILDPDGKFFSHRAYRESCIFSDGSYTKDLTVL 412


>UniRef50_A0DAA6 Cluster: Chromosome undetermined scaffold_43, whole
           genome shotgun sequence; n=2; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_43,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 336

 Score = 95.1 bits (226), Expect = 2e-18
 Identities = 44/106 (41%), Positives = 69/106 (65%)
 Frame = +2

Query: 404 KSVMVIDLDETLVHSSFKPINNAHFVVPVEIDGAVHQVYVLKRPHVDEFLRRCGELY*CV 583
           +  +VIDLDETLVHSSF+P+     +V V +    +++YV  RP   EF++   +L+  +
Sbjct: 45  RKTLVIDLDETLVHSSFEPMKINDLIVEVTMKDQKYKIYVNIRPGAQEFIKETSKLFELI 104

Query: 584 LFTASLAKYADPVADLLDRWGVFRARLFRDSCVFHRGNYVKDLNSL 721
           +FTAS+++YA+ V D +D  G+   RLFR++C  + G  VKDL+ L
Sbjct: 105 IFTASISEYANSVIDFIDPHGLVDLRLFRENCTVYNGVLVKDLSLL 150


>UniRef50_A7QNU7 Cluster: Chromosome undetermined scaffold_134,
           whole genome shotgun sequence; n=2; Vitis vinifera|Rep:
           Chromosome undetermined scaffold_134, whole genome
           shotgun sequence - Vitis vinifera (Grape)
          Length = 277

 Score = 94.7 bits (225), Expect = 2e-18
 Identities = 45/104 (43%), Positives = 68/104 (65%), Gaps = 1/104 (0%)
 Frame = +2

Query: 413 MVIDLDETLVHSSFKPINNAHFVVPVEIDGAVHQVYVLKRPHVDEFLRRCGELY*CVLFT 592
           +V+DLDETLVHS+ +P ++A F  PV  +   H +YV +RP +  FL R  E++  ++FT
Sbjct: 107 LVLDLDETLVHSTLEPCDHADFTFPVFFNMKEHTIYVRQRPFLQMFLERVAEMFEIIVFT 166

Query: 593 ASLAKYADPVADLLD-RWGVFRARLFRDSCVFHRGNYVKDLNSL 721
           AS + YA+ + D+LD    +F  R +R+SC+F  G+Y KDL  L
Sbjct: 167 ASQSIYAEQLLDILDPDRKLFSGRAYRESCIFSDGSYTKDLTVL 210


>UniRef50_Q5S7T3 Cluster: Putative nuclear LIM
           interactor-interacting protein; n=2; Phytophthora|Rep:
           Putative nuclear LIM interactor-interacting protein -
           Phytophthora sojae
          Length = 261

 Score = 94.3 bits (224), Expect = 3e-18
 Identities = 48/112 (42%), Positives = 69/112 (61%), Gaps = 1/112 (0%)
 Frame = +2

Query: 389 TRTCIKSVMVIDLDETLVHSSFKPINNAHFVVPVEIDGAVHQVYVLKRPHVDEFLRRCGE 568
           +R   K  +V+DLDETLVH S   + N H   PV  +G  + V V KRPH++ FL+R  +
Sbjct: 73  SRNAPKICLVLDLDETLVHCSVDEVKNPHMQFPVTFNGVEYTVNVKKRPHLEYFLKRVSK 132

Query: 569 LY*CVLFTASLAKYADPVADLLD-RWGVFRARLFRDSCVFHRGNYVKDLNSL 721
           L+  V+FTAS   YA+ + ++LD      + RL+R+ C+   GNY+KDLN L
Sbjct: 133 LFEIVVFTASHKVYAEKLMNMLDPNRNFIKYRLYREDCLDVFGNYLKDLNVL 184


>UniRef50_A2G0V4 Cluster: NLI interacting factor-like phosphatase
           family protein; n=1; Trichomonas vaginalis G3|Rep: NLI
           interacting factor-like phosphatase family protein -
           Trichomonas vaginalis G3
          Length = 287

 Score = 93.9 bits (223), Expect = 4e-18
 Identities = 49/106 (46%), Positives = 66/106 (62%)
 Frame = +2

Query: 404 KSVMVIDLDETLVHSSFKPINNAHFVVPVEIDGAVHQVYVLKRPHVDEFLRRCGELY*CV 583
           K  +V+DLDETLVHSSF  + NA F   + +D     +YV  RP  ++FL+  GELY  V
Sbjct: 120 KITLVLDLDETLVHSSFIAVPNADFSFQIGVDANCLGIYVCVRPGAEDFLKTLGELYELV 179

Query: 584 LFTASLAKYADPVADLLDRWGVFRARLFRDSCVFHRGNYVKDLNSL 721
           LFTAS   YAD V D +D     + RL+R+SC    G++VKDL+ +
Sbjct: 180 LFTASTKFYADLVVDQIDPDKNIKYRLYRESCSDLGGSHVKDLSKI 225


>UniRef50_A6R5B2 Cluster: Carboxy-terminal domain RNA polymerase II
           polypeptide A small phosphatase 1; n=1; Ajellomyces
           capsulatus NAm1|Rep: Carboxy-terminal domain RNA
           polymerase II polypeptide A small phosphatase 1 -
           Ajellomyces capsulatus NAm1
          Length = 519

 Score = 93.9 bits (223), Expect = 4e-18
 Identities = 44/79 (55%), Positives = 58/79 (73%), Gaps = 1/79 (1%)
 Frame = +2

Query: 404 KSVMVIDLDETLVHSSFKPINNAHFVVPVEIDGAVHQVYVLKRPHVDEFLRRCGELY*CV 583
           +  +V+DLDETLVHSSFK +  A F +PVEI+G  H +YV+KRP VD+F++R GELY  V
Sbjct: 384 RKCLVLDLDETLVHSSFKVLEKADFTIPVEIEGQYHNIYVIKRPGVDQFMKRVGELYEVV 443

Query: 584 LFTASLAKYADPVA-DLLD 637
           +FTAS++K    V  DL D
Sbjct: 444 VFTASVSKDLSQVGRDLRD 462


>UniRef50_UPI0000E479C0 Cluster: PREDICTED: similar to CTD
           (carboxy-terminal domain, RNA polymerase II, polypeptide
           A) small phosphatase like 2; n=1; Strongylocentrotus
           purpuratus|Rep: PREDICTED: similar to CTD
           (carboxy-terminal domain, RNA polymerase II, polypeptide
           A) small phosphatase like 2 - Strongylocentrotus
           purpuratus
          Length = 466

 Score = 92.7 bits (220), Expect = 8e-18
 Identities = 50/112 (44%), Positives = 66/112 (58%), Gaps = 1/112 (0%)
 Frame = +2

Query: 389 TRTCIKSVMVIDLDETLVHSSFKPINNAHFVVPVEIDGAVHQVYVLKRPHVDEFLRRCGE 568
           TR   K  +V+DLDETLVH S   + N     PV      +QVYV  RP   +FL R  +
Sbjct: 301 TRRSPKYSLVLDLDETLVHCSLAEMENCTMSFPVYFQDNEYQVYVRTRPFFRDFLERMSK 360

Query: 569 LY*CVLFTASLAKYADPVADLLD-RWGVFRARLFRDSCVFHRGNYVKDLNSL 721
           ++  +LFTAS   YAD + +LLD    + R RLFR+ C+  +GNY+KDLN L
Sbjct: 361 IFEIILFTASKRVYADKLLNLLDPEKKLVRHRLFREHCICVQGNYIKDLNIL 412


>UniRef50_A0BL21 Cluster: Chromosome undetermined scaffold_113,
           whole genome shotgun sequence; n=4; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_113,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 327

 Score = 91.9 bits (218), Expect = 1e-17
 Identities = 48/106 (45%), Positives = 65/106 (61%)
 Frame = +2

Query: 404 KSVMVIDLDETLVHSSFKPINNAHFVVPVEIDGAVHQVYVLKRPHVDEFLRRCGELY*CV 583
           + V+V+DLDETLVHS F+ IN   F + + + G + +VYV  RP V EFL +  E Y  V
Sbjct: 56  RKVIVLDLDETLVHSQFQIINGYDFSIDIIVQGQLFKVYVTIRPGVYEFLEQLYEFYDIV 115

Query: 584 LFTASLAKYADPVADLLDRWGVFRARLFRDSCVFHRGNYVKDLNSL 721
            +TASL +YADPV D +D       R++RDSC   +    K+LN L
Sbjct: 116 FWTASLQEYADPVMDFIDPNNRAIGRMYRDSCTPLQIGLTKNLNKL 161


>UniRef50_UPI0000D5691E Cluster: PREDICTED: similar to CTD
           (carboxy-terminal domain, RNA polymerase II, polypeptide
           A) small phosphatase like 2; n=1; Tribolium
           castaneum|Rep: PREDICTED: similar to CTD
           (carboxy-terminal domain, RNA polymerase II, polypeptide
           A) small phosphatase like 2 - Tribolium castaneum
          Length = 451

 Score = 91.5 bits (217), Expect = 2e-17
 Identities = 48/114 (42%), Positives = 71/114 (62%), Gaps = 3/114 (2%)
 Frame = +2

Query: 389 TRTCIKSVMVIDLDETLVHSSFKPINNAHFVVPVEIDGAVHQVYVLKRPHVDEFLRRCGE 568
           TR+  +  +V+DLDETLVH S + +++A F  PV      + VYV  RP+  EF+ +  +
Sbjct: 267 TRSSPEFSLVLDLDETLVHCSLQELSDASFHFPVLFQDCSYTVYVRTRPYFREFMEKVSQ 326

Query: 569 LY*CVLFTASLAKYADPVADLLD---RWGVFRARLFRDSCVFHRGNYVKDLNSL 721
           ++  +LFTAS   YAD + +LLD   +W   + RLFR+ CV   GNY+KDL+ L
Sbjct: 327 MFEVILFTASKRVYADKLLNLLDPERKW--IKYRLFREHCVCVNGNYIKDLSIL 378


>UniRef50_Q00VM1 Cluster: TFIIF-interacting CTD phosphatase,
           including NLI-interacting factor; n=1; Ostreococcus
           tauri|Rep: TFIIF-interacting CTD phosphatase, including
           NLI-interacting factor - Ostreococcus tauri
          Length = 485

 Score = 91.1 bits (216), Expect = 3e-17
 Identities = 50/108 (46%), Positives = 67/108 (62%), Gaps = 2/108 (1%)
 Frame = +2

Query: 404 KSVMVIDLDETLVHSSFKPINN-AHFVVPVEIDGAVHQVYVLKRPHVDEFLRRCGELY*C 580
           ++ +V+DLDETLVHS+ +     + F  PV  +G +HQV V  RPH+  F+    + Y  
Sbjct: 286 RNTLVLDLDETLVHSNLENTGGKSDFSFPVVFNGEIHQVNVRTRPHLQTFMETVSKKYEI 345

Query: 581 VLFTASLAKYADPVADLLDRWGVFRA-RLFRDSCVFHRGNYVKDLNSL 721
           V+FTAS   YAD + DLLD    + A R+FRDSCV   GNY+KDL  L
Sbjct: 346 VVFTASQQIYADKLLDLLDPKREWIAHRVFRDSCVQIEGNYMKDLRVL 393


>UniRef50_Q8VY28 Cluster: Putative uncharacterized protein
           At5g46410; n=2; Arabidopsis thaliana|Rep: Putative
           uncharacterized protein At5g46410 - Arabidopsis thaliana
           (Mouse-ear cress)
          Length = 453

 Score = 90.2 bits (214), Expect = 4e-17
 Identities = 52/108 (48%), Positives = 67/108 (62%), Gaps = 2/108 (1%)
 Frame = +2

Query: 404 KSV-MVIDLDETLVHSSFKPINNAHFVVPVEIDGAVHQVYVLKRPHVDEFLRRCGELY*C 580
           KSV +V+DLDETLVHS+ +  N A F   V  +   + VYV +RPH+  FL R GEL+  
Sbjct: 279 KSVTLVLDLDETLVHSTLESCNVADFSFRVFFNMQENTVYVRQRPHLYRFLERVGELFHV 338

Query: 581 VLFTASLAKYADPVADLLDRWGVF-RARLFRDSCVFHRGNYVKDLNSL 721
           V+FTAS + YA  + D+LD  G F   R +RDSC+   G Y KDL  L
Sbjct: 339 VIFTASHSIYASQLLDILDPDGKFISQRFYRDSCILLDGIYTKDLTVL 386


>UniRef50_UPI0000DB7CDC Cluster: PREDICTED: similar to CTD
           (carboxy-terminal domain, RNA polymerase II, polypeptide
           A) small phosphatase like 2; n=1; Apis mellifera|Rep:
           PREDICTED: similar to CTD (carboxy-terminal domain, RNA
           polymerase II, polypeptide A) small phosphatase like 2 -
           Apis mellifera
          Length = 486

 Score = 89.8 bits (213), Expect = 6e-17
 Identities = 48/112 (42%), Positives = 68/112 (60%), Gaps = 1/112 (0%)
 Frame = +2

Query: 389 TRTCIKSVMVIDLDETLVHSSFKPINNAHFVVPVEIDGAVHQVYVLKRPHVDEFLRRCGE 568
           TR+  +  +V+DLDETLVH S + +++A F  PV      + V+V  RP+  EFL     
Sbjct: 302 TRSSPEFSLVLDLDETLVHCSLQELSDAAFRFPVVFQDVTYTVFVRTRPYFREFLEHVSS 361

Query: 569 LY*CVLFTASLAKYADPVADLLD-RWGVFRARLFRDSCVFHRGNYVKDLNSL 721
           LY  +LFTAS   YA+ + +LLD    + + RLFR+ CV   GNY+KDL+ L
Sbjct: 362 LYEVILFTASKRVYANKLMNLLDPTRKLIKYRLFREHCVCVNGNYIKDLSIL 413


>UniRef50_UPI00015B4F0F Cluster: PREDICTED: similar to conserved
           hypothetical protein; n=1; Nasonia vitripennis|Rep:
           PREDICTED: similar to conserved hypothetical protein -
           Nasonia vitripennis
          Length = 525

 Score = 89.0 bits (211), Expect = 1e-16
 Identities = 48/112 (42%), Positives = 67/112 (59%), Gaps = 1/112 (0%)
 Frame = +2

Query: 389 TRTCIKSVMVIDLDETLVHSSFKPINNAHFVVPVEIDGAVHQVYVLKRPHVDEFLRRCGE 568
           TR+  +  +V+DLDETLVH S + +++A F  PV      + V+V  RP   EFL     
Sbjct: 341 TRSSPEFSLVLDLDETLVHCSLQELSDASFRFPVVFQNITYTVFVRTRPFFREFLEHVSS 400

Query: 569 LY*CVLFTASLAKYADPVADLLD-RWGVFRARLFRDSCVFHRGNYVKDLNSL 721
           LY  +LFTAS   YA+ + +LLD    + + RLFR+ CV   GNY+KDL+ L
Sbjct: 401 LYEVILFTASKRVYANKLMNLLDPTRKLIKYRLFREHCVCVNGNYIKDLSIL 452


>UniRef50_Q9FK73 Cluster: Arabidopsis thaliana genomic DNA,
           chromosome 5, P1 clone:MRA19; n=3; core
           eudicotyledons|Rep: Arabidopsis thaliana genomic DNA,
           chromosome 5, P1 clone:MRA19 - Arabidopsis thaliana
           (Mouse-ear cress)
          Length = 272

 Score = 89.0 bits (211), Expect = 1e-16
 Identities = 52/105 (49%), Positives = 64/105 (60%), Gaps = 2/105 (1%)
 Frame = +2

Query: 404 KSVMVIDLDETLVHSSF-KPINNAHFVVPVEIDGAVHQVYVLKRPHVDEFLRRCGELY*C 580
           K  +V+DLDETLVHSS  KP     FVV  +IDG +   +V+KRP VDEFL++ GE Y  
Sbjct: 97  KKTIVLDLDETLVHSSMEKPEVPYDFVVNPKIDGQILTFFVIKRPGVDEFLKKIGEKYQI 156

Query: 581 VLFTASLAKYADPVADLLD-RWGVFRARLFRDSCVFHRGNYVKDL 712
           V+FTA L +YA  V D LD    V     +RD+C    G  VKDL
Sbjct: 157 VVFTAGLREYASLVLDKLDPERRVISRSFYRDACSEIDGRLVKDL 201


>UniRef50_Q0P4B2 Cluster: Zgc:153196; n=2; Danio rerio|Rep:
           Zgc:153196 - Danio rerio (Zebrafish) (Brachydanio rerio)
          Length = 220

 Score = 88.6 bits (210), Expect = 1e-16
 Identities = 39/45 (86%), Positives = 42/45 (93%)
 Frame = +2

Query: 587 FTASLAKYADPVADLLDRWGVFRARLFRDSCVFHRGNYVKDLNSL 721
           F  SLAKYADPVADLLD+WGVFRARLFR+SCVFHRGNYVKDL+ L
Sbjct: 111 FKPSLAKYADPVADLLDQWGVFRARLFRESCVFHRGNYVKDLSRL 155



 Score = 37.5 bits (83), Expect = 0.33
 Identities = 19/29 (65%), Positives = 23/29 (79%)
 Frame = +2

Query: 404 KSVMVIDLDETLVHSSFKPINNAHFVVPV 490
           K+ +VIDLDETLVHSSFKP + A +  PV
Sbjct: 95  KNCVVIDLDETLVHSSFKP-SLAKYADPV 122


>UniRef50_A0DJT1 Cluster: Chromosome undetermined scaffold_53, whole
           genome shotgun sequence; n=4; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_53,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 308

 Score = 87.4 bits (207), Expect = 3e-16
 Identities = 43/106 (40%), Positives = 65/106 (61%)
 Frame = +2

Query: 404 KSVMVIDLDETLVHSSFKPINNAHFVVPVEIDGAVHQVYVLKRPHVDEFLRRCGELY*CV 583
           + V V+DLDETLVHS FK  N+  F + + +   + +VYV  RP V+ F+    E +  +
Sbjct: 55  RKVCVLDLDETLVHSQFKAENDHDFSLDIIVQSQLFKVYVTVRPGVENFIDTLSEYFEVI 114

Query: 584 LFTASLAKYADPVADLLDRWGVFRARLFRDSCVFHRGNYVKDLNSL 721
           ++TASL +YADPV D++D       RL+R+SC   +G   K+L+ L
Sbjct: 115 MWTASLKEYADPVMDIIDPSRRALTRLYRESCTPIQGGLTKNLSKL 160


>UniRef50_Q4Q9N6 Cluster: Putative uncharacterized protein; n=3;
           Leishmania|Rep: Putative uncharacterized protein -
           Leishmania major
          Length = 364

 Score = 85.4 bits (202), Expect = 1e-15
 Identities = 44/108 (40%), Positives = 63/108 (58%), Gaps = 2/108 (1%)
 Frame = +2

Query: 404 KSVMVIDLDETLVHSSFKPINNAHFVVPVEIDGAVH-QVYVLKRPHVDEFLRRCGELY*C 580
           K  +++D+DETLVHSS++        +P+ +D   H  VYV  RPH+  FL     L+  
Sbjct: 180 KKCLILDVDETLVHSSYQNTGRYDVHLPITLDRDTHVNVYVAFRPHLQRFLEAVAPLFEV 239

Query: 581 VLFTASLAKYADPVADLLDRWGVFRA-RLFRDSCVFHRGNYVKDLNSL 721
           V+FTASL+ Y DP+ D +D+  +    RLFR+ C      YVKDL+ L
Sbjct: 240 VIFTASLSTYCDPLMDSIDKQHILGGLRLFREHCSVVGTTYVKDLSLL 287


>UniRef50_UPI000155399B Cluster: PREDICTED: hypothetical protein;
           n=1; Mus musculus|Rep: PREDICTED: hypothetical protein -
           Mus musculus
          Length = 420

 Score = 85.0 bits (201), Expect = 2e-15
 Identities = 46/112 (41%), Positives = 66/112 (58%), Gaps = 1/112 (0%)
 Frame = +2

Query: 389 TRTCIKSVMVIDLDETLVHSSFKPINNAHFVVPVEIDGAVHQVYVLKRPHVDEFLRRCGE 568
           TR+  +  +V+DLDETLVH S   + NA    PV     ++Q      P   EFL R  +
Sbjct: 258 TRSTSEFSLVLDLDETLVHCSLNELENAALTFPVLFQDVIYQFL----PFFREFLERISQ 313

Query: 569 LY*CVLFTASLAKYADPVADLLD-RWGVFRARLFRDSCVFHRGNYVKDLNSL 721
           +Y  +LFTAS   YAD + ++LD +  + R +LFR+ C+  +GNY+KDLN L
Sbjct: 314 MYEIILFTASKKVYADKLLNILDPKKQLVRHQLFREHCICVQGNYIKDLNIL 365


>UniRef50_Q4Q9H6 Cluster: Nuclear lim interactor-interacting
           factor-like protein; n=3; Leishmania|Rep: Nuclear lim
           interactor-interacting factor-like protein - Leishmania
           major
          Length = 290

 Score = 84.6 bits (200), Expect = 2e-15
 Identities = 44/109 (40%), Positives = 68/109 (62%), Gaps = 3/109 (2%)
 Frame = +2

Query: 404 KSVMVIDLDETLVHSSFKPINNAHF--VVPVEIDGAVHQVYVLKRPHVDEFLRRCGELY* 577
           K  +V+D+DETLVHS+F+P ++  +  V+ V  +G  + V V  RP++++FLR     + 
Sbjct: 112 KVTLVLDVDETLVHSTFQPSSDVVYDKVLLVPSEGKTYTVSVKYRPYLEDFLRFVSRRFE 171

Query: 578 CVLFTASLAKYADPVADLLDRWGVF-RARLFRDSCVFHRGNYVKDLNSL 721
            V+FTAS+  Y D + D +D  G+    RLFR+ C F   +YVKDL+ L
Sbjct: 172 VVIFTASMRAYCDKLMDEIDPHGILGNLRLFREHCTFSERSYVKDLHRL 220


>UniRef50_A2DY53 Cluster: Putative uncharacterized protein; n=1;
           Trichomonas vaginalis G3|Rep: Putative uncharacterized
           protein - Trichomonas vaginalis G3
          Length = 288

 Score = 84.2 bits (199), Expect = 3e-15
 Identities = 45/106 (42%), Positives = 63/106 (59%)
 Frame = +2

Query: 404 KSVMVIDLDETLVHSSFKPINNAHFVVPVEIDGAVHQVYVLKRPHVDEFLRRCGELY*CV 583
           K  +++DLDETL+HSSF PI NA+F   +    A   V VL RPH +EF+   GE +  +
Sbjct: 123 KISLILDLDETLIHSSFVPIQNANFTFLLNAVPAPIPVSVLIRPHAEEFITSLGEKFELI 182

Query: 584 LFTASLAKYADPVADLLDRWGVFRARLFRDSCVFHRGNYVKDLNSL 721
           +FTAS   YAD   + +D   + + +L+R+SC    G  VKDL  L
Sbjct: 183 VFTASNKDYADYCIEQIDPKHLVKYKLYRESCSDLNGATVKDLGLL 228


>UniRef50_A0E2M8 Cluster: Chromosome undetermined scaffold_75, whole
           genome shotgun sequence; n=1; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_75,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 492

 Score = 84.2 bits (199), Expect = 3e-15
 Identities = 45/108 (41%), Positives = 63/108 (58%), Gaps = 2/108 (1%)
 Frame = +2

Query: 404 KSVMVIDLDETLVHSSFKPINNAHFVVPVEIDGAVHQVYVLKRPHVDEFLRRCGELY*CV 583
           +  +VIDLDETLVH +  P   + F +PV+I+   +Q  +  RP+  EFLR   E Y  +
Sbjct: 282 QKTLVIDLDETLVHCNEYPQLKSDFYIPVQINNITYQAGISVRPYAQEFLRSMAEYYEII 341

Query: 584 LFTASLAKYADPVADLLDRWG-VFRARLFRDSCV-FHRGNYVKDLNSL 721
           +FTAS   YA+ + D LD  G +   RLFR+ C+    G +VKDL  L
Sbjct: 342 IFTASNEDYANQIIDYLDPTGTLVSGRLFREDCIRVESGCHVKDLRIL 389


>UniRef50_A0DPK8 Cluster: Chromosome undetermined scaffold_59, whole
           genome shotgun sequence; n=3; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_59,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 250

 Score = 84.2 bits (199), Expect = 3e-15
 Identities = 41/103 (39%), Positives = 61/103 (59%)
 Frame = +2

Query: 413 MVIDLDETLVHSSFKPINNAHFVVPVEIDGAVHQVYVLKRPHVDEFLRRCGELY*CVLFT 592
           +V+DLDETL+HS  +  +     + V+I   + + Y+  RP+  EFL+   +L+  V+FT
Sbjct: 75  LVLDLDETLIHSDLERTSILDEEIIVKIGENIEKYYIKVRPYAREFLQSLSQLFDLVIFT 134

Query: 593 ASLAKYADPVADLLDRWGVFRARLFRDSCVFHRGNYVKDLNSL 721
           A+L +YAD V D LD  G  + R +RDSC    G Y KDL  +
Sbjct: 135 AALKEYADKVIDFLDPCGFIKRRFYRDSCTKKDGVYYKDLTKV 177


>UniRef50_UPI0000549063 Cluster: PREDICTED: hypothetical protein;
           n=1; Danio rerio|Rep: PREDICTED: hypothetical protein -
           Danio rerio
          Length = 360

 Score = 82.2 bits (194), Expect = 1e-14
 Identities = 42/112 (37%), Positives = 67/112 (59%), Gaps = 1/112 (0%)
 Frame = +2

Query: 389 TRTCIKSVMVIDLDETLVHSSFKPINNAHFVVPVEIDGAVHQVYVLKRPHVDEFLRRCGE 568
           TR+   + +V+DLDETLV SS   I +A +          ++VYV+ RPHV EFL+   +
Sbjct: 176 TRSTPAATLVLDLDETLVFSSLNVIPDAEYTFNTRFQDHKYKVYVILRPHVREFLQAMTK 235

Query: 569 LY*CVLFTASLAKYADPVADLLD-RWGVFRARLFRDSCVFHRGNYVKDLNSL 721
            +   ++T++  +YA+ + D+LD    +FR RL++D C    G+Y+KDL  L
Sbjct: 236 HFEMFVYTSAKKEYAEKIVDILDPNKKLFRHRLYQDDCACVLGHYIKDLTIL 287


>UniRef50_A2DNP9 Cluster: NLI interacting factor-like phosphatase
           family protein; n=2; Trichomonas vaginalis G3|Rep: NLI
           interacting factor-like phosphatase family protein -
           Trichomonas vaginalis G3
          Length = 322

 Score = 82.2 bits (194), Expect = 1e-14
 Identities = 50/164 (30%), Positives = 82/164 (50%)
 Frame = +2

Query: 230 PAASCDRCCAVGAVAEARDLPEAMAPIVSTAGLLRPCWSCLNMPPDLCYRQ*DTRTCIKS 409
           P + CD CCA   V   R  P +   I + +  L        +PP       D +   K 
Sbjct: 112 PTSCCDFCCAKQKVYPTRSTPYSKYSIANKSMDL--------LPPK------DPKDHKKI 157

Query: 410 VMVIDLDETLVHSSFKPINNAHFVVPVEIDGAVHQVYVLKRPHVDEFLRRCGELY*CVLF 589
            +V+D+DETL+HS+F+   +  F   +  D   + +YV  RP + +FL+   + +  V F
Sbjct: 158 TLVLDVDETLIHSTFENDPHHDFHFSMTNDDITYDIYVSVRPGLKKFLKTLSKHFELVAF 217

Query: 590 TASLAKYADPVADLLDRWGVFRARLFRDSCVFHRGNYVKDLNSL 721
           T +   Y D + D +D   + + RL+R+SC+ + G +VKDL+ L
Sbjct: 218 TTARQNYCDYILDRIDPDHLIKYRLYRESCIIYNGTFVKDLSLL 261


>UniRef50_Q871J4 Cluster: Related to nuclear envelope protein NEM1;
           n=4; Sordariomycetes|Rep: Related to nuclear envelope
           protein NEM1 - Neurospora crassa
          Length = 531

 Score = 81.4 bits (192), Expect = 2e-14
 Identities = 51/122 (41%), Positives = 71/122 (58%), Gaps = 16/122 (13%)
 Frame = +2

Query: 404 KSVMVIDLDETLVHSSFKP--INNAHFV--------VPV---EIDGAVHQV--YVLKRPH 538
           +  +++DLDETL+HS  K   +++ H V        V V   +  G  H +  YV KRPH
Sbjct: 339 QKTLILDLDETLIHSMSKGGRMSSGHMVEVRLNTTYVGVGGQQTIGPQHPILYYVHKRPH 398

Query: 539 VDEFLRRCGELY*CVLFTASLAKYADPVADLLDR-WGVFRARLFRDSCVFHRGNYVKDLN 715
            DEFLRR  + Y  V+FTAS+ +YADPV D L+     F AR +R  C F  G ++KDL+
Sbjct: 399 CDEFLRRVSKWYNLVVFTASVQEYADPVIDWLESDRKYFSARYYRQHCTFRHGAFIKDLS 458

Query: 716 SL 721
           S+
Sbjct: 459 SV 460


>UniRef50_Q4DGU0 Cluster: Putative uncharacterized protein; n=1;
           Trypanosoma cruzi|Rep: Putative uncharacterized protein
           - Trypanosoma cruzi
          Length = 446

 Score = 80.6 bits (190), Expect = 4e-14
 Identities = 42/108 (38%), Positives = 65/108 (60%), Gaps = 2/108 (1%)
 Frame = +2

Query: 404 KSVMVIDLDETLVHSSFKPINNAH-FVVPVEIDGAVHQVYVLKRPHVDEFLRRCGELY*C 580
           K  +++DLDETLVHSS       H  ++ ++ +  V  +YV  RP + EF++    L+  
Sbjct: 257 KKTLILDLDETLVHSSLTLQPKQHDLILSMKTEPEVTTIYVAYRPFLHEFIQAVAGLFEV 316

Query: 581 VLFTASLAKYADPVADLLDRWGVFRA-RLFRDSCVFHRGNYVKDLNSL 721
           V+FTAS++ Y +PV D +D  G+  + RL+R+ C    G YVKDL+ L
Sbjct: 317 VIFTASVSMYCNPVMDAVDPEGILGSLRLYREHCSILNGAYVKDLSLL 364


>UniRef50_Q0JL24 Cluster: Os01g0629400 protein; n=4; Oryza
           sativa|Rep: Os01g0629400 protein - Oryza sativa subsp.
           japonica (Rice)
          Length = 465

 Score = 79.0 bits (186), Expect = 1e-13
 Identities = 43/107 (40%), Positives = 63/107 (58%), Gaps = 4/107 (3%)
 Frame = +2

Query: 413 MVIDLD---ETLVHSSFKPINNAHFVVPVEIDGAVHQVYVLKRPHVDEFLRRCGELY*CV 583
           +V+DLD    TLVHS+    +N  F + V  +   H VYV +RPH+  FL +  +++  V
Sbjct: 289 LVLDLDGKLATLVHSTLDHCDNVDFTLQVFFNMKNHTVYVRQRPHLKMFLEKVAQMFDLV 348

Query: 584 LFTASLAKYADPVADLLDRWG-VFRARLFRDSCVFHRGNYVKDLNSL 721
           +FTAS   YA+ + D LD  G +   R++R+SC+F  G Y KDL  L
Sbjct: 349 IFTASQRIYAEQLIDRLDPDGRLISHRIYRESCIFSEGCYTKDLTIL 395


>UniRef50_A0E487 Cluster: Chromosome undetermined scaffold_78, whole
           genome shotgun sequence; n=1; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_78,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 289

 Score = 78.6 bits (185), Expect = 1e-13
 Identities = 39/106 (36%), Positives = 61/106 (57%)
 Frame = +2

Query: 404 KSVMVIDLDETLVHSSFKPINNAHFVVPVEIDGAVHQVYVLKRPHVDEFLRRCGELY*CV 583
           + ++V+DLDETLVHS F+  ++    + + +     +V+V+ RP + +F  +  + Y  +
Sbjct: 53  RKIIVLDLDETLVHSQFQHFDSYDLSLDIVVQSQNFKVFVIVRPGIKQFFDQLNQFYDII 112

Query: 584 LFTASLAKYADPVADLLDRWGVFRARLFRDSCVFHRGNYVKDLNSL 721
           L+TASL +YA PV D +D       RLFRDSC   +    KDL  L
Sbjct: 113 LWTASLKEYAMPVMDYIDPDRKAVERLFRDSCTPLKNGLTKDLTKL 158


>UniRef50_A0C0L1 Cluster: Chromosome undetermined scaffold_14, whole
           genome shotgun sequence; n=3; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_14,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 276

 Score = 77.8 bits (183), Expect = 3e-13
 Identities = 37/105 (35%), Positives = 60/105 (57%), Gaps = 2/105 (1%)
 Frame = +2

Query: 404 KSVMVIDLDETLVHSSFKPINNAHFVVPVEI--DGAVHQVYVLKRPHVDEFLRRCGELY* 577
           K ++V+DLDETLVH  FK   N ++   +++   G ++ VY+ +RPH+++FL++    Y 
Sbjct: 37  KKILVLDLDETLVHCEFKENQNFNYETILDVWHRGMLYNVYLCRRPHLEQFLKQMSVYYE 96

Query: 578 CVLFTASLAKYADPVADLLDRWGVFRARLFRDSCVFHRGNYVKDL 712
            ++FTA    Y D V   +D          R +C+F  GN +KDL
Sbjct: 97  IIIFTAGYESYCDKVLQYIDVDKHISDYFARSNCIFVNGNCLKDL 141


>UniRef50_Q6FN41 Cluster: Similar to sp|P38757 Saccharomyces
           cerevisiae YHR004c; n=1; Candida glabrata|Rep: Similar
           to sp|P38757 Saccharomyces cerevisiae YHR004c - Candida
           glabrata (Yeast) (Torulopsis glabrata)
          Length = 464

 Score = 77.4 bits (182), Expect = 3e-13
 Identities = 46/115 (40%), Positives = 66/115 (57%), Gaps = 9/115 (7%)
 Frame = +2

Query: 404 KSVMVIDLDETLVHS-----SFKPINNAHFV-VPVEIDGAVHQVYVLKRPHVDEFLRRCG 565
           K  +VIDLDETL+HS     +    + AH + V   I G     YV KRP+ D FL +  
Sbjct: 271 KKTLVIDLDETLIHSVSRGTTHSNSSQAHIIEVRFAISGVSTLYYVHKRPYCDLFLSKVC 330

Query: 566 ELY*CVLFTASLAKYADPVADLLDR--WGVFRARLFRDSCVFHRG-NYVKDLNSL 721
           + Y  ++FTAS+ +YADPV D L+    G F  R++R+ C+   G  Y+KDL ++
Sbjct: 331 KWYNLIIFTASMKEYADPVIDWLESSFSGSFTQRMYRNHCIARDGVGYIKDLGNI 385


>UniRef50_Q4P7E4 Cluster: Putative uncharacterized protein; n=1;
            Ustilago maydis|Rep: Putative uncharacterized protein -
            Ustilago maydis (Smut fungus)
          Length = 928

 Score = 77.0 bits (181), Expect = 4e-13
 Identities = 40/79 (50%), Positives = 52/79 (65%), Gaps = 1/79 (1%)
 Frame = +2

Query: 479  VVPVEIDGAVHQVYVLKRPHVDEFLRRCGELY*CVLFTASLAKYADPVADLLDRW-GVFR 655
            +V V +DG     +V KRP  D FLR+    Y  V+FTAS+ +YADPV D LD+  G+  
Sbjct: 783  MVEVVLDGRSVLYHVYKRPWADYFLRKVASWYTVVIFTASVQEYADPVIDWLDQGRGLIS 842

Query: 656  ARLFRDSCVFHRGNYVKDL 712
            ARLFR+SC F  G+YVK+L
Sbjct: 843  ARLFRESCSFKAGSYVKNL 861


>UniRef50_O95476 Cluster: Serine/threonine-protein phosphatase
           dullard; n=40; Eumetazoa|Rep: Serine/threonine-protein
           phosphatase dullard - Homo sapiens (Human)
          Length = 244

 Score = 77.0 bits (181), Expect = 4e-13
 Identities = 43/113 (38%), Positives = 63/113 (55%), Gaps = 9/113 (7%)
 Frame = +2

Query: 404 KSVMVIDLDETLVHS--------SFKPINNAHFVVPVEIDGAVHQVYVLKRPHVDEFLRR 559
           + ++V+DLDETL+HS        + +P     F++ V ID    + +V KRPHVD FL  
Sbjct: 61  RKILVLDLDETLIHSHHDGVLRPTVRPGTPPDFILKVVIDKHPVRFFVHKRPHVDFFLEV 120

Query: 560 CGELY*CVLFTASLAKYADPVADLLDR-WGVFRARLFRDSCVFHRGNYVKDLN 715
             + Y  V+FTAS+  Y   VAD LD    + + R +R  C    G+Y+KDL+
Sbjct: 121 VSQWYELVVFTASMEIYGSAVADKLDNSRSILKRRYYRQHCTLELGSYIKDLS 173


>UniRef50_A7TS54 Cluster: Putative uncharacterized protein; n=1;
           Vanderwaltozyma polyspora DSM 70294|Rep: Putative
           uncharacterized protein - Vanderwaltozyma polyspora DSM
           70294
          Length = 422

 Score = 76.6 bits (180), Expect = 6e-13
 Identities = 47/113 (41%), Positives = 63/113 (55%), Gaps = 9/113 (7%)
 Frame = +2

Query: 404 KSVMVIDLDETLVHSSFKPINN-----AHFV-VPVEIDGAVHQVYVLKRPHVDEFLRRCG 565
           K  +V+DLDETL+HS  +   N     AH V V   I G     YV KRP+ D FL +  
Sbjct: 192 KKKLVLDLDETLIHSISRSTPNSNNAQAHLVEVKFPISGISTLYYVHKRPYCDLFLSKVC 251

Query: 566 ELY*CVLFTASLAKYADPVADLLDR--WGVFRARLFRDSCVFHRG-NYVKDLN 715
             Y  ++FTAS+ +YADPV D L+    G F  R +R+ C+   G  Y+KDL+
Sbjct: 252 RWYDLIIFTASMKEYADPVIDWLETSFRGSFSKRFYRNDCILRDGVGYIKDLS 304


>UniRef50_Q57ZA0 Cluster: Putative uncharacterized protein; n=1;
           Trypanosoma brucei|Rep: Putative uncharacterized protein
           - Trypanosoma brucei
          Length = 423

 Score = 75.8 bits (178), Expect = 1e-12
 Identities = 41/108 (37%), Positives = 63/108 (58%), Gaps = 2/108 (1%)
 Frame = +2

Query: 404 KSVMVIDLDETLVHSSFKPINNAH-FVVPVEIDGAVHQVYVLKRPHVDEFLRRCGELY*C 580
           K  +++DLDETLVHSS    +  H  V+ V ++     VYV  RP + EFL+    L+  
Sbjct: 236 KITLILDLDETLVHSSLTSQSRHHDLVLDVRMENTSTTVYVAFRPFMREFLQAVAPLFEV 295

Query: 581 VLFTASLAKYADPVADLLDRWGVFRA-RLFRDSCVFHRGNYVKDLNSL 721
           ++FTAS++ Y + + D +D   +  + RL+R+ C    G YVKDL+ L
Sbjct: 296 IIFTASVSVYCNQLMDAIDTDNILGSLRLYREHCSILNGAYVKDLSLL 343


>UniRef50_Q750M6 Cluster: AGL070Wp; n=1; Eremothecium gossypii|Rep:
           AGL070Wp - Ashbya gossypii (Yeast) (Eremothecium
           gossypii)
          Length = 343

 Score = 75.4 bits (177), Expect = 1e-12
 Identities = 49/114 (42%), Positives = 66/114 (57%), Gaps = 10/114 (8%)
 Frame = +2

Query: 404 KSVMVIDLDETLVHS---SFKPINNA--HFV-VPVEIDGAVHQVYVLKRPHVDEFLRRCG 565
           K ++V+DLDETL+HS   S   ++N+  H V V     G     YV KRP+ D FL R  
Sbjct: 160 KKLLVLDLDETLIHSMSRSTSSVSNSQGHMVEVTFAASGVSTLYYVHKRPYCDLFLSRVS 219

Query: 566 ELY*CVLFTASLAKYADPVADLLDRWGV---FRARLFRDSCVFHRG-NYVKDLN 715
           + Y  V+FTAS+ +YADPV D L+  G+   F  R +R  C+   G  YVKDL+
Sbjct: 220 KWYDLVIFTASMKEYADPVIDWLES-GISVRFSQRRYRSDCLLRDGVGYVKDLS 272


>UniRef50_A1CQG6 Cluster: NIF domain protein; n=9;
           Eurotiomycetidae|Rep: NIF domain protein - Aspergillus
           clavatus
          Length = 533

 Score = 75.4 bits (177), Expect = 1e-12
 Identities = 49/126 (38%), Positives = 72/126 (57%), Gaps = 20/126 (15%)
 Frame = +2

Query: 404 KSVMVIDLDETLVHSSFKP--INNAHFV-----VPVEID----------GAVHQV--YVL 526
           +  +V+DLDETL+HS  K   +++ H V      P+             G  H +  YV 
Sbjct: 319 QKTLVLDLDETLIHSLAKGGRMSSGHMVEVKLATPMTTTLAPGAAPTTLGPQHPILYYVH 378

Query: 527 KRPHVDEFLRRCGELY*CVLFTASLAKYADPVADLLDR-WGVFRARLFRDSCVFHRGNYV 703
           KRP+ D+FLR+  + Y  V+FTAS+ +YADPV D L++    F+AR +R  C F  G Y+
Sbjct: 379 KRPNCDDFLRKICKWYKLVVFTASVQEYADPVIDWLEQERKYFQARYYRQHCTFRNGAYI 438

Query: 704 KDLNSL 721
           KDL+S+
Sbjct: 439 KDLSSV 444


>UniRef50_A7AN33 Cluster: Dullard-like phosphatase domain containing
           protein; n=1; Babesia bovis|Rep: Dullard-like
           phosphatase domain containing protein - Babesia bovis
          Length = 278

 Score = 74.9 bits (176), Expect = 2e-12
 Identities = 40/104 (38%), Positives = 57/104 (54%)
 Frame = +2

Query: 404 KSVMVIDLDETLVHSSFKPINNAHFVVPVEIDGAVHQVYVLKRPHVDEFLRRCGELY*CV 583
           K  +V+DLDETL+HSS         +V +  D  +  V V  RP   EF+     ++  V
Sbjct: 91  KKTLVLDLDETLIHSSTFRTGKHQTLVEIVGDTGISLVSVSLRPFAREFIAAATRMFEVV 150

Query: 584 LFTASLAKYADPVADLLDRWGVFRARLFRDSCVFHRGNYVKDLN 715
           +FTA+  KYA+P+ DLLD      ARLFR+ C     + +KDL+
Sbjct: 151 IFTAAGCKYANPIIDLLDCERRIHARLFREHCTTFNQHIIKDLS 194


>UniRef50_UPI000023CDF5 Cluster: hypothetical protein FG10302.1;
           n=1; Gibberella zeae PH-1|Rep: hypothetical protein
           FG10302.1 - Gibberella zeae PH-1
          Length = 475

 Score = 74.5 bits (175), Expect = 2e-12
 Identities = 48/122 (39%), Positives = 69/122 (56%), Gaps = 16/122 (13%)
 Frame = +2

Query: 404 KSVMVIDLDETLVHSSFKP--INNAHFV------VPVEIDGAV-----HQV--YVLKRPH 538
           +  +++DLDETL+HS  K   ++  H V        V + G       H +  +V KRP+
Sbjct: 298 QKTLILDLDETLIHSMSKGGRMSTGHMVEVRLNTTYVGVGGQTSIGPQHPILYWVNKRPY 357

Query: 539 VDEFLRRCGELY*CVLFTASLAKYADPVADLLD-RWGVFRARLFRDSCVFHRGNYVKDLN 715
            DEFLRR  + Y  V+FTAS+ +YADPV D L+     F AR +R  C F +G ++KDL 
Sbjct: 358 CDEFLRRVCKWYNLVVFTASVQEYADPVIDWLETERKFFSARYYRQHCTFRQGAFIKDLA 417

Query: 716 SL 721
           S+
Sbjct: 418 SV 419


>UniRef50_Q5KIG7 Cluster: Nuclear envelope-endoplasmic reticulum
           network protein, putative; n=1; Filobasidiella
           neoformans|Rep: Nuclear envelope-endoplasmic reticulum
           network protein, putative - Cryptococcus neoformans
           (Filobasidiella neoformans)
          Length = 1305

 Score = 74.5 bits (175), Expect = 2e-12
 Identities = 51/150 (34%), Positives = 76/150 (50%), Gaps = 27/150 (18%)
 Frame = +2

Query: 344 SCLNMPPDLCYRQ*DTRTCIKSVMVIDLDETLVHSSFKPIN------------------- 466
           S    P     RQ  T   ++  +++DLDETL+HS+ +PI+                   
Sbjct: 278 SLFRKPSPRPLRQPTTPFHLQKTLILDLDETLIHSTSRPIHYPGGSSGGGGLLGLSVGGV 337

Query: 467 ------NAHFVVPVEIDGAVHQVYVLKRPHVDEFLRRCGELY*CVLFTASLAKYADPVAD 628
                 N    V V ++G     +V KRP+VD FL++    Y  V+FTAS+ +YADPV D
Sbjct: 338 FGSGRANEGHTVEVVVNGRSTMYHVYKRPYVDHFLKKVASWYTLVIFTASMPEYADPVID 397

Query: 629 LLDRW-GVFRARLFRDSC-VFHRGNYVKDL 712
            LD    +F  +L+R++C V   G+Y+KDL
Sbjct: 398 WLDGGRNLFARKLYRENCHVQPNGSYIKDL 427


>UniRef50_A2FKQ9 Cluster: NLI interacting factor-like phosphatase
           family protein; n=1; Trichomonas vaginalis G3|Rep: NLI
           interacting factor-like phosphatase family protein -
           Trichomonas vaginalis G3
          Length = 244

 Score = 74.1 bits (174), Expect = 3e-12
 Identities = 38/106 (35%), Positives = 66/106 (62%), Gaps = 3/106 (2%)
 Frame = +2

Query: 413 MVIDLDETLVHSSFKPINNAHFVVPVEID-GAVHQVYVLKRPHVDEFLRRCGELY*CVLF 589
           +++DLD TL+++S +  ++  F V +  D G++  +Y+ KRPH+D FL +   +    +F
Sbjct: 74  LILDLDNTLIYTSVEANSSYDFTVTIPDDSGSMVTLYITKRPHLDAFLAKISNITQPYIF 133

Query: 590 TASLAKYADPVADLLDRWG-VFRARLFRDSCVFHRGN-YVKDLNSL 721
           T+S  +YAD +   LD  G +F  + FRDSC   + N YVKD++++
Sbjct: 134 TSSSEEYADQIISFLDPLGKIFVHKFFRDSCRLVKPNVYVKDISTV 179


>UniRef50_UPI00006CA416 Cluster: NLI interacting factor-like
           phosphatase family protein; n=1; Tetrahymena thermophila
           SB210|Rep: NLI interacting factor-like phosphatase
           family protein - Tetrahymena thermophila SB210
          Length = 623

 Score = 73.7 bits (173), Expect = 4e-12
 Identities = 39/105 (37%), Positives = 61/105 (58%), Gaps = 2/105 (1%)
 Frame = +2

Query: 404 KSVMVIDLDETLVHSSFKPINNAHFVVPVEIDGA-VHQVYVLKRPHVDEFLRRCGELY*C 580
           K  +++DLDETL+H +    N++ F++ ++ D   V Q  +  RP   +FL     LY  
Sbjct: 433 KKTLILDLDETLIHCNESLDNSSDFILDIQADSKEVVQAGINVRPFAKQFLEEMSHLYEI 492

Query: 581 VLFTASLAKYADPVADLLDRWGVF-RARLFRDSCVFHRGNYVKDL 712
           V+FTAS + YA+ V + LD    F   RLFR++C++    Y+KDL
Sbjct: 493 VIFTASRSVYANEVINKLDPQNKFIFKRLFRENCIYKNRIYIKDL 537


>UniRef50_A0DXS4 Cluster: Chromosome undetermined scaffold_69, whole
           genome shotgun sequence; n=2; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_69,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 476

 Score = 73.3 bits (172), Expect = 5e-12
 Identities = 41/109 (37%), Positives = 63/109 (57%), Gaps = 2/109 (1%)
 Frame = +2

Query: 401 IKSVMVIDLDETLVHSSFKPINNAHFVVPVEIDGAVHQVYVLKRPHVDEFLRRCGELY*C 580
           I+  ++IDLDETLVH +      + F +PV  +  ++QV +  RP+  +FLR   + Y  
Sbjct: 281 IQKTLIIDLDETLVHCNEFSCLKSDFFIPVIFNEQIYQVGISIRPYAQQFLRNMAKDYEI 340

Query: 581 VLFTASLAKYADPVADLLD-RWGVFRARLFRDSCVFHRGN-YVKDLNSL 721
           ++FTAS   YA+ + D LD +  +   RLFRD C+    N ++KDL  L
Sbjct: 341 MVFTASNPDYANKIIDYLDPQHKLVSYRLFRDDCIQISNNCHIKDLRIL 389


>UniRef50_A0CQU0 Cluster: Chromosome undetermined scaffold_24, whole
           genome shotgun sequence; n=3; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_24,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 489

 Score = 73.3 bits (172), Expect = 5e-12
 Identities = 39/108 (36%), Positives = 65/108 (60%), Gaps = 5/108 (4%)
 Frame = +2

Query: 404 KSVMVIDLDETLVHSSFKPINNAHFVVPVEI-DGAVHQVYVLKRPHVDEFLRRCGELY*C 580
           +  +V+DLDETL+H + +      F +P+++ +G VH+  +  RP+  +FL  C + +  
Sbjct: 297 QKTLVLDLDETLMHCNEQQQMKFDFKIPIQMPNGQVHEAGISVRPYAQQFLSECSKHFEI 356

Query: 581 VLFTASLAKYADPVADLLD---RWGVFRARLFRDSCV-FHRGNYVKDL 712
           ++FTAS   YAD + D LD   +W     RL+R++C+   +G YVKDL
Sbjct: 357 IIFTASHQLYADKIIDKLDPSRKW--VSHRLYRENCIQTQQGIYVKDL 402


>UniRef50_O59718 Cluster: NLI interacting factor family; n=1;
           Schizosaccharomyces pombe|Rep: NLI interacting factor
           family - Schizosaccharomyces pombe (Fission yeast)
          Length = 476

 Score = 72.5 bits (170), Expect = 9e-12
 Identities = 40/108 (37%), Positives = 62/108 (57%), Gaps = 4/108 (3%)
 Frame = +2

Query: 404 KSVMVIDLDETLVHS-SFKPINNAHFVVPVEIDGAVHQV--YVLKRPHVDEFLRRCGELY 574
           +  +V+DLDETL+HS S      +   + V + G  H +  Y+ KRPH+D FL    + +
Sbjct: 303 RKTLVLDLDETLIHSVSRGSRTTSGQPIEVHVPGE-HPILYYIHKRPHLDYFLSNVSQWF 361

Query: 575 *CVLFTASLAKYADPVADLLDR-WGVFRARLFRDSCVFHRGNYVKDLN 715
             +LFTAS+  YADP+ D L+R   +F  R +R  C     ++VKD++
Sbjct: 362 RLILFTASVQPYADPIIDYLERDKKIFAKRYYRQHCALVDSSFVKDIS 409


>UniRef50_Q0UTG3 Cluster: Putative uncharacterized protein; n=1;
           Phaeosphaeria nodorum|Rep: Putative uncharacterized
           protein - Phaeosphaeria nodorum (Septoria nodorum)
          Length = 447

 Score = 72.1 bits (169), Expect = 1e-11
 Identities = 46/117 (39%), Positives = 65/117 (55%), Gaps = 14/117 (11%)
 Frame = +2

Query: 404 KSVMVIDLDETLVHSSFKPIN-NAHFVVPVEID---GAVHQV---------YVLKRPHVD 544
           +  ++IDLDETL+HS  K        +V V++    GA  Q+         YV KRP+ D
Sbjct: 260 QKTLIIDLDETLIHSMSKGGRFQTGRMVEVKLQASVGAGGQIIGPQVPILYYVHKRPYCD 319

Query: 545 EFLRRCGELY*CVLFTASLAKYADPVADLLD-RWGVFRARLFRDSCVFHRGNYVKDL 712
           +FL++  + Y  V+FTAS+ +YADPV D L+     F  R +R  C F  G Y+KDL
Sbjct: 320 DFLKKVSKWYNLVIFTASVQEYADPVIDWLEVERKYFVGRYYRQHCTFRNGAYIKDL 376


>UniRef50_A2E6G6 Cluster: NLI interacting factor-like phosphatase
           family protein; n=2; Trichomonas vaginalis G3|Rep: NLI
           interacting factor-like phosphatase family protein -
           Trichomonas vaginalis G3
          Length = 210

 Score = 71.3 bits (167), Expect = 2e-11
 Identities = 41/103 (39%), Positives = 55/103 (53%)
 Frame = +2

Query: 404 KSVMVIDLDETLVHSSFKPINNAHFVVPVEIDGAVHQVYVLKRPHVDEFLRRCGELY*CV 583
           K  +++DLDETLVHS F   +   + +PV+ +G  + +YV KRP  DEF +    LY   
Sbjct: 40  KITLILDLDETLVHSRFHKPDWYDYEMPVQYNGITYTIYVQKRPGFDEFFKVIEPLYDIY 99

Query: 584 LFTASLAKYADPVADLLDRWGVFRARLFRDSCVFHRGNYVKDL 712
           +FTASL +YA PV   +         L R  C    G  VKDL
Sbjct: 100 IFTASLPEYAVPVVQKVIPTFPASKVLTRYHCQLIDGTLVKDL 142


>UniRef50_Q8SUC7 Cluster: Putative uncharacterized protein
           ECU10_1270; n=1; Encephalitozoon cuniculi|Rep: Putative
           uncharacterized protein ECU10_1270 - Encephalitozoon
           cuniculi
          Length = 226

 Score = 71.3 bits (167), Expect = 2e-11
 Identities = 40/110 (36%), Positives = 58/110 (52%)
 Frame = +2

Query: 392 RTCIKSVMVIDLDETLVHSSFKPINNAHFVVPVEIDGAVHQVYVLKRPHVDEFLRRCGEL 571
           R   K  +V+DLD TLV+S+F+      F V +     +  +YV  RP+  EF+     L
Sbjct: 44  RHSTKPTLVLDLDNTLVYSTFRMPKLYDFCVEIPRSRNI-LIYVKARPYAAEFISAAEAL 102

Query: 572 Y*CVLFTASLAKYADPVADLLDRWGVFRARLFRDSCVFHRGNYVKDLNSL 721
           Y  V+FT++  +YA  V D +D        L+R+SC F  G YVKDL  +
Sbjct: 103 YEVVIFTSAKREYAKKVVDRIDTNKNISRILYRESCTFTNGRYVKDLRKV 152


>UniRef50_P38757 Cluster: Nuclear envelope morphology protein 1;
           n=2; Saccharomyces cerevisiae|Rep: Nuclear envelope
           morphology protein 1 - Saccharomyces cerevisiae (Baker's
           yeast)
          Length = 446

 Score = 71.3 bits (167), Expect = 2e-11
 Identities = 43/113 (38%), Positives = 63/113 (55%), Gaps = 9/113 (7%)
 Frame = +2

Query: 404 KSVMVIDLDETLVHSSFKPINNA-----HFV-VPVEIDGAVHQVYVLKRPHVDEFLRRCG 565
           K  +VIDLDETL+HS+ +   ++     H V V   + G     ++ KRP+ D FL +  
Sbjct: 251 KKKLVIDLDETLIHSASRSTTHSNSSQGHLVEVKFGLSGIRTLYFIHKRPYCDLFLTKVS 310

Query: 566 ELY*CVLFTASLAKYADPVADLLDRW--GVFRARLFRDSCVFHRG-NYVKDLN 715
           + Y  ++FTAS+ +YADPV D L+      F  R +R  CV   G  Y+KDL+
Sbjct: 311 KWYDLIIFTASMKEYADPVIDWLESSFPSSFSKRYYRSDCVLRDGVGYIKDLS 363


>UniRef50_A2FJD8 Cluster: NLI interacting factor-like phosphatase
           family protein; n=1; Trichomonas vaginalis G3|Rep: NLI
           interacting factor-like phosphatase family protein -
           Trichomonas vaginalis G3
          Length = 223

 Score = 70.1 bits (164), Expect = 5e-11
 Identities = 37/108 (34%), Positives = 65/108 (60%), Gaps = 1/108 (0%)
 Frame = +2

Query: 395 TCIKSVMVIDLDETLVHSSFKPINNAHFVVPVEIDGAVHQVYVLKRPHVDEFLRRCGELY 574
           T  + ++ +DLDETLV +SF+  +   F V + +    + V+VLKRP VDEFL+   +L+
Sbjct: 36  TDFRKILALDLDETLVLTSFEESSPYDFRVDISLGNTTYPVFVLKRPGVDEFLQESLDLF 95

Query: 575 *CVLFTASLAKYADP-VADLLDRWGVFRARLFRDSCVFHRGNYVKDLN 715
              ++T+S+ +YA   V +L+  +   +  L R+ C +  GN++K L+
Sbjct: 96  NVYIYTSSVIEYATAIVRELIPDFPKSKI-LHREHCKYMNGNFIKQLS 142


>UniRef50_Q6CD87 Cluster: Yarrowia lipolytica chromosome C of strain
           CLIB122 of Yarrowia lipolytica; n=1; Yarrowia
           lipolytica|Rep: Yarrowia lipolytica chromosome C of
           strain CLIB122 of Yarrowia lipolytica - Yarrowia
           lipolytica (Candida lipolytica)
          Length = 465

 Score = 70.1 bits (164), Expect = 5e-11
 Identities = 44/104 (42%), Positives = 60/104 (57%), Gaps = 4/104 (3%)
 Frame = +2

Query: 413 MVIDLDETLVHSSF--KPINNAHFVVPVEIDGAVHQVY-VLKRPHVDEFLRRCGELY*CV 583
           +++DLDETL+HS    KP    H +V V +D     +Y V KRP  D+FL+   + Y  V
Sbjct: 291 LILDLDETLIHSQSRGKPSMMGH-MVEVRLDKRHATLYYVHKRPFCDDFLKLVCKWYNVV 349

Query: 584 LFTASLAKYADPVADLLDR-WGVFRARLFRDSCVFHRGNYVKDL 712
           +FTAS+ +YADPV D L++    F  R +R  C      YVKDL
Sbjct: 350 VFTASVQEYADPVIDWLEQEQRFFSKRYYRQHCTKVGNGYVKDL 393


>UniRef50_UPI00006CCC91 Cluster: NLI interacting factor-like
           phosphatase family protein; n=1; Tetrahymena thermophila
           SB210|Rep: NLI interacting factor-like phosphatase
           family protein - Tetrahymena thermophila SB210
          Length = 1131

 Score = 68.9 bits (161), Expect = 1e-10
 Identities = 38/105 (36%), Positives = 57/105 (54%), Gaps = 1/105 (0%)
 Frame = +2

Query: 401 IKSVMVIDLDETLVHSSFKPINNAHFVVPVEIDGAVHQVYVLKRPHVDEFLRRCGELY*C 580
           +K  +++DLDETL+HSS            ++      + +V  RP+V  FLR     Y  
Sbjct: 168 MKKTLILDLDETLIHSSQMKPKKYDLNFNIQTSTTKEEFFVKFRPNVSNFLRIMANYYEV 227

Query: 581 VLFTASLAKYADPVADLLDRWGVFRA-RLFRDSCVFHRGNYVKDL 712
            ++TAS+ +YAD + + LD  G F + RL+RDSC      Y+KDL
Sbjct: 228 FIWTASIKEYADVIINQLDPSGSFISYRLYRDSCRKKGDYYIKDL 272


>UniRef50_A0DXE4 Cluster: Chromosome undetermined scaffold_68, whole
           genome shotgun sequence; n=4; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_68,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 282

 Score = 68.1 bits (159), Expect = 2e-10
 Identities = 38/105 (36%), Positives = 55/105 (52%), Gaps = 2/105 (1%)
 Frame = +2

Query: 404 KSVMVIDLDETLVHSSFKPINNAHFVVPVEI--DGAVHQVYVLKRPHVDEFLRRCGELY* 577
           K V+V+DLDETLVH  FK   N    V +E+   G ++ VY+  RP++++FL+   + Y 
Sbjct: 34  KKVLVLDLDETLVHCEFKENENFQHEVLLEVIHKGQLYTVYLKARPYLNQFLQEASKDYE 93

Query: 578 CVLFTASLAKYADPVADLLDRWGVFRARLFRDSCVFHRGNYVKDL 712
             +FTA    Y   V   +D+  +      R SC F  G   KDL
Sbjct: 94  IFIFTAGYEAYCQEVLSFIDKKKIISDYYARGSCQFIDGICYKDL 138


>UniRef50_Q23QU2 Cluster: NLI interacting factor-like phosphatase
           family protein; n=1; Tetrahymena thermophila SB210|Rep:
           NLI interacting factor-like phosphatase family protein -
           Tetrahymena thermophila SB210
          Length = 379

 Score = 67.7 bits (158), Expect = 3e-10
 Identities = 32/103 (31%), Positives = 56/103 (54%)
 Frame = +2

Query: 413 MVIDLDETLVHSSFKPINNAHFVVPVEIDGAVHQVYVLKRPHVDEFLRRCGELY*CVLFT 592
           +V+DLDETL+H + K +N+   ++ V+        Y+ +R ++ EFL +C   +   ++T
Sbjct: 212 LVLDLDETLIHCNEKSLNDDSSIITVQFQNQQKNYYLHQRGYLQEFLEQCALNFNIYIYT 271

Query: 593 ASLAKYADPVADLLDRWGVFRARLFRDSCVFHRGNYVKDLNSL 721
           AS   YA+ V  ++D   V +    R SC +    Y+K L +L
Sbjct: 272 ASTRDYAEEVVKIIDPRSVIKKVYDRSSCFYDGKQYLKSLKTL 314


>UniRef50_A0BQ25 Cluster: Chromosome undetermined scaffold_12, whole
           genome shotgun sequence; n=1; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_12,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 520

 Score = 66.9 bits (156), Expect = 5e-10
 Identities = 40/106 (37%), Positives = 58/106 (54%), Gaps = 3/106 (2%)
 Frame = +2

Query: 413 MVIDLDETLVHSSFKPINNAHFVVPVEIDGA-VHQVYVLKRPHVDEFLRRCGELY*CVLF 589
           ++ DLDETL+H +   +N     V V+I      QV    RP+  E L+   + Y  +LF
Sbjct: 332 IIFDLDETLIHCNDINLNQTDHEVTVQIPNEPAQQVRFNIRPYCIEMLQSLSQFYELILF 391

Query: 590 TASLAKYADPVADLLD-RWGVFRARLFRDSCV-FHRGNYVKDLNSL 721
           TAS  +YAD + + +D +  +F  RL+RD+CV    G  VKDL  L
Sbjct: 392 TASFQQYADKILEFIDPKKNIFSYRLYRDNCVTLGDGLLVKDLRVL 437


>UniRef50_Q241B6 Cluster: NLI interacting factor-like phosphatase
            family protein; n=1; Tetrahymena thermophila SB210|Rep:
            NLI interacting factor-like phosphatase family protein -
            Tetrahymena thermophila SB210
          Length = 1393

 Score = 65.7 bits (153), Expect = 1e-09
 Identities = 39/106 (36%), Positives = 59/106 (55%), Gaps = 3/106 (2%)
 Frame = +2

Query: 404  KSVMVIDLDETLVHSSFKPINNAHFVVPVEID-GAVHQVYVLKRPHVDEFLRRCGELY*C 580
            K  +V DLDETL+H +      +  ++P+    G V +  +  RP+  E L+   + Y  
Sbjct: 1197 KKTLVFDLDETLIHCNENANIPSDVILPIRFPTGEVIEAGINVRPYCMEILQELSKFYEI 1256

Query: 581  VLFTASLAKYADPVADLLDRWGVF-RARLFRDSCV-FHRGNYVKDL 712
            ++FTAS + YA+ V D LD  G +   RLFR++CV    G Y+KDL
Sbjct: 1257 IVFTASHSCYANVVLDYLDPKGQYITGRLFRENCVTTEEGVYIKDL 1302


>UniRef50_A2FHG5 Cluster: NLI interacting factor-like phosphatase
           family protein; n=1; Trichomonas vaginalis G3|Rep: NLI
           interacting factor-like phosphatase family protein -
           Trichomonas vaginalis G3
          Length = 207

 Score = 65.3 bits (152), Expect = 1e-09
 Identities = 46/106 (43%), Positives = 54/106 (50%)
 Frame = +2

Query: 404 KSVMVIDLDETLVHSSFKPINNAHFVVPVEIDGAVHQVYVLKRPHVDEFLRRCGELY*CV 583
           K  + IDLDETLV S   P     F  PV I     + YV  RP   EFL +  E+Y   
Sbjct: 31  KPCIAIDLDETLVFSYQLPPKTECF--PVRIGR--RRAYVTVRPGAIEFLDKIKEMYEIF 86

Query: 584 LFTASLAKYADPVADLLDRWGVFRARLFRDSCVFHRGNYVKDLNSL 721
           +FTAS   YAD V D +  +     RLFRDSC    G +VKDL  L
Sbjct: 87  IFTASEKPYADKVIDAIAPYIDQEHRLFRDSCQCADGYHVKDLRIL 132


>UniRef50_A0E0T6 Cluster: Chromosome undetermined scaffold_72, whole
           genome shotgun sequence; n=2; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_72,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 707

 Score = 65.3 bits (152), Expect = 1e-09
 Identities = 38/103 (36%), Positives = 59/103 (57%)
 Frame = +2

Query: 413 MVIDLDETLVHSSFKPINNAHFVVPVEIDGAVHQVYVLKRPHVDEFLRRCGELY*CVLFT 592
           +V+DLDETLVH  ++ +N   + +     G       L RP  +EFL    + Y   +FT
Sbjct: 528 LVLDLDETLVH--YQEVNQ--YTIKKFPKGGGQ---FLVRPFAEEFLDSLSKYYEIFIFT 580

Query: 593 ASLAKYADPVADLLDRWGVFRARLFRDSCVFHRGNYVKDLNSL 721
           A+L  YA+ + D++D+ GV + RL+RD  +F    Y+KDL+ L
Sbjct: 581 AALPDYANFIIDIIDKKGVVKQRLYRDKTIFKDQVYIKDLSIL 623


>UniRef50_Q8I3U9 Cluster: Nif-like protein, putative; n=6;
           Plasmodium|Rep: Nif-like protein, putative - Plasmodium
           falciparum (isolate 3D7)
          Length = 328

 Score = 64.1 bits (149), Expect = 3e-09
 Identities = 34/111 (30%), Positives = 59/111 (53%), Gaps = 1/111 (0%)
 Frame = +2

Query: 392 RTCIKSVMVIDLDETLVHSSFKPINNAHFVVPVEIDGAVHQVYVLKRPHVDEFLRRCGEL 571
           R C    +V+DLDETL++ + K   +    V V I+G    +YV KRP++D F       
Sbjct: 53  RICPTMTLVLDLDETLIYCTKKRKYHYQKEVDVLINGKYLPLYVCKRPYIDLFFSSLYPF 112

Query: 572 Y*CVLFTASLAKYADPVADLLDRWGVFRARLFRDSCV-FHRGNYVKDLNSL 721
           Y  ++FT ++  YAD V +++D       + +R+ C   +   Y+K+L ++
Sbjct: 113 YEIIIFTTAIKSYADTVLNIIDVDHYIDKKFYREDCYEMNEKLYIKNLTNI 163


>UniRef50_UPI0000F2111E Cluster: PREDICTED: hypothetical protein;
           n=2; Danio rerio|Rep: PREDICTED: hypothetical protein -
           Danio rerio
          Length = 173

 Score = 63.3 bits (147), Expect = 6e-09
 Identities = 28/37 (75%), Positives = 32/37 (86%)
 Frame = +2

Query: 404 KSVMVIDLDETLVHSSFKPINNAHFVVPVEIDGAVHQ 514
           K  +VIDLDETLVHSSFKPI+NA F+VPVEI+G  HQ
Sbjct: 88  KICVVIDLDETLVHSSFKPISNADFIVPVEIEGTTHQ 124


>UniRef50_A0BXV8 Cluster: Chromosome undetermined scaffold_135,
           whole genome shotgun sequence; n=1; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_135,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 715

 Score = 63.3 bits (147), Expect = 6e-09
 Identities = 39/103 (37%), Positives = 55/103 (53%)
 Frame = +2

Query: 413 MVIDLDETLVHSSFKPINNAHFVVPVEIDGAVHQVYVLKRPHVDEFLRRCGELY*CVLFT 592
           +V+DLDETLVH    P     F+V               RP  +EFL    + Y  V+FT
Sbjct: 503 LVLDLDETLVHYQEFPKGGGQFLV---------------RPFAEEFLEALSKYYDIVIFT 547

Query: 593 ASLAKYADPVADLLDRWGVFRARLFRDSCVFHRGNYVKDLNSL 721
           A+L  YA+ + D++D+  V + RL+RD  VF    Y+KDL+ L
Sbjct: 548 AALPDYANFIIDIIDKNEVVQQRLYRDQTVFKDEVYIKDLSIL 590


>UniRef50_Q7QQZ2 Cluster: GLP_442_14601_13606; n=1; Giardia lamblia
           ATCC 50803|Rep: GLP_442_14601_13606 - Giardia lamblia
           ATCC 50803
          Length = 331

 Score = 62.5 bits (145), Expect = 1e-08
 Identities = 41/129 (31%), Positives = 68/129 (52%), Gaps = 8/129 (6%)
 Frame = +2

Query: 353 NMPPDLCYR-Q*DTRTCIKSVMVIDLDETLVHSSFKPINNAH---FVVPVEIDGAVHQVY 520
           ++PP   Y  Q    +  ++++ +DLDETLV S  +         F V VE  G  ++  
Sbjct: 135 DLPPQFAYFFQFSHLSATRNLLCLDLDETLVCSKQRTPQTRETEDFYVVVEQRGKRYEFS 194

Query: 521 VLKRPHVDEFLRRCGELY*CVLFTASLAKYADPVADLLDRWGVFRARLFRDSCVFH---- 688
           V+KRP +D FL    ELY   +FT ++ +Y D + +++D   + + R++R  CV +    
Sbjct: 195 VIKRPGLDVFLVSLAELYDLAIFTYAIKEYGDKIVNIIDPNRLIKYRMYRQHCVKYLVDK 254

Query: 689 RGNYVKDLN 715
           R   VKDL+
Sbjct: 255 RHVIVKDLS 263


>UniRef50_A6SCV2 Cluster: Putative uncharacterized protein; n=2;
           Sclerotiniaceae|Rep: Putative uncharacterized protein -
           Botryotinia fuckeliana B05.10
          Length = 523

 Score = 62.5 bits (145), Expect = 1e-08
 Identities = 39/90 (43%), Positives = 55/90 (61%), Gaps = 11/90 (12%)
 Frame = +2

Query: 404 KSVMVIDLDETLVHS-SFKPINNAHFVVPVEID--------GAVHQV--YVLKRPHVDEF 550
           +  +++DLDETL+HS ++    +A  +V V+I         G  H +  YV KRP+ DEF
Sbjct: 316 QKTLILDLDETLIHSMNYGGRMSAGHMVEVQITNLMGAGGAGPQHPILYYVNKRPYCDEF 375

Query: 551 LRRCGELY*CVLFTASLAKYADPVADLLDR 640
           LRR  + Y  V+FTASL  YADPV D L++
Sbjct: 376 LRRVCKWYNLVVFTASLQDYADPVIDWLEQ 405


>UniRef50_Q9VZS0 Cluster: CG12078-PA; n=1; Drosophila
           melanogaster|Rep: CG12078-PA - Drosophila melanogaster
           (Fruit fly)
          Length = 253

 Score = 61.7 bits (143), Expect = 2e-08
 Identities = 40/113 (35%), Positives = 60/113 (53%), Gaps = 10/113 (8%)
 Frame = +2

Query: 404 KSVMVIDLDETLVHSSF-----KPINN---AH-FVVPVEIDGAVHQVYVLKRPHVDEFLR 556
           +  +V+D+D T++ S F     KP N    AH F   +   GA   +YV KRP++D FL 
Sbjct: 70  RKTLVLDMDNTMITSWFIKRGKKPKNIPRIAHDFKFYLPAYGAT--IYVYKRPYLDHFLD 127

Query: 557 RCGELY*CVLFTASLAKYADPVADLLDRW-GVFRARLFRDSCVFHRGNYVKDL 712
           R  + Y   +FT+    YA P+ D LDR  G+  +RL+R  C+   G + K +
Sbjct: 128 RVSKWYDLTVFTSGAEIYASPILDFLDRGRGILNSRLYRQHCIEQFGKWSKSV 180


>UniRef50_A0E7V4 Cluster: Chromosome undetermined scaffold_81, whole
           genome shotgun sequence; n=5; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_81,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 499

 Score = 61.7 bits (143), Expect = 2e-08
 Identities = 36/106 (33%), Positives = 57/106 (53%), Gaps = 3/106 (2%)
 Frame = +2

Query: 404 KSVMVIDLDETLVHSSFKPINNAHFVVPVEI-DGAVHQVYVLKRPHVDEFLRRCGELY*C 580
           K  +V DLDETL+H +         ++P++   G + +  +  RP+  + L+   + +  
Sbjct: 303 KKTIVFDLDETLIHCNESVQIPGDVILPIKFPSGEIIEASINIRPYAQQVLQTLNKHFEI 362

Query: 581 VLFTASLAKYADPVADLLD-RWGVFRARLFRDSCV-FHRGNYVKDL 712
           ++FTAS + YA+ V D LD    +   R FRDSCV    G Y+KDL
Sbjct: 363 IVFTASHSCYANVVIDYLDPNKNIISHRFFRDSCVQTEEGAYIKDL 408


>UniRef50_A2EX88 Cluster: NLI interacting factor-like phosphatase
           family protein; n=2; Trichomonas vaginalis G3|Rep: NLI
           interacting factor-like phosphatase family protein -
           Trichomonas vaginalis G3
          Length = 218

 Score = 61.3 bits (142), Expect = 2e-08
 Identities = 40/107 (37%), Positives = 55/107 (51%)
 Frame = +2

Query: 395 TCIKSVMVIDLDETLVHSSFKPINNAHFVVPVEIDGAVHQVYVLKRPHVDEFLRRCGELY 574
           T  +  +V+DLDETLVH+S  P ++   V  ++ D      YV  RP+V +FL R  EL+
Sbjct: 38  TDTRKALVLDLDETLVHTSTFPPHSD--VEALKFDDT--NEYVFLRPNVKKFLERVSELF 93

Query: 575 *CVLFTASLAKYADPVADLLDRWGVFRARLFRDSCVFHRGNYVKDLN 715
              +FTA    YA+ + D          R +RDSC F      KDLN
Sbjct: 94  EVFIFTAGTQIYAERILDSFCPQIDQMHRFYRDSCKFSGNKCKKDLN 140


>UniRef50_A2FWF7 Cluster: NLI interacting factor-like phosphatase
           family protein; n=1; Trichomonas vaginalis G3|Rep: NLI
           interacting factor-like phosphatase family protein -
           Trichomonas vaginalis G3
          Length = 244

 Score = 60.9 bits (141), Expect = 3e-08
 Identities = 37/104 (35%), Positives = 60/104 (57%), Gaps = 3/104 (2%)
 Frame = +2

Query: 413 MVIDLDETLVHSSFKPINNAHFVVPV-EIDGAVHQVYVLKRPHVDEFLRRCGELY*CVLF 589
           +V+DLD TL+ SS +P ++  F + V + +G +  VYV KRP +D FL +  ++    LF
Sbjct: 74  VVLDLDNTLICSSKEPSSSFDFNIAVPDGNGDIETVYVTKRPRLDGFLTKLCQISTPYLF 133

Query: 590 TASLAKYADPVADLLDRWG-VFRARLFRDSC-VFHRGNYVKDLN 715
           ++    Y D V   +D  G +F    +R+SC +   G Y+KDL+
Sbjct: 134 SSGDKVYVDQVMSFIDPLGQIFSKVFYRESCKLATPGVYIKDLS 177


>UniRef50_Q5AMI9 Cluster: Putative uncharacterized protein NEM1;
           n=1; Candida albicans|Rep: Putative uncharacterized
           protein NEM1 - Candida albicans (Yeast)
          Length = 500

 Score = 60.9 bits (141), Expect = 3e-08
 Identities = 31/85 (36%), Positives = 51/85 (60%), Gaps = 7/85 (8%)
 Frame = +2

Query: 404 KSVMVIDLDETLVHS-------SFKPINNAHFVVPVEIDGAVHQVYVLKRPHVDEFLRRC 562
           K ++++DLDETL+HS       SF P   A  ++ ++++      YV KRP+ D FL+  
Sbjct: 290 KKILILDLDETLIHSLSRGSPRSFNPAT-ASKMIEIKLNSISSLYYVYKRPYCDYFLQET 348

Query: 563 GELY*CVLFTASLAKYADPVADLLD 637
            + +   +FTAS+ +YADP+ D L+
Sbjct: 349 SQWFELQIFTASVKEYADPIIDWLE 373


>UniRef50_A0CPA8 Cluster: Chromosome undetermined scaffold_23, whole
           genome shotgun sequence; n=1; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_23,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 506

 Score = 60.5 bits (140), Expect = 4e-08
 Identities = 35/103 (33%), Positives = 54/103 (52%), Gaps = 3/103 (2%)
 Frame = +2

Query: 413 MVIDLDETLVHSSFKPINNAHFVVPVEIDGAVH-QVYVLKRPHVDEFLRRCGELY*CVLF 589
           +V DLDETL+H +    N+      + I      ++    RPH  + L+   + Y  +LF
Sbjct: 313 LVFDLDETLIHCNDINNNSTDHTTVIHIPNEPETEIRFNIRPHCQQMLKALSQYYELILF 372

Query: 590 TASLAKYADPVADLLDRWG-VFRARLFRDSCV-FHRGNYVKDL 712
           TAS  +YAD + + +D  G +F  R +R+SC+    G  VKDL
Sbjct: 373 TASYKEYADKILEYIDPKGNLFSYRFYRESCLELEEGLLVKDL 415


>UniRef50_A0BT20 Cluster: Chromosome undetermined scaffold_126,
           whole genome shotgun sequence; n=2; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_126,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 473

 Score = 60.5 bits (140), Expect = 4e-08
 Identities = 36/112 (32%), Positives = 63/112 (56%), Gaps = 2/112 (1%)
 Frame = +2

Query: 392 RTCIKSVMVIDLDETLVHSSFKPINNAHFVVPVEIDGAVHQVYVLKRPHVDEFLRRCGEL 571
           +T  +  +VIDLDETLVH +   +      + + ++     V V+ RP+  +FL+   + 
Sbjct: 277 QTTRQKTLVIDLDETLVHCNESCLMPKDLEININLNNGFI-VKVIVRPYTQQFLQNMSKH 335

Query: 572 Y*CVLFTASLAKYADPVADLLD-RWGVFRARLFRDSCV-FHRGNYVKDLNSL 721
           +  +++TAS   YA+ + D LD    + + RL+R+ C+   +G +VKDL SL
Sbjct: 336 FEIMIYTASNEDYANQIIDYLDPTKQLVKYRLYRNDCINLSKGCHVKDLRSL 387


>UniRef50_Q5S7T2 Cluster: Putative nuclear LIM
           interactor-interacting protein; n=2; Phytophthora|Rep:
           Putative nuclear LIM interactor-interacting protein -
           Phytophthora sojae
          Length = 237

 Score = 60.1 bits (139), Expect = 5e-08
 Identities = 42/116 (36%), Positives = 58/116 (50%), Gaps = 15/116 (12%)
 Frame = +2

Query: 413 MVIDLDETLVHSSF-----------KPINNAHFVVPVEI---DGAVHQVYVLKRPHVDEF 550
           +V+D+DE LVHS F           +P     +    EI   DG   +  V KRP +D F
Sbjct: 43  LVLDMDECLVHSKFQNEVEYRQSEYRPEQLEEYGDSFEIVMDDG--ERAVVNKRPGLDRF 100

Query: 551 LRRCGELY*CVLFTASLAKYADPVADLLDRWG-VFRARLFRDSCVFHRGNYVKDLN 715
           L    + Y   +FTA L  Y  P+ D LD  G +F  R FR+SC   +G ++KDL+
Sbjct: 101 LEEAAKHYDVYVFTAGLEAYGKPILDALDPKGNLFAGRFFRESCQQRKGMFLKDLS 156


>UniRef50_Q01C48 Cluster: TFIIF-interacting CTD phosphatase,
           including NLI-interacting factor; n=2; Ostreococcus|Rep:
           TFIIF-interacting CTD phosphatase, including
           NLI-interacting factor - Ostreococcus tauri
          Length = 329

 Score = 59.7 bits (138), Expect = 7e-08
 Identities = 36/107 (33%), Positives = 53/107 (49%)
 Frame = +2

Query: 401 IKSVMVIDLDETLVHSSFKPINNAHFVVPVEIDGAVHQVYVLKRPHVDEFLRRCGELY*C 580
           I   +V+DLD+TL++S++K                     V KRP VD FL    + Y  
Sbjct: 118 IPHTLVLDLDDTLINSNWKRERGWR---------------VFKRPGVDGFLAHMAQFYEM 162

Query: 581 VLFTASLAKYADPVADLLDRWGVFRARLFRDSCVFHRGNYVKDLNSL 721
           V+FT  L  Y DP+ + LD       RL+R+S  +  G Y++DL+ L
Sbjct: 163 VIFTDQLMTYGDPIIERLDPTRYVTHRLYRESAQYKNGEYIRDLSKL 209


>UniRef50_Q7JY68 Cluster: AT02326p; n=2; Sophophora|Rep: AT02326p -
           Drosophila melanogaster (Fruit fly)
          Length = 293

 Score = 59.7 bits (138), Expect = 7e-08
 Identities = 45/119 (37%), Positives = 60/119 (50%), Gaps = 16/119 (13%)
 Frame = +2

Query: 404 KSVMVIDLDETLVHSSF-KPINNAH-------------FVVPVEIDGAVHQVY-VLKRPH 538
           +  +V+DLDETLVHS +  P  + +             +V+ + IDG    V+ V KRPH
Sbjct: 95  RKTLVLDLDETLVHSCYLDPDTHDNVGCSQLPEHAQPDYVLNISIDGMEPIVFRVFKRPH 154

Query: 539 VDEFLRRCGELY*CVLFTASLAKYADPVADLLDRW-GVFRARLFRDSCVFHRGNYVKDL 712
           VDEFL    + Y  V++TASL  YA  V D LD   G+   R +R  C        KDL
Sbjct: 155 VDEFLDFVSKWYDLVIYTASLEVYAAQVVDHLDAGRGLITRRFYRQHCRASSPMVSKDL 213


>UniRef50_A0DHN8 Cluster: Chromosome undetermined scaffold_50, whole
           genome shotgun sequence; n=1; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_50,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 460

 Score = 59.7 bits (138), Expect = 7e-08
 Identities = 37/106 (34%), Positives = 57/106 (53%), Gaps = 3/106 (2%)
 Frame = +2

Query: 413 MVIDLDETLVHSSFKPINNAHFVVPVEIDGAVH-QVYVLKRPHVDEFLRRCGELY*CVLF 589
           ++ DLDETL+H + +       ++ V ++     Q  +  RP+  E LR+  E +  ++F
Sbjct: 262 LIFDLDETLIHCNERDHKLYDAILTVNLNKTQQVQAKINVRPNAVEILRKLSENFELIVF 321

Query: 590 TASLAKYADPVADLLD-RWGVFRARLFRDSCVFHRGN-YVKDLNSL 721
           TAS   YA  V D LD    +F  RL+R+SC+   G  +VKDL  L
Sbjct: 322 TASNKIYAKSVIDYLDPNKDIFAHRLYRESCILTSGGIHVKDLRIL 367


>UniRef50_A0DBP6 Cluster: Chromosome undetermined scaffold_44, whole
           genome shotgun sequence; n=1; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_44,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 672

 Score = 59.3 bits (137), Expect = 9e-08
 Identities = 35/103 (33%), Positives = 55/103 (53%)
 Frame = +2

Query: 413 MVIDLDETLVHSSFKPINNAHFVVPVEIDGAVHQVYVLKRPHVDEFLRRCGELY*CVLFT 592
           +V+DLDETLVH    P     F+V               RP+ +EFL +  + Y  V+FT
Sbjct: 499 LVLDLDETLVHYQELPNGGGQFLV---------------RPYAEEFLEKLSKYYELVIFT 543

Query: 593 ASLAKYADPVADLLDRWGVFRARLFRDSCVFHRGNYVKDLNSL 721
           A+   YA+ + D++D+  V  +RL+R+   +    Y+KDL+ L
Sbjct: 544 AAQPDYANFIIDIIDKQKVVTSRLYREHTCYKDNIYLKDLSIL 586


>UniRef50_A0D7B8 Cluster: Chromosome undetermined scaffold_4, whole
           genome shotgun sequence; n=1; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_4,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 582

 Score = 59.3 bits (137), Expect = 9e-08
 Identities = 37/104 (35%), Positives = 59/104 (56%), Gaps = 4/104 (3%)
 Frame = +2

Query: 413 MVIDLDETLVHSSFKPINNAHFVVPVEI--DGAVHQVYVLKRPHVDEFLRRCGELY*CVL 586
           +V DLDETL+H +    +    VV +++  +G V +  +  RP+  + L+     +  +L
Sbjct: 386 LVFDLDETLIHCNDNNNDPTDHVVQIQLPNEGTV-EARINIRPYCQQMLKLLSSHFELML 444

Query: 587 FTASLAKYADPVADLLD-RWGVFRARLFRDSCV-FHRGNYVKDL 712
           FTAS   YAD V +L+D    +F+ R +RDSC+    G +VKDL
Sbjct: 445 FTASYQYYADKVLELIDPDRTLFQYRFYRDSCIEVEEGLFVKDL 488


>UniRef50_Q3LDS8 Cluster: Hypothetical 50.6 kDa protein in
           RPL14B-GPA1 intergenic region; n=1; Nyctotherus
           ovalis|Rep: Hypothetical 50.6 kDa protein in RPL14B-GPA1
           intergenic region - Nyctotherus ovalis
          Length = 220

 Score = 58.8 bits (136), Expect = 1e-07
 Identities = 41/115 (35%), Positives = 64/115 (55%), Gaps = 9/115 (7%)
 Frame = +2

Query: 404 KSVMVIDLDETLVHS-SFKPINNAHFV------VPVEIDGAVHQVYVLKRPHVDEFLRRC 562
           K  +V+DLDETL+ + S KP+  +  +      VP+++     Q+YV  RP++ EFL   
Sbjct: 41  KKTLVLDLDETLIFATSKKPLVYSTIITYHSRGVPIKVRFGYRQLYVQFRPYLKEFLEDM 100

Query: 563 GELY*CVLFTASLAKYADPVADLLDRWGVFRA-RLFRDSCVFHRGNYV-KDLNSL 721
            E Y  V++T++   YAD V D ++    F A RL++  C+   G Y+ KDL  L
Sbjct: 101 RERYELVVYTSADQGYADVVIDCIESEQQFFAHRLYQAQCLRKEGLYLFKDLEIL 155


>UniRef50_Q6CMP7 Cluster: Kluyveromyces lactis strain NRRL Y-1140
           chromosome E of strain NRRL Y- 1140 of Kluyveromyces
           lactis; n=1; Kluyveromyces lactis|Rep: Kluyveromyces
           lactis strain NRRL Y-1140 chromosome E of strain NRRL Y-
           1140 of Kluyveromyces lactis - Kluyveromyces lactis
           (Yeast) (Candida sphaerica)
          Length = 374

 Score = 58.8 bits (136), Expect = 1e-07
 Identities = 41/124 (33%), Positives = 63/124 (50%), Gaps = 18/124 (14%)
 Frame = +2

Query: 404 KSVMVIDLDETLVHS--SFKPINNAHFVVPVEIDGAVHQVYV-------------LKRPH 538
           + ++V+DLDETL+HS  + + + N     P      +H V V              KRP+
Sbjct: 175 RKLLVLDLDETLIHSMSNSRSLGNPTDKNPSGTTPMIHLVEVRFPQTNISTLYNVAKRPY 234

Query: 539 VDEFLRRCGELY*CVLFTASLAKYADPVADLLDRW--GVFRARLFRDSCVFHRG-NYVKD 709
            D FL++  + Y   +FTAS+ +YADPV D L +     F  R +R+ C    G  YVKD
Sbjct: 235 CDMFLQQTSQWYDIAIFTASMKEYADPVIDWLQQTCSVQFHYRWYREDCTLRPGVGYVKD 294

Query: 710 LNSL 721
           + ++
Sbjct: 295 IGTV 298


>UniRef50_A0DJD2 Cluster: Chromosome undetermined scaffold_53, whole
           genome shotgun sequence; n=4; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_53,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 591

 Score = 58.4 bits (135), Expect = 2e-07
 Identities = 37/105 (35%), Positives = 54/105 (51%), Gaps = 2/105 (1%)
 Frame = +2

Query: 413 MVIDLDETLVHSSFKPINNAHFVVPVEI-DGAVHQVYVLKRPHVDEFLRRCGELY*CVLF 589
           +V DLDETL+H +      +   +P+    G   Q  +  RP   + L +  E+   V+F
Sbjct: 402 VVFDLDETLIHCNEDQKMKSEVYLPITFPSGDTVQAGINIRPWAKQILNQLSEVCEVVVF 461

Query: 590 TASLAKYADPVADLLDRWGVFRARLFRDSC-VFHRGNYVKDLNSL 721
           TAS   YA  V   LD   +  A+LFR+SC V + G ++KDL  L
Sbjct: 462 TASHQCYASQVIQFLDHKKILTAQLFRESCIVTNDGVHIKDLRVL 506


>UniRef50_UPI00004985D1 Cluster: nuclear LIM interactor-interacting
           factor 3; n=1; Entamoeba histolytica HM-1:IMSS|Rep:
           nuclear LIM interactor-interacting factor 3 - Entamoeba
           histolytica HM-1:IMSS
          Length = 226

 Score = 57.6 bits (133), Expect = 3e-07
 Identities = 36/107 (33%), Positives = 55/107 (51%), Gaps = 1/107 (0%)
 Frame = +2

Query: 404 KSVMVIDLDETLVHSSFKPINNAHFVVPVEIDGAVHQVYVLKRPHVDEFLRRCGELY*CV 583
           K  +V DLDETL+H+     N +  ++ +E  G   Q +V  RP   E L+     Y  +
Sbjct: 60  KLTIVFDLDETLIHTHVTSQNLSDDLITIEFQGK--QYFVSVRPGARELLKSLAGKYELI 117

Query: 584 LFTASLAKYADPVADLLDRWG-VFRARLFRDSCVFHRGNYVKDLNSL 721
           LFTAS   YA  + + L+R G +F  +L+  +C    G   KD++ L
Sbjct: 118 LFTASTEGYATQIINNLERDGQIFDYKLYCHNCKEKFGQLFKDVHKL 164


>UniRef50_UPI00006CB6E4 Cluster: NLI interacting factor-like
           phosphatase family protein; n=1; Tetrahymena thermophila
           SB210|Rep: NLI interacting factor-like phosphatase
           family protein - Tetrahymena thermophila SB210
          Length = 553

 Score = 57.2 bits (132), Expect = 4e-07
 Identities = 36/108 (33%), Positives = 56/108 (51%), Gaps = 2/108 (1%)
 Frame = +2

Query: 404 KSVMVIDLDETLVHSSFKPINNAHFVVPVEI-DGAVHQVYVLKRPHVDEFLRRCGELY*C 580
           K  +V+DLDETL+ SS     +A   + V + +G    V+V  RP V  FL    ELY  
Sbjct: 127 KKTLVLDLDETLITSSVLEFKSADLKIKVNLPNGRGKNVWVKFRPGVQNFLNEMNELYEL 186

Query: 581 VLFTASLAKYADPVADLLDRWGVFRARLFRDSC-VFHRGNYVKDLNSL 721
           ++FT+S+ +       + +   +   R+FR++C +   GN  KDL  L
Sbjct: 187 IIFTSSIKEVI--FVFIANCESLVNVRIFRENCSIDSNGNLYKDLCKL 232


>UniRef50_Q23DG5 Cluster: NLI interacting factor-like phosphatase
            family protein; n=1; Tetrahymena thermophila SB210|Rep:
            NLI interacting factor-like phosphatase family protein -
            Tetrahymena thermophila SB210
          Length = 1363

 Score = 57.2 bits (132), Expect = 4e-07
 Identities = 37/106 (34%), Positives = 53/106 (50%)
 Frame = +2

Query: 404  KSVMVIDLDETLVHSSFKPINNAHFVVPVEIDGAVHQVYVLKRPHVDEFLRRCGELY*CV 583
            K  +V+DLDETLVH    P     F++               RPH + FL++  E Y  V
Sbjct: 1183 KYTLVLDLDETLVHYQEIPEEGGQFLI---------------RPHAEIFLQKLSEYYEIV 1227

Query: 584  LFTASLAKYADPVADLLDRWGVFRARLFRDSCVFHRGNYVKDLNSL 721
            +FTA+L  YAD + D+LD   V   RL+R     +   + KD++ L
Sbjct: 1228 IFTAALKDYADFILDVLDTTFVISHRLYRQHTDRNGRCFAKDISKL 1273


>UniRef50_A5E3L7 Cluster: Putative uncharacterized protein; n=1;
           Lodderomyces elongisporus NRRL YB-4239|Rep: Putative
           uncharacterized protein - Lodderomyces elongisporus
           (Yeast) (Saccharomyces elongisporus)
          Length = 575

 Score = 57.2 bits (132), Expect = 4e-07
 Identities = 30/85 (35%), Positives = 49/85 (57%), Gaps = 7/85 (8%)
 Frame = +2

Query: 404 KSVMVIDLDETLVHS-------SFKPINNAHFVVPVEIDGAVHQVYVLKRPHVDEFLRRC 562
           K ++++DLDETL+HS       SF    +   ++ + I+      YV KRP+ D FLR  
Sbjct: 362 KKILILDLDETLIHSLSRGSPRSFHSSGSHCKMIEIRINNMSSLYYVHKRPYCDYFLREI 421

Query: 563 GELY*CVLFTASLAKYADPVADLLD 637
            + +   +FTAS+ +YADP+ + L+
Sbjct: 422 SKWFELQIFTASVKEYADPIINWLE 446


>UniRef50_A7ATL2 Cluster: NLI interacting factor-like phosphatase
           family protein; n=1; Babesia bovis|Rep: NLI interacting
           factor-like phosphatase family protein - Babesia bovis
          Length = 299

 Score = 56.8 bits (131), Expect = 5e-07
 Identities = 34/105 (32%), Positives = 54/105 (51%), Gaps = 2/105 (1%)
 Frame = +2

Query: 413 MVIDLDETLVHSSFKPINNAHFVVPVEIDGAVHQVYVLKRPHVDEFLRRCGELY*CVLFT 592
           +V+DLD+T++HS     NN    V + +        V KRPH+D FL    + Y  VL++
Sbjct: 59  LVLDLDDTILHSVSTRGNNETSSVALTVGNRTLNFVVYKRPHLDTFLMEMRKYYEIVLYS 118

Query: 593 ASLAKYADP-VADLLDRWGVFRARLFRDSCVFH-RGNYVKDLNSL 721
            S  +Y D  ++D      + R +L+R  C     G Y+KDL+ +
Sbjct: 119 TSRRRYVDACLSDACVNHLIDR-KLYRSDCFLDANGTYIKDLSKV 162


>UniRef50_A2DRH4 Cluster: NLI interacting factor-like phosphatase
           family protein; n=1; Trichomonas vaginalis G3|Rep: NLI
           interacting factor-like phosphatase family protein -
           Trichomonas vaginalis G3
          Length = 188

 Score = 56.4 bits (130), Expect = 7e-07
 Identities = 34/103 (33%), Positives = 52/103 (50%)
 Frame = +2

Query: 413 MVIDLDETLVHSSFKPINNAHFVVPVEIDGAVHQVYVLKRPHVDEFLRRCGELY*CVLFT 592
           +VIDLD TL+ S+  P     F    E D    + +V  RP   EFL +  + Y    FT
Sbjct: 15  LVIDLDNTLIFSTELPTRQHEF----ECDVGRKKYFVHVRPGTYEFLEKISKYYEIFFFT 70

Query: 593 ASLAKYADPVADLLDRWGVFRARLFRDSCVFHRGNYVKDLNSL 721
            S  +Y++ +   +  +      L+RDSC+F +G  +KDLN +
Sbjct: 71  VSRREYSESIIRHIAPYVKKENCLYRDSCLFAQGYAIKDLNKI 113


>UniRef50_Q22U86 Cluster: NLI interacting factor-like phosphatase
            family protein; n=1; Tetrahymena thermophila SB210|Rep:
            NLI interacting factor-like phosphatase family protein -
            Tetrahymena thermophila SB210
          Length = 937

 Score = 56.0 bits (129), Expect = 9e-07
 Identities = 35/106 (33%), Positives = 54/106 (50%), Gaps = 3/106 (2%)
 Frame = +2

Query: 404  KSVMVIDLDETLVHSSFKPINNAHFVVPVEID-GAVHQVYVLKRPHVDEFLRRCGELY*C 580
            K  ++ D+DETL+H +      +  +V V    G   Q  +  RP+  E L+   E +  
Sbjct: 742  KKTLIFDMDETLIHCNESASTPSDVIVDVRFPTGEFIQAGINIRPYAIEILQELSEEFEI 801

Query: 581  VLFTASLAKYADPVADLLDRWGVF-RARLFRDSCV-FHRGNYVKDL 712
            V+FTAS + YA  V + LD    +   R +RD C+   +G Y+KDL
Sbjct: 802  VIFTASHSCYAQAVIEYLDPHRKYVHHRFYRDQCIQTPQGVYIKDL 847


>UniRef50_Q22RH8 Cluster: NLI interacting factor-like phosphatase
            family protein; n=1; Tetrahymena thermophila SB210|Rep:
            NLI interacting factor-like phosphatase family protein -
            Tetrahymena thermophila SB210
          Length = 1930

 Score = 56.0 bits (129), Expect = 9e-07
 Identities = 35/103 (33%), Positives = 56/103 (54%)
 Frame = +2

Query: 413  MVIDLDETLVHSSFKPINNAHFVVPVEIDGAVHQVYVLKRPHVDEFLRRCGELY*CVLFT 592
            +VIDLDETLVH  ++ ++          DG       L RP+ + FL    E Y  ++FT
Sbjct: 1747 LVIDLDETLVH--YQELD----------DGG----QFLVRPYAETFLEEMSEYYEIIIFT 1790

Query: 593  ASLAKYADPVADLLDRWGVFRARLFRDSCVFHRGNYVKDLNSL 721
            A+L  YAD + D++D       +L+R   V ++ +Y+KDL+ +
Sbjct: 1791 AALQDYADFILDIIDSKKSISYKLYRQHTVTYQNSYIKDLSRI 1833


>UniRef50_A0EHC1 Cluster: Chromosome undetermined scaffold_97, whole
           genome shotgun sequence; n=6; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_97,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 563

 Score = 56.0 bits (129), Expect = 9e-07
 Identities = 36/106 (33%), Positives = 53/106 (50%)
 Frame = +2

Query: 404 KSVMVIDLDETLVHSSFKPINNAHFVVPVEIDGAVHQVYVLKRPHVDEFLRRCGELY*CV 583
           K  +VIDLDETLVH   + +++  F+V               RP+  +FL+   + Y  V
Sbjct: 388 KYTLVIDLDETLVHYQ-ELVDDGQFLV---------------RPYAQQFLKEMSKYYEIV 431

Query: 584 LFTASLAKYADPVADLLDRWGVFRARLFRDSCVFHRGNYVKDLNSL 721
           +FTA+   YAD + DL+D   V   RL+R         YVKD+  +
Sbjct: 432 IFTAAQQDYADFILDLIDEDKVIGYRLYRQHTTLVNNTYVKDIQKI 477


>UniRef50_Q22YQ1 Cluster: NLI interacting factor-like phosphatase
            family protein; n=1; Tetrahymena thermophila SB210|Rep:
            NLI interacting factor-like phosphatase family protein -
            Tetrahymena thermophila SB210
          Length = 1037

 Score = 55.2 bits (127), Expect = 2e-06
 Identities = 35/106 (33%), Positives = 53/106 (50%), Gaps = 3/106 (2%)
 Frame = +2

Query: 404  KSVMVIDLDETLVHSSFKPINNAHFVVPVEI-DGAVHQVYVLKRPHVDEFLRRCGELY*C 580
            K  ++ DLDETL+H +      +  V+ +    G +    +  RP+  E L+   + +  
Sbjct: 790  KKTIIFDLDETLIHCNENASIPSDVVLSIRFPQGEILDAGINIRPNAVEMLKELSQDFEI 849

Query: 581  VLFTASLAKYADPVADLLD-RWGVFRARLFRDSCVF-HRGNYVKDL 712
            V+FTAS + YA  V D LD        R FRD C+   +G Y+KDL
Sbjct: 850  VVFTASHSSYAKAVLDHLDPHKRYIHHRFFRDQCIMTPQGVYIKDL 895


>UniRef50_A3GGD6 Cluster: Nuclear Envelope Morphology; n=3;
           Saccharomycetaceae|Rep: Nuclear Envelope Morphology -
           Pichia stipitis (Yeast)
          Length = 401

 Score = 55.2 bits (127), Expect = 2e-06
 Identities = 29/86 (33%), Positives = 51/86 (59%), Gaps = 8/86 (9%)
 Frame = +2

Query: 404 KSVMVIDLDETLVHS-------SFKPINN-AHFVVPVEIDGAVHQVYVLKRPHVDEFLRR 559
           +  +++DLDETL+HS       SF   ++ A  ++ ++++      YV KRP+ D FL+ 
Sbjct: 195 RKTLILDLDETLIHSLSRGSPRSFNTSSSSAPKMIEIKLNNIASLYYVHKRPYCDYFLKE 254

Query: 560 CGELY*CVLFTASLAKYADPVADLLD 637
             + +   +FTAS+ +YADP+ D L+
Sbjct: 255 ISKWFELQIFTASVKEYADPIIDWLE 280


>UniRef50_Q7RSX6 Cluster: NLI interacting factor, putative; n=2;
           Plasmodium (Vinckeia)|Rep: NLI interacting factor,
           putative - Plasmodium yoelii yoelii
          Length = 815

 Score = 54.8 bits (126), Expect = 2e-06
 Identities = 28/55 (50%), Positives = 35/55 (63%)
 Frame = +2

Query: 515 VYVLKRPHVDEFLRRCGELY*CVLFTASLAKYADPVADLLDRWGVFRARLFRDSC 679
           +YV KRP VD F +   + Y  V+FTAS+ KYA+ V D LD   V   RLFR+SC
Sbjct: 748 IYVNKRPGVDYFFQEISKYYEIVIFTASMPKYANAVIDKLDVNRVCSYRLFRESC 802


>UniRef50_A0DDM7 Cluster: Chromosome undetermined scaffold_47, whole
           genome shotgun sequence; n=3; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_47,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 417

 Score = 54.8 bits (126), Expect = 2e-06
 Identities = 33/103 (32%), Positives = 52/103 (50%), Gaps = 3/103 (2%)
 Frame = +2

Query: 413 MVIDLDETLVHSSFKPINNAHFVVPVEID-GAVHQVYVLKRPHVDEFLRRCGELY*CVLF 589
           +  DLDETLVH +  P      ++ + +    V +  +  RP+  E LR   + +  ++F
Sbjct: 219 LFFDLDETLVHCNENPSIPCDVILDINVSKNQVVKAGINIRPYAKELLRNLSKSFEIIIF 278

Query: 590 TASLAKYADPVADLLD-RWGVFRARLFRDSCVFHRGN-YVKDL 712
           TAS   YA+ V + LD    +   RL+R+SC     + Y KDL
Sbjct: 279 TASHNCYAEKVCNFLDPEQNIISHRLYRESCTLTNNSLYTKDL 321


>UniRef50_A0BWL2 Cluster: Chromosome undetermined scaffold_132,
           whole genome shotgun sequence; n=4; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_132,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 571

 Score = 54.8 bits (126), Expect = 2e-06
 Identities = 38/108 (35%), Positives = 54/108 (50%), Gaps = 5/108 (4%)
 Frame = +2

Query: 413 MVIDLDETLVHSSFKPINNAHFVVPVEID-GAVHQVYVLKRPHVDEFLRRCGELY*CVLF 589
           +V DLDETL+H +         V+P+    G   Q  +  RP   + L+     +  ++F
Sbjct: 377 VVFDLDETLIHCNESVAVPGDVVLPITFPTGETIQASINIRPFAQQILQTLSRHFEIIVF 436

Query: 590 TASLAKYADPVADLLD---RWGVFRARLFRDSCV-FHRGNYVKDLNSL 721
           TAS + YA+ V D LD   +W     RLFRD C+    G Y+KDL  L
Sbjct: 437 TASHSCYANVVLDYLDPKKQW--ISHRLFRDHCLQSEDGAYIKDLRVL 482


>UniRef50_Q5CP88 Cluster: ENSANGP00000011443; n=2;
           Cryptosporidium|Rep: ENSANGP00000011443 -
           Cryptosporidium hominis
          Length = 392

 Score = 54.4 bits (125), Expect = 3e-06
 Identities = 32/101 (31%), Positives = 55/101 (54%), Gaps = 1/101 (0%)
 Frame = +2

Query: 413 MVIDLDETLVHSSFKPINNAHFVVPVEIDGAVHQVYVLKRPHVDEFLRRCGELY*CVLFT 592
           +V+D+DETLVH + + +      + V+I       +V  RP +  FL+   +L    +FT
Sbjct: 207 IVLDMDETLVHCTNEMLKGVKPDLLVKIATYSTPWFVYYRPFLKFFLQNASKLGSICVFT 266

Query: 593 ASLAKYADPVADLLD-RWGVFRARLFRDSCVFHRGNYVKDL 712
           AS  +YA+ V + +D    + + +LFR+ C  +   Y+KDL
Sbjct: 267 ASTREYAEQVINSIDPTQDLIKYKLFREHCTVYNKGYMKDL 307


>UniRef50_Q22R94 Cluster: NLI interacting factor-like phosphatase
            family protein; n=1; Tetrahymena thermophila SB210|Rep:
            NLI interacting factor-like phosphatase family protein -
            Tetrahymena thermophila SB210
          Length = 1313

 Score = 54.0 bits (124), Expect = 4e-06
 Identities = 35/103 (33%), Positives = 52/103 (50%)
 Frame = +2

Query: 413  MVIDLDETLVHSSFKPINNAHFVVPVEIDGAVHQVYVLKRPHVDEFLRRCGELY*CVLFT 592
            +V+DLDETL+H +    N   FVV               RP+V  FL +  E Y  V+FT
Sbjct: 1141 LVLDLDETLIHYTEAYNNVKQFVV---------------RPYVQTFLHQISEFYEIVVFT 1185

Query: 593  ASLAKYADPVADLLDRWGVFRARLFRDSCVFHRGNYVKDLNSL 721
            A +  YA+ V D  D  G  + RL+R   +  +  ++KDL+ +
Sbjct: 1186 AGMPDYANWVIDNFDTKGFIKHRLYRQHTLQIQNTFIKDLSRI 1228


>UniRef50_Q23JH8 Cluster: NLI interacting factor-like phosphatase
            family protein; n=1; Tetrahymena thermophila SB210|Rep:
            NLI interacting factor-like phosphatase family protein -
            Tetrahymena thermophila SB210
          Length = 1190

 Score = 53.6 bits (123), Expect = 5e-06
 Identities = 34/103 (33%), Positives = 51/103 (49%)
 Frame = +2

Query: 413  MVIDLDETLVHSSFKPINNAHFVVPVEIDGAVHQVYVLKRPHVDEFLRRCGELY*CVLFT 592
            +V+DLDETL+H    P+   HF               L RP ++ FL+   ++Y  V+FT
Sbjct: 1022 LVLDLDETLIHFVDTPVGG-HF---------------LMRPFLEMFLKEMSKIYEIVIFT 1065

Query: 593  ASLAKYADPVADLLDRWGVFRARLFRDSCVFHRGNYVKDLNSL 721
              +  YA+ V D  D+      RL+R      + NY+KDL+ L
Sbjct: 1066 VGMENYANWVIDSFDKNKYISHRLYRQHAFSKQYNYIKDLSKL 1108


>UniRef50_A0DAV8 Cluster: Chromosome undetermined scaffold_43, whole
           genome shotgun sequence; n=1; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_43,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 639

 Score = 53.6 bits (123), Expect = 5e-06
 Identities = 26/67 (38%), Positives = 44/67 (65%), Gaps = 1/67 (1%)
 Frame = +2

Query: 524 LKRPHVDEFLRRCGELY*CVLFTASLAKYADPVADLLDRWGVFRARLFRDSCVFHRGN-Y 700
           L RP+ +EFL +  + Y  V+FTA+   YA+ + D++D+  + +ARL+R+   F + N Y
Sbjct: 524 LVRPYTEEFLEKLSKYYEIVIFTAAQPDYANFIIDIIDKQQIVKARLYREH-TFQKDNVY 582

Query: 701 VKDLNSL 721
           +KDL+ L
Sbjct: 583 IKDLSIL 589


>UniRef50_A0DXP2 Cluster: Chromosome undetermined scaffold_69, whole
           genome shotgun sequence; n=4; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_69,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 572

 Score = 53.2 bits (122), Expect = 6e-06
 Identities = 35/108 (32%), Positives = 57/108 (52%), Gaps = 5/108 (4%)
 Frame = +2

Query: 413 MVIDLDETLVHSSFKPINNAHFVVPVEI-DGAVHQVYVLKRPHVDEFLRRCGELY*CVLF 589
           +V DLDETL+H +         ++P+   +    Q  +  RP+  + L+   + +  ++F
Sbjct: 380 IVFDLDETLIHCNPNVSIPGDIILPITFPNDETVQASINIRPYAKQILQTLSKHFEIIVF 439

Query: 590 TASLAKYADPVADLLD---RWGVFRARLFRDSCV-FHRGNYVKDLNSL 721
           TAS + YA+ V D LD   +W     RLFR++C+    G Y+KDL  L
Sbjct: 440 TASHSSYANIVIDYLDPKRQW--ISHRLFRENCLQTTEGAYIKDLRVL 485


>UniRef50_A0CAF1 Cluster: Chromosome undetermined scaffold_161,
           whole genome shotgun sequence; n=4; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_161,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 485

 Score = 53.2 bits (122), Expect = 6e-06
 Identities = 37/109 (33%), Positives = 52/109 (47%), Gaps = 3/109 (2%)
 Frame = +2

Query: 404 KSVMVIDLDETLVHSSFKPINNAHFVVPVEI-DGAVHQVYVLKRPHVDEFLRRCGELY*C 580
           K  +V DLDETL+H +      A   +P+    G   Q  +  RP     L+   +L   
Sbjct: 294 KKTVVFDLDETLIHCNENQNLKADIYLPITFPSGDTAQAGINIRPFAKWILQELSQLCEV 353

Query: 581 VLFTASLAKYADPVADLLDRWG-VFRARLFRDSCVFH-RGNYVKDLNSL 721
           ++FTAS   YA  V   LD    + + +LFRD CV    G ++KDL  L
Sbjct: 354 IVFTASHQCYASQVIKYLDPHSTLLQGQLFRDRCVLSPDGVHIKDLRVL 402


>UniRef50_A0BIM9 Cluster: Chromosome undetermined scaffold_11, whole
           genome shotgun sequence; n=2; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_11,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 419

 Score = 53.2 bits (122), Expect = 6e-06
 Identities = 33/107 (30%), Positives = 55/107 (51%), Gaps = 3/107 (2%)
 Frame = +2

Query: 401 IKSVMVIDLDETLVHSSFKPINNAHFVVPVEID-GAVHQVYVLKRPHVDEFLRRCGELY* 577
           +K  ++ DLDETLVH +      +  V+P+    G      +  RP  ++ ++    +  
Sbjct: 224 VKKTVIFDLDETLVHCNEDESMPSQIVLPITFPTGEKVNAGINIRPFAEKMIQLLSNVCE 283

Query: 578 CVLFTASLAKYADPVADLLDRWGVFRARLFRDSCVFHRGN--YVKDL 712
            ++FTAS   YA+ V + LD     + R+FRDSCV    +  Y+K+L
Sbjct: 284 VMIFTASHECYANEVINHLDPQTRVKRRIFRDSCVTDENSIYYIKNL 330


>UniRef50_Q4WI16 Cluster: Import inner membrane translocase subunit
           tim50, mitochondrial precursor; n=12;
           Pezizomycotina|Rep: Import inner membrane translocase
           subunit tim50, mitochondrial precursor - Aspergillus
           fumigatus (Sartorya fumigata)
          Length = 501

 Score = 53.2 bits (122), Expect = 6e-06
 Identities = 29/71 (40%), Positives = 40/71 (56%)
 Frame = +2

Query: 509 HQVYVLKRPHVDEFLRRCGELY*CVLFTASLAKYADPVADLLDRWGVFRARLFRDSCVFH 688
           H   + KRP VD FLR   + Y  VLFT+  +  AD V   LD + + R  LFR++  + 
Sbjct: 242 HGWRIAKRPGVDYFLRYLNQYYELVLFTSVPSMMADQVLRKLDPYRIIRWPLFREATRYK 301

Query: 689 RGNYVKDLNSL 721
            G Y+KDL+ L
Sbjct: 302 DGEYIKDLSYL 312


>UniRef50_A0DNV3 Cluster: Chromosome undetermined scaffold_58, whole
           genome shotgun sequence; n=2; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_58,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 428

 Score = 52.8 bits (121), Expect = 8e-06
 Identities = 30/105 (28%), Positives = 55/105 (52%), Gaps = 2/105 (1%)
 Frame = +2

Query: 413 MVIDLDETLVHSSFKPINNAHFVVPVEI-DGAVHQVYVLKRPHVDEFLRRCGELY*CVLF 589
           ++ D+DETL+H +    +   F + ++  DG + +  +  R    E +++  +L   ++F
Sbjct: 240 IIFDMDETLIHCNEDENDKCQFKIDIQFEDGEIIEAGINIRNFAREIIQKLSDLCEVMIF 299

Query: 590 TASLAKYADPVADLLDRWGVFRARLFRDSCV-FHRGNYVKDLNSL 721
           TAS   YA+ V ++LD       R+FR+SC+     N +K L  L
Sbjct: 300 TASQDVYANKVINILDPNNKLSYRIFRESCISVGDNNLIKHLGVL 344


>UniRef50_A0DB36 Cluster: Chromosome undetermined scaffold_44, whole
           genome shotgun sequence; n=3; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_44,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 511

 Score = 52.4 bits (120), Expect = 1e-05
 Identities = 31/107 (28%), Positives = 54/107 (50%), Gaps = 4/107 (3%)
 Frame = +2

Query: 404 KSVMVIDLDETLVHSSFKPINNAHFVVPVEIDGAVHQVYVLKRPHVDEFLRRCGELY*CV 583
           K  ++ DLDETLVH +         ++ +  +G   +  +  RP+    L+     +  +
Sbjct: 311 KKTLLFDLDETLVHCNSNSFIPGDVLLNINHEGEKMEASLNIRPYTSHLLQTLSRNFELI 370

Query: 584 LFTASLAKYADPVADLLD---RWGVFRARLFRDSCV-FHRGNYVKDL 712
           +FTAS + YA+ V D LD   +W     R +R+ C+    G+++KDL
Sbjct: 371 VFTASQSHYANAVIDYLDPQKKW--ISHRFYREHCIPTDDGHFIKDL 415


>UniRef50_Q9W0S3 Cluster: Import inner membrane translocase subunit
           TIM50-B, mitochondrial precursor; n=1; Drosophila
           melanogaster|Rep: Import inner membrane translocase
           subunit TIM50-B, mitochondrial precursor - Drosophila
           melanogaster (Fruit fly)
          Length = 409

 Score = 52.4 bits (120), Expect = 1e-05
 Identities = 27/65 (41%), Positives = 38/65 (58%)
 Frame = +2

Query: 527 KRPHVDEFLRRCGELY*CVLFTASLAKYADPVADLLDRWGVFRARLFRDSCVFHRGNYVK 706
           KRP VD FL+ C + +  V++TA       P+ D LD  G    RL RDS  F  G++VK
Sbjct: 235 KRPGVDVFLKECAKYFEIVVYTAEQGVTVFPLVDALDPNGCIMYRLVRDSTHFDGGHHVK 294

Query: 707 DLNSL 721
           +L++L
Sbjct: 295 NLDNL 299


>UniRef50_Q23DN3 Cluster: NLI interacting factor-like phosphatase
            family protein; n=1; Tetrahymena thermophila SB210|Rep:
            NLI interacting factor-like phosphatase family protein -
            Tetrahymena thermophila SB210
          Length = 1722

 Score = 52.0 bits (119), Expect = 1e-05
 Identities = 41/104 (39%), Positives = 55/104 (52%), Gaps = 1/104 (0%)
 Frame = +2

Query: 413  MVIDLDETLVHSSFKPINNAHFVVPVEIDGAVHQVYVLKRPHVDEFLRRCGELY*CVLFT 592
            +V+DLDETLVH S +  N   FVV               RP  ++FL+   E Y  V+FT
Sbjct: 1550 LVLDLDETLVHYS-ETNNGGQFVV---------------RPFANQFLQVLSEYYEIVVFT 1593

Query: 593  ASLAKYADPVADLLDRWGVFRARLFRDSCVFHRGN-YVKDLNSL 721
            A++  YA+ V D LD       RLFR   V H GN ++KDL+ +
Sbjct: 1594 AAMPDYANWVLDNLDPNKYVTYRLFRQHAV-HIGNVFIKDLSRI 1636


>UniRef50_Q22GY6 Cluster: NLI interacting factor-like phosphatase
           family protein; n=2; Oligohymenophorea|Rep: NLI
           interacting factor-like phosphatase family protein -
           Tetrahymena thermophila SB210
          Length = 446

 Score = 52.0 bits (119), Expect = 1e-05
 Identities = 34/104 (32%), Positives = 55/104 (52%), Gaps = 4/104 (3%)
 Frame = +2

Query: 413 MVIDLDETLVHSSFKPINNAHFV-VPVEIDGAV-HQVYVLKRPHVDEFLRRCGELY*CVL 586
           +++DLDETL+HS     N  H +    + D  V +Q+ +  RP+  EFL++  + +   +
Sbjct: 263 LLLDLDETLIHSCSLKENPDHIIKAKADNDDKVGYQIGLRVRPYCLEFLQKLAQYWDIYI 322

Query: 587 FTASLAKYADPVADLLDRWGVF-RARLFRDSCV-FHRGNYVKDL 712
           FTAS   YA  +   LD  G +    L R +C+    G ++KDL
Sbjct: 323 FTASSPTYASAIVKFLDPEGKYINGILNRSNCMETKNGFFIKDL 366


>UniRef50_A4VD36 Cluster: Putative uncharacterized protein; n=1;
           Tetrahymena thermophila SB210|Rep: Putative
           uncharacterized protein - Tetrahymena thermophila SB210
          Length = 410

 Score = 52.0 bits (119), Expect = 1e-05
 Identities = 26/66 (39%), Positives = 37/66 (56%)
 Frame = +2

Query: 524 LKRPHVDEFLRRCGELY*CVLFTASLAKYADPVADLLDRWGVFRARLFRDSCVFHRGNYV 703
           L+RP ++EFL      Y  V+FTA L  YAD +    D+ G+   RL+R  C      ++
Sbjct: 262 LQRPGLNEFLESMYNYYELVIFTAGLKDYADSIIPTFDQKGLISYRLYRQHCNLQGLVHI 321

Query: 704 KDLNSL 721
           KDLN+L
Sbjct: 322 KDLNNL 327


>UniRef50_A0DTY0 Cluster: Chromosome undetermined scaffold_63, whole
           genome shotgun sequence; n=3; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_63,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 396

 Score = 52.0 bits (119), Expect = 1e-05
 Identities = 32/106 (30%), Positives = 53/106 (50%), Gaps = 2/106 (1%)
 Frame = +2

Query: 404 KSVMVIDLDETLVHSSFKPINNAHFVVPVEIDGA-VHQVYVLKRPHVDEFLRRCGELY*C 580
           K  +++DLDETLVH S          + + I  + + QV +  RP +   L      +  
Sbjct: 189 KYTLLLDLDETLVHCSLDVRLPCEKKLNIRISPSEILQVGLTIRPGLQNMLENLQPYFEI 248

Query: 581 VLFTASLAKYADPVADLLDRWGVFRARLFRDSCVF-HRGNYVKDLN 715
           ++FTAS  +YA  + + +D   +  + L R+ C F   G Y+KDL+
Sbjct: 249 IIFTASHVQYAKKIVEFIDPKKIISSVLSREHCCFTSLGQYIKDLS 294


>UniRef50_Q0V6C1 Cluster: Putative uncharacterized protein; n=1;
           Phaeosphaeria nodorum|Rep: Putative uncharacterized
           protein - Phaeosphaeria nodorum (Septoria nodorum)
          Length = 596

 Score = 51.6 bits (118), Expect = 2e-05
 Identities = 27/71 (38%), Positives = 40/71 (56%)
 Frame = +2

Query: 509 HQVYVLKRPHVDEFLRRCGELY*CVLFTASLAKYADPVADLLDRWGVFRARLFRDSCVFH 688
           H   + KRP +D FLR     Y  V+FT+  +  ADP+   LD + +    LFR++  F 
Sbjct: 302 HGYRLAKRPGLDYFLRYLSSQYELVIFTSVKSMDADPIIRKLDPFRLVMWPLFREATRFE 361

Query: 689 RGNYVKDLNSL 721
           +G Y+KDL+ L
Sbjct: 362 KGEYIKDLSYL 372


>UniRef50_UPI0000E496F3 Cluster: PREDICTED: similar to Translocase
           of inner mitochondrial membrane 50 homolog (yeast); n=1;
           Strongylocentrotus purpuratus|Rep: PREDICTED: similar to
           Translocase of inner mitochondrial membrane 50 homolog
           (yeast) - Strongylocentrotus purpuratus
          Length = 307

 Score = 51.2 bits (117), Expect = 2e-05
 Identities = 28/66 (42%), Positives = 41/66 (62%), Gaps = 1/66 (1%)
 Frame = +2

Query: 527 KRPHVDEFLRRCGE-LY*CVLFTASLAKYADPVADLLDRWGVFRARLFRDSCVFHRGNYV 703
           KRP V+ FL++ G  L+  V++T+     A P+ D LD  G    RLFRD+  +  G++V
Sbjct: 125 KRPGVEYFLQQAGPPLFEIVIYTSEQGFTAFPILDSLDPKGCIMYRLFRDATKYVNGHHV 184

Query: 704 KDLNSL 721
           KDL+SL
Sbjct: 185 KDLSSL 190


>UniRef50_A7QHR1 Cluster: Chromosome chr8 scaffold_99, whole genome
           shotgun sequence; n=1; Vitis vinifera|Rep: Chromosome
           chr8 scaffold_99, whole genome shotgun sequence - Vitis
           vinifera (Grape)
          Length = 329

 Score = 51.2 bits (117), Expect = 2e-05
 Identities = 30/73 (41%), Positives = 41/73 (56%), Gaps = 1/73 (1%)
 Frame = +2

Query: 506 VHQVYVLKRPHVDEFLRRCGELY*CVLFTASLAKYADPVADLLDRWGVFRARLFRDSCVF 685
           +  V V +RP + EFL +  E    VLFTA+L  YA P+ D +D    F  RL+R S V 
Sbjct: 174 ISYVTVFERPGLQEFLEQISEFAELVLFTAALEGYARPLVDKIDAGNRFSKRLYRPSTVS 233

Query: 686 HR-GNYVKDLNSL 721
            +   +VKDL+ L
Sbjct: 234 TKYREHVKDLSCL 246


>UniRef50_A7Q3I0 Cluster: Chromosome chr13 scaffold_48, whole genome
           shotgun sequence; n=10; Magnoliophyta|Rep: Chromosome
           chr13 scaffold_48, whole genome shotgun sequence - Vitis
           vinifera (Grape)
          Length = 318

 Score = 51.2 bits (117), Expect = 2e-05
 Identities = 30/73 (41%), Positives = 42/73 (57%), Gaps = 1/73 (1%)
 Frame = +2

Query: 506 VHQVYVLKRPHVDEFLRRCGELY*CVLFTASLAKYADPVADLLDRWGVFRARLFRDSCV- 682
           V+ V V +RP + EFL++  E    VLFTA L  YA P+ D +D   +F  RL+R S + 
Sbjct: 163 VNYVTVFERPGLREFLKQLSEFSELVLFTAGLEGYARPLVDRIDVENLFSLRLYRPSTIS 222

Query: 683 FHRGNYVKDLNSL 721
                +VKDL+ L
Sbjct: 223 TEYREHVKDLSCL 235


>UniRef50_Q22N55 Cluster: NLI interacting factor-like phosphatase
           family protein; n=1; Tetrahymena thermophila SB210|Rep:
           NLI interacting factor-like phosphatase family protein -
           Tetrahymena thermophila SB210
          Length = 475

 Score = 51.2 bits (117), Expect = 2e-05
 Identities = 33/113 (29%), Positives = 59/113 (52%), Gaps = 10/113 (8%)
 Frame = +2

Query: 413 MVIDLDETLVHSS-FKP-----IN---NAHFVVPVEIDGAVHQVYVLK-RPHVDEFLRRC 562
           + +DLDETLV++  +K      +N   N   V  +       Q + LK RP +D FL   
Sbjct: 293 LALDLDETLVYTQPYKQKLKEKVNEQDNPDIVQVIHPSQQSVQFFTLKKRPGLDIFLLEM 352

Query: 563 GELY*CVLFTASLAKYADPVADLLDRWGVFRARLFRDSCVFHRGNYVKDLNSL 721
            +++  V+++++  +Y D + D +D   +   RL+RD C  + G Y+KD+  +
Sbjct: 353 SKIFNLVIYSSAQKQYVDAIVDKIDTNKLIVKRLYRDQCFKYPGLYIKDIQQV 405


>UniRef50_A1ZCM3 Cluster: Development protein; n=1; Microscilla
           marina ATCC 23134|Rep: Development protein - Microscilla
           marina ATCC 23134
          Length = 195

 Score = 50.8 bits (116), Expect = 3e-05
 Identities = 25/73 (34%), Positives = 46/73 (63%)
 Frame = +2

Query: 404 KSVMVIDLDETLVHSSFKPINNAHFVVPVEIDGAVHQVYVLKRPHVDEFLRRCGELY*CV 583
           K+++++DLDETL+++S  P+ N   + P     A H VY  KRP+++EFL  C + +   
Sbjct: 3   KTLLILDLDETLIYTSKTPLIN---IEPAFTLSAYHYVY--KRPYLEEFLYACQQYFELA 57

Query: 584 LFTASLAKYADPV 622
           +++++   Y +PV
Sbjct: 58  VWSSAQRNYVNPV 70


>UniRef50_Q9N6I5 Cluster: Putative uncharacterized protein; n=3;
           Leishmania|Rep: Putative uncharacterized protein -
           Leishmania major
          Length = 738

 Score = 50.8 bits (116), Expect = 3e-05
 Identities = 31/95 (32%), Positives = 46/95 (48%), Gaps = 3/95 (3%)
 Frame = +2

Query: 404 KSVMVIDLDETLVHSSFKPINNAH---FVVPVEIDGAVHQVYVLKRPHVDEFLRRCGELY 574
           + V+VIDLDETL H S    N A    F   +         +V +RP+   FL    +L+
Sbjct: 310 QKVLVIDLDETLCHVSTTTANMAGPPTFSEVIPTASGAELFHVWERPYARLFLSTAAKLF 369

Query: 575 *CVLFTASLAKYADPVADLLDRWGVFRARLFRDSC 679
             VLFT++   YAD +   +D   + + R +R  C
Sbjct: 370 NLVLFTSASKPYADTILQRIDPDRLLKYRYYRQDC 404


>UniRef50_A0CYD9 Cluster: Chromosome undetermined scaffold_31, whole
           genome shotgun sequence; n=4; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_31,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 626

 Score = 50.8 bits (116), Expect = 3e-05
 Identities = 35/103 (33%), Positives = 52/103 (50%), Gaps = 3/103 (2%)
 Frame = +2

Query: 413 MVIDLDETLVHSSFKPINNAHFVVPVEID-GAVHQVYVLKRPHVDEFLRRCGELY*CVLF 589
           +V DLDETL+H      + +   + ++   G   +  +  RP+  E L+   + Y  ++F
Sbjct: 439 IVFDLDETLIHCQESNDDPSDIALTIKFPTGETVEAGINIRPYCKEMLQILSQKYEIIVF 498

Query: 590 TASLAKYADPVADLLD-RWGVFRARLFRDSC-VFHRGNYVKDL 712
           TAS   YA  V + LD    +   R FRDSC V   G +VKDL
Sbjct: 499 TASHECYAQKVLNYLDPDKKLIHHRFFRDSCVVIQDGLHVKDL 541


>UniRef50_Q9W4V8 Cluster: Import inner membrane translocase subunit
           TIM50-C, mitochondrial precursor; n=6; Diptera|Rep:
           Import inner membrane translocase subunit TIM50-C,
           mitochondrial precursor - Drosophila melanogaster (Fruit
           fly)
          Length = 428

 Score = 50.8 bits (116), Expect = 3e-05
 Identities = 27/65 (41%), Positives = 37/65 (56%)
 Frame = +2

Query: 527 KRPHVDEFLRRCGELY*CVLFTASLAKYADPVADLLDRWGVFRARLFRDSCVFHRGNYVK 706
           KRP VD FL  C + +  V+FTA       P+ D LD  G    RL RD+  F  G++VK
Sbjct: 254 KRPGVDHFLAECAKDFEIVVFTAEQGMTVFPILDALDPNGYIMYRLVRDATHFVDGHHVK 313

Query: 707 DLNSL 721
           +L++L
Sbjct: 314 NLDNL 318


>UniRef50_A0CN10 Cluster: Chromosome undetermined scaffold_22, whole
           genome shotgun sequence; n=1; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_22,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 596

 Score = 50.4 bits (115), Expect = 4e-05
 Identities = 37/104 (35%), Positives = 56/104 (53%), Gaps = 1/104 (0%)
 Frame = +2

Query: 413 MVIDLDETLVHSSFKPINNAHFVVPVEIDGAVHQVYVLKRPHVDEFLRRCGELY*CVLFT 592
           +V+DLDETLVH          F+   +         VL RP+ + FL + G+ +  V+FT
Sbjct: 439 LVLDLDETLVH----------FIEETQ--------EVLIRPYTEIFLEQMGKHFEIVIFT 480

Query: 593 ASLAKYADPVADLLDRWGVFRARLFRDSCVFHRGN-YVKDLNSL 721
           A +  YAD + D +D   V + RL+R    F +GN  +KDL++L
Sbjct: 481 AGIQSYADKIIDKIDVMNVVKHRLYRHH-TFSQGNVMLKDLSTL 523


>UniRef50_UPI00006CB5CE Cluster: NLI interacting factor-like
           phosphatase family protein; n=1; Tetrahymena thermophila
           SB210|Rep: NLI interacting factor-like phosphatase
           family protein - Tetrahymena thermophila SB210
          Length = 793

 Score = 50.0 bits (114), Expect = 6e-05
 Identities = 33/106 (31%), Positives = 55/106 (51%), Gaps = 3/106 (2%)
 Frame = +2

Query: 404 KSVMVIDLDETLVHSSFKPINNAHFVVPVEI-DGAVHQVYVLKRPHVDEFLRRCGELY*C 580
           K  +V DLDETL+H +      A  ++P++  +  +    +  RP+  E L    + +  
Sbjct: 599 KKTIVFDLDETLIHCNESTDIPADVIIPIKFPNNDIIDAGINIRPYAKECLEELSKHFEI 658

Query: 581 VLFTASLAKYADPVADLLDRWGVFRA-RLFRDSCV-FHRGNYVKDL 712
           ++FTAS   YA  V   LD    + + +LFR+SCV    G ++KD+
Sbjct: 659 IVFTASHGCYAIKVLQHLDPEEKYISHKLFRESCVQTEEGIHIKDM 704


>UniRef50_A7Q966 Cluster: Chromosome chr19 scaffold_66, whole genome
           shotgun sequence; n=13; Magnoliophyta|Rep: Chromosome
           chr19 scaffold_66, whole genome shotgun sequence - Vitis
           vinifera (Grape)
          Length = 368

 Score = 50.0 bits (114), Expect = 6e-05
 Identities = 32/103 (31%), Positives = 50/103 (48%)
 Frame = +2

Query: 413 MVIDLDETLVHSSFKPINNAHFVVPVEIDGAVHQVYVLKRPHVDEFLRRCGELY*CVLFT 592
           +V+DL+ETL++S +K                       KRP VD FL    + Y  V+++
Sbjct: 185 LVLDLNETLIYSDWKRDRGWR---------------TFKRPGVDAFLEHLAQFYEIVVYS 229

Query: 593 ASLAKYADPVADLLDRWGVFRARLFRDSCVFHRGNYVKDLNSL 721
             L+ Y DPV + LD+    R RL R +  +  G + +DL+ L
Sbjct: 230 DQLSMYVDPVVERLDKKQCIRHRLSRAATRYQDGKHYRDLSKL 272


>UniRef50_A0D6Q6 Cluster: Chromosome undetermined scaffold_4, whole
           genome shotgun sequence; n=2; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_4,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 547

 Score = 50.0 bits (114), Expect = 6e-05
 Identities = 42/136 (30%), Positives = 63/136 (46%)
 Frame = +2

Query: 314 STAGLLRPCWSCLNMPPDLCYRQ*DTRTCIKSVMVIDLDETLVHSSFKPINNAHFVVPVE 493
           S  GLL     C+   P L Y    T T     +V+D+DETL+H + +     HF++   
Sbjct: 356 SYQGLLGIPLICVAPQPYLPYANQKTYT-----LVLDMDETLIHFTDQ---TGHFLI--- 404

Query: 494 IDGAVHQVYVLKRPHVDEFLRRCGELY*CVLFTASLAKYADPVADLLDRWGVFRARLFRD 673
                       RP   +FL+   + Y  V+FTA L  YA+ V D +D+      RLFR 
Sbjct: 405 ------------RPFTHQFLQEMSQFYELVVFTAGLPDYANWVLDQVDKNKNISYRLFRQ 452

Query: 674 SCVFHRGNYVKDLNSL 721
             + +   ++KDL+ L
Sbjct: 453 HALQYSNQFIKDLSRL 468


>UniRef50_A7TQU6 Cluster: Putative uncharacterized protein; n=1;
           Vanderwaltozyma polyspora DSM 70294|Rep: Putative
           uncharacterized protein - Vanderwaltozyma polyspora DSM
           70294
          Length = 489

 Score = 50.0 bits (114), Expect = 6e-05
 Identities = 24/66 (36%), Positives = 41/66 (62%), Gaps = 1/66 (1%)
 Frame = +2

Query: 527 KRPHVDEFLRRCGELY*CVLFTASLAKYADPVADLLDRWGVFRA-RLFRDSCVFHRGNYV 703
           KRP VD FL    + Y  VLF+++   Y++ +A+ LD    F +  L+++ CV+  G+++
Sbjct: 226 KRPGVDYFLGYLSQYYEVVLFSSNYMMYSEKIAEKLDPIHAFISYNLYKEHCVYKEGDHI 285

Query: 704 KDLNSL 721
           KDL+ L
Sbjct: 286 KDLSKL 291


>UniRef50_A0EHH2 Cluster: Chromosome undetermined scaffold_97, whole
           genome shotgun sequence; n=1; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_97,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 532

 Score = 49.6 bits (113), Expect = 8e-05
 Identities = 32/104 (30%), Positives = 55/104 (52%), Gaps = 4/104 (3%)
 Frame = +2

Query: 413 MVIDLDETLVHSSFKPINNAHFVVPVEI--DGAVHQVYVLKRPHVDEFLRRCGELY*CVL 586
           +V DLDETL+H +    +     + V +  +G V +  +  RP   + L+     +  +L
Sbjct: 336 LVFDLDETLLHCNENVNDPTDHTIMVNMPNEGMV-KTKINIRPFCQQMLKLLSNHFELIL 394

Query: 587 FTASLAKYADPVADLLD-RWGVFRARLFRDSCV-FHRGNYVKDL 712
           FTA+   YAD   +L+D    +F+ R +R+SC+    G ++KDL
Sbjct: 395 FTAAYQYYADKALELIDPERKLFQYRFYRESCLEIEEGLFIKDL 438


>UniRef50_Q7R5U8 Cluster: GLP_81_145711_146535; n=1; Giardia lamblia
           ATCC 50803|Rep: GLP_81_145711_146535 - Giardia lamblia
           ATCC 50803
          Length = 274

 Score = 49.2 bits (112), Expect = 1e-04
 Identities = 34/119 (28%), Positives = 61/119 (51%), Gaps = 13/119 (10%)
 Frame = +2

Query: 404 KSVMVIDLDETLVHSSFKP-INNAHFVVPV------EIDGAVHQVYVL----KRPHVDEF 550
           K  +V+D+DETL+   F   +  + ++VP+      E    + ++Y +    KRP++++F
Sbjct: 89  KPTLVLDMDETLIAVKFDLYLPGSDYIVPLRLCHLTETGTGMTELYTIAWVRKRPYLEDF 148

Query: 551 LRRCGELY*CVLFTASLAKYADPVADLLDRWGVFRARLFRDSCVFHR--GNYVKDLNSL 721
           L    + +  ++ TA +  YA P+    DR  +    L+RDSC   +  G   KDL+ L
Sbjct: 149 LASVAKDWEVIIMTAGIEDYAKPIIAEFDRNKIVSYSLYRDSCSCDKSDGIIYKDLSIL 207


>UniRef50_A0DRY1 Cluster: Chromosome undetermined scaffold_61, whole
           genome shotgun sequence; n=2; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_61,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 475

 Score = 49.2 bits (112), Expect = 1e-04
 Identities = 35/106 (33%), Positives = 55/106 (51%), Gaps = 3/106 (2%)
 Frame = +2

Query: 404 KSVMVIDLDETLVHSSFKPINNAHFVVPVEID-GAVHQVYVLKRPHVDEFLRRCGELY*C 580
           K  ++ DLDETLVH + +    +  V+ ++++   + +  V  RP   E L+   + +  
Sbjct: 279 KITVIFDLDETLVHCNEQMQQKSDIVLNIKVNPHEIVKAGVNIRPGAIELLQSLVDDFEI 338

Query: 581 VLFTASLAKYADPVADLLDRWG-VFRARLFRDSCVFHRGN-YVKDL 712
           V+FTAS   YA  V + LD    +   R FRD+C+   G  Y KDL
Sbjct: 339 VVFTASHQCYAKQVLEHLDPENKLISHRFFRDNCILTTGGMYTKDL 384


>UniRef50_Q4DR97 Cluster: Putative uncharacterized protein; n=3;
           Trypanosoma|Rep: Putative uncharacterized protein -
           Trypanosoma cruzi
          Length = 573

 Score = 48.8 bits (111), Expect = 1e-04
 Identities = 29/95 (30%), Positives = 46/95 (48%), Gaps = 3/95 (3%)
 Frame = +2

Query: 404 KSVMVIDLDETLVHSSFKPINNA---HFVVPVEIDGAVHQVYVLKRPHVDEFLRRCGELY 574
           + V+++DLDETL   S K  ++     F   +         YV +RPHV  F+    +L+
Sbjct: 309 QKVLIMDLDETLCFVSTKSTSSCCPPTFSEVIPTASGAELFYVWERPHVRLFIGTLAKLF 368

Query: 575 *CVLFTASLAKYADPVADLLDRWGVFRARLFRDSC 679
              LFT++   YAD +   LD   + + R +R  C
Sbjct: 369 NLALFTSATKPYADSILRRLDPERLIKRRYYRHHC 403


>UniRef50_Q23KI9 Cluster: NLI interacting factor-like phosphatase
            family protein; n=2; Alveolata|Rep: NLI interacting
            factor-like phosphatase family protein - Tetrahymena
            thermophila SB210
          Length = 1487

 Score = 48.8 bits (111), Expect = 1e-04
 Identities = 34/109 (31%), Positives = 56/109 (51%)
 Frame = +2

Query: 395  TCIKSVMVIDLDETLVHSSFKPINNAHFVVPVEIDGAVHQVYVLKRPHVDEFLRRCGELY 574
            T  K  +V+DLDETLVH               E++      +++ RP  ++FL    + Y
Sbjct: 967  TKYKYTLVLDLDETLVHYH-------------EMEDQTGGEFLI-RPFAEQFLYDMSKYY 1012

Query: 575  *CVLFTASLAKYADPVADLLDRWGVFRARLFRDSCVFHRGNYVKDLNSL 721
              V+FTA++ +YAD + D++D+      +L+R   VF     +KDL+ L
Sbjct: 1013 EIVIFTAAVKEYADWILDIIDKDKNISYKLYRQHTVFDGQYNLKDLSKL 1061


>UniRef50_A0DYN1 Cluster: Chromosome undetermined scaffold_7, whole
           genome shotgun sequence; n=10; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_7,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 432

 Score = 48.8 bits (111), Expect = 1e-04
 Identities = 31/102 (30%), Positives = 56/102 (54%), Gaps = 2/102 (1%)
 Frame = +2

Query: 413 MVIDLDETLVHSSFKPINNAHFVVPVEIDGAVHQVYVLKRPHVDEFLRRCGELY*CVLFT 592
           +V+DLDETL+HS  +  N   +V  V   G   ++ +  RP+   FL++  + Y   ++T
Sbjct: 252 LVLDLDETLIHSCSQRENPQVYVTAVGDFGEEAKIGINIRPYTTLFLQQLSQHYTIYIYT 311

Query: 593 ASLAKYADPVADLLDRWGVFRARLF-RDSCV-FHRGNYVKDL 712
           AS + YA  + + LD    + + +  R++C+    G ++KDL
Sbjct: 312 ASSSAYALAIINYLDPTKQYISGIMTRNNCMETKNGFFIKDL 353


>UniRef50_Q02776 Cluster: Import inner membrane translocase subunit
           TIM50, mitochondrial precursor; n=5;
           Saccharomycetales|Rep: Import inner membrane translocase
           subunit TIM50, mitochondrial precursor - Saccharomyces
           cerevisiae (Baker's yeast)
          Length = 476

 Score = 48.8 bits (111), Expect = 1e-04
 Identities = 25/66 (37%), Positives = 39/66 (59%), Gaps = 1/66 (1%)
 Frame = +2

Query: 527 KRPHVDEFLRRCGELY*CVLFTASLAKYADPVADLLDRWGVFRA-RLFRDSCVFHRGNYV 703
           KRP  D FL    + Y  VLF+++   Y+D +A+ LD    F +  LF++ CV+  G ++
Sbjct: 217 KRPGADYFLGYLSQYYEIVLFSSNYMMYSDKIAEKLDPIHAFVSYNLFKEHCVYKDGVHI 276

Query: 704 KDLNSL 721
           KDL+ L
Sbjct: 277 KDLSKL 282


>UniRef50_Q3ZCQ8 Cluster: Import inner membrane translocase subunit
           TIM50, mitochondrial precursor; n=30; Eumetazoa|Rep:
           Import inner membrane translocase subunit TIM50,
           mitochondrial precursor - Homo sapiens (Human)
          Length = 353

 Score = 47.6 bits (108), Expect = 3e-04
 Identities = 23/65 (35%), Positives = 37/65 (56%)
 Frame = +2

Query: 527 KRPHVDEFLRRCGELY*CVLFTASLAKYADPVADLLDRWGVFRARLFRDSCVFHRGNYVK 706
           KRP ++   ++   LY  V+FT+     A P+ D +D  G    RLFRD+  +  G++VK
Sbjct: 173 KRPGIETLFQQLAPLYEIVIFTSETGMTAFPLIDSVDPHGFISYRLFRDATRYMDGHHVK 232

Query: 707 DLNSL 721
           D++ L
Sbjct: 233 DISCL 237


>UniRef50_UPI00003C0364 Cluster: PREDICTED: similar to CG2713-PA;
           n=1; Apis mellifera|Rep: PREDICTED: similar to CG2713-PA
           - Apis mellifera
          Length = 387

 Score = 47.2 bits (107), Expect = 4e-04
 Identities = 27/66 (40%), Positives = 37/66 (56%), Gaps = 1/66 (1%)
 Frame = +2

Query: 527 KRPHVDEFLRRCGE-LY*CVLFTASLAKYADPVADLLDRWGVFRARLFRDSCVFHRGNYV 703
           KRP VD+FL       +  V++TA       P+ D+LD  G    RL RD+  F  G++V
Sbjct: 210 KRPGVDQFLEAIAPPQFEIVVYTAEQGMTVFPILDILDPNGYIMYRLVRDTTRFVDGHHV 269

Query: 704 KDLNSL 721
           KDLN+L
Sbjct: 270 KDLNAL 275


>UniRef50_A5B8A7 Cluster: Putative uncharacterized protein; n=1;
           Vitis vinifera|Rep: Putative uncharacterized protein -
           Vitis vinifera (Grape)
          Length = 388

 Score = 47.2 bits (107), Expect = 4e-04
 Identities = 25/59 (42%), Positives = 33/59 (55%)
 Frame = +2

Query: 506 VHQVYVLKRPHVDEFLRRCGELY*CVLFTASLAKYADPVADLLDRWGVFRARLFRDSCV 682
           +  V V +RP + EFL +  E    VLFTA+L  YA P+ D +D    F  RL+R S V
Sbjct: 299 ISYVTVFERPGLQEFLEQISEFAELVLFTAALEGYARPLVDKIDAGNRFSKRLYRPSTV 357


>UniRef50_Q95QG8 Cluster: Putative uncharacterized protein fcp-1;
           n=2; Caenorhabditis|Rep: Putative uncharacterized
           protein fcp-1 - Caenorhabditis elegans
          Length = 659

 Score = 47.2 bits (107), Expect = 4e-04
 Identities = 33/109 (30%), Positives = 55/109 (50%), Gaps = 6/109 (5%)
 Frame = +2

Query: 404 KSVMVIDLDETLVHSSFKPIN-NAHFVVPVEIDGAVHQVYVLK-RPHVDEFLRRCGELY* 577
           K V+++DLD+T++H+S KP+  +      +       +VY  K RPH  EFL +   +Y 
Sbjct: 143 KLVLLVDLDQTIIHTSDKPMTVDTENHKDITKYNLHSRVYTTKLRPHTTEFLNKMSNMYE 202

Query: 578 CVLFTASLAKYADPVADLLDRWG-VFRARLFRDSCVF---HRGNYVKDL 712
             + T    +YA  +A +LD    +F  R+     +F   H+ N +K L
Sbjct: 203 MHIVTYGQRQYAHRIAQILDPDARLFEQRILSRDELFSAQHKTNNLKAL 251


>UniRef50_Q8MQY2 Cluster: SD01014p; n=4; Diptera|Rep: SD01014p -
           Drosophila melanogaster (Fruit fly)
          Length = 896

 Score = 46.8 bits (106), Expect = 5e-04
 Identities = 37/119 (31%), Positives = 60/119 (50%), Gaps = 7/119 (5%)
 Frame = +2

Query: 386 DTRTCI---KSVMVIDLDETLVHSSFKPI-NNAHFVVPVEIDGAVHQVYVLK-RPHVDEF 550
           DTR  +   K V+++DLD+T++H++   + +N   +   ++ G     Y  + RP   EF
Sbjct: 214 DTRRLLADRKLVLLVDLDQTVIHTTNDTVPDNIKGIYHFQLYGPHSPWYHTRLRPGTAEF 273

Query: 551 LRRCGELY*CVLFTASLAKYADPVADLLDRWGVFRAR--LFRDSCVFHRGNYVKDLNSL 721
           L R  +LY   + T     YA  +A LLD  G F +   L RD C F+  +   +L +L
Sbjct: 274 LERMSQLYELHICTFGARNYAHMIAQLLDPEGKFFSHRILSRDEC-FNATSKTDNLKAL 331


>UniRef50_Q4Q5S6 Cluster: Putative uncharacterized protein; n=3;
           Leishmania|Rep: Putative uncharacterized protein -
           Leishmania major
          Length = 231

 Score = 46.4 bits (105), Expect = 7e-04
 Identities = 40/115 (34%), Positives = 59/115 (51%), Gaps = 9/115 (7%)
 Frame = +2

Query: 404 KSVMVIDLDETLVHSSF-KPI-----NNAHFVVPVEIDGAVHQVYVLKRPHVDEFLRRCG 565
           +  + +D+DETLVH  F KP      N   F   +E D +V   Y  +RP ++EFL +C 
Sbjct: 22  RRTLFLDMDETLVHCYFEKPTFFIDTNEDFFQFTLEDDPSV-TYYAFRRPGLNEFLYQCA 80

Query: 566 ELY*CVLFTASLAKYADPVAD-LLDRWGVFRARLF-RDSCVFH-RGNYVKDLNSL 721
           E Y   +FTA    YA  +   LL    +  +R + RD+CV    G  +K+L+ L
Sbjct: 81  EHYDMRIFTAGEDLYARTLLRWLLPDNLIDESRWYTRDACVGDGYGRLIKNLSML 135


>UniRef50_A0CYV8 Cluster: Chromosome undetermined scaffold_31, whole
           genome shotgun sequence; n=3; Alveolata|Rep: Chromosome
           undetermined scaffold_31, whole genome shotgun sequence
           - Paramecium tetraurelia
          Length = 401

 Score = 46.4 bits (105), Expect = 7e-04
 Identities = 32/103 (31%), Positives = 53/103 (51%), Gaps = 3/103 (2%)
 Frame = +2

Query: 413 MVIDLDETLVHS-SFKPINNAHFVVPVEIDGAVHQVYVLKRPHVDEFLRRCGELY*CVLF 589
           +++DLDETL+HS +F+  ++    + ++ D     ++   RP   EFLR     Y   +F
Sbjct: 222 LILDLDETLIHSCTFR--DSPQVTITLQDDEDKVDLFFNVRPFCKEFLREMSNYYNIYIF 279

Query: 590 TASLAKYADPVADLLD-RWGVFRARLFRDSCV-FHRGNYVKDL 712
           TAS   YA+ + + LD         L R++C     G ++KDL
Sbjct: 280 TASSELYANAIVNHLDPNRQYINDVLCRNNCFETKNGFFIKDL 322


>UniRef50_Q0F1Q7 Cluster: Putative uncharacterized protein; n=1;
           Mariprofundus ferrooxydans PV-1|Rep: Putative
           uncharacterized protein - Mariprofundus ferrooxydans
           PV-1
          Length = 181

 Score = 46.0 bits (104), Expect = 0.001
 Identities = 23/70 (32%), Positives = 39/70 (55%)
 Frame = +2

Query: 404 KSVMVIDLDETLVHSSFKPINNAHFVVPVEIDGAVHQVYVLKRPHVDEFLRRCGELY*CV 583
           K ++++D+DETL+H S   ++        E D      Y+ KRPHVD F++ C E Y   
Sbjct: 4   KKLLILDIDETLIHGSQHRLDT-------EPDAISDWCYLYKRPHVDSFMKFCREHYKVA 56

Query: 584 LFTASLAKYA 613
           ++T +  ++A
Sbjct: 57  IWTTASPEHA 66


>UniRef50_Q4Q377 Cluster: NLI-interacting factor, putative; n=7;
           Trypanosomatidae|Rep: NLI-interacting factor, putative -
           Leishmania major
          Length = 358

 Score = 46.0 bits (104), Expect = 0.001
 Identities = 27/82 (32%), Positives = 43/82 (52%), Gaps = 3/82 (3%)
 Frame = +2

Query: 404 KSVMVIDLDETLVHSSFKPINNA---HFVVPVEIDGAVHQVYVLKRPHVDEFLRRCGELY 574
           K  +V+D+DETL+H+    +++    H   P     ++    VL RPH+ EFL    +L+
Sbjct: 49  KHTLVLDIDETLIHTYAMGLHDDSKDHTRDPALQGVSLIDYNVLLRPHLKEFLEEVNQLF 108

Query: 575 *CVLFTASLAKYADPVADLLDR 640
             V +TA  A Y   V D L++
Sbjct: 109 EVVFWTAGTASYCCAVLDALEQ 130


>UniRef50_A0BX31 Cluster: Chromosome undetermined scaffold_133,
           whole genome shotgun sequence; n=2; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_133,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 342

 Score = 46.0 bits (104), Expect = 0.001
 Identities = 28/107 (26%), Positives = 50/107 (46%), Gaps = 6/107 (5%)
 Frame = +2

Query: 413 MVIDLDETLVHSSFKPINNAHFVVPVEIDGAVHQVYVLKRPHVDEFLRRCGELY*CVLFT 592
           ++I L+ TLV +S  P+   + ++     G     YV  RP +D FL    ++Y   ++T
Sbjct: 158 LLIGLEGTLVCTSHSPVEGWNKIIIQYHSGLTQDFYVKHRPLLDHFLCNVSQIYDVSIYT 217

Query: 593 ASLAKYADPVAD---LLDRWGVFRAR---LFRDSCVFHRGNYVKDLN 715
             + ++A P+ D   +      +R +    F  SCV  R    K++N
Sbjct: 218 TQIKEFAAPIIDQFCIQFSQNFYRQKQILFFTQSCVISRNKIRKEIN 264


>UniRef50_Q4PEW9 Cluster: Import inner membrane translocase subunit
           TIM50, mitochondrial precursor; n=1; Ustilago
           maydis|Rep: Import inner membrane translocase subunit
           TIM50, mitochondrial precursor - Ustilago maydis (Smut
           fungus)
          Length = 493

 Score = 45.2 bits (102), Expect = 0.002
 Identities = 38/104 (36%), Positives = 46/104 (44%), Gaps = 1/104 (0%)
 Frame = +2

Query: 413 MVIDLDETLVHSSFKPINNAHFVVPVEIDGAVHQVYVLKRPHVDEFLRRCGELY*CVLFT 592
           MVID+D+ LVHS +                  H     KRP +D FL    + Y  VLFT
Sbjct: 223 MVIDIDDLLVHSEWS---------------REHGWRTAKRPGLDHFLGYLSQFYEIVLFT 267

Query: 593 ASLAKYADPVADLLDRWGVF-RARLFRDSCVFHRGNYVKDLNSL 721
                 A P+ + LD    F    LFR+SC    G  VKDLN L
Sbjct: 268 TQPFFTAGPIIEKLDPDRRFITYTLFRESCRTVDGKLVKDLNHL 311


>UniRef50_Q874C1 Cluster: Import inner membrane translocase subunit
           tim-50, mitochondrial precursor; n=5;
           Sordariomycetes|Rep: Import inner membrane translocase
           subunit tim-50, mitochondrial precursor - Neurospora
           crassa
          Length = 540

 Score = 45.2 bits (102), Expect = 0.002
 Identities = 26/71 (36%), Positives = 37/71 (52%)
 Frame = +2

Query: 509 HQVYVLKRPHVDEFLRRCGELY*CVLFTASLAKYADPVADLLDRWGVFRARLFRDSCVFH 688
           H   + KRP VD FLR   + Y  VLFT+     A+P+   +D +      LFR++  + 
Sbjct: 268 HGWRLAKRPGVDYFLRYLSQYYEIVLFTSVPFANAEPIVRKMDPYRFIMWPLFREATKYK 327

Query: 689 RGNYVKDLNSL 721
            G  VKDL+ L
Sbjct: 328 DGEIVKDLSYL 338


>UniRef50_Q98SN2 Cluster: CTD phosphatase; n=10; Tetrapoda|Rep: CTD
           phosphatase - Xenopus laevis (African clawed frog)
          Length = 980

 Score = 44.8 bits (101), Expect = 0.002
 Identities = 29/97 (29%), Positives = 49/97 (50%), Gaps = 4/97 (4%)
 Frame = +2

Query: 404 KSVMVIDLDETLVHSSFKPINNAHF--VVPVEIDGAVHQVYVLKRPHVDEFLRRCGELY* 577
           K V+++DLD+TL+H++ +   +     +   ++      ++   RPH  EFL +  +LY 
Sbjct: 175 KLVLMVDLDQTLIHTTEQHCQHMSRKGIFHFQLGRGEPMLHTRLRPHCKEFLEKIAKLYE 234

Query: 578 CVLFTASLAKYADPVADLLD-RWGVFRAR-LFRDSCV 682
             +FT     YA  +A  LD    +F  R L RD C+
Sbjct: 235 LHVFTFGSRLYAHTIAGFLDPEKKLFSHRILSRDECI 271


>UniRef50_Q4FWB8 Cluster: Putative uncharacterized protein; n=3;
           Leishmania|Rep: Putative uncharacterized protein -
           Leishmania major strain Friedlin
          Length = 582

 Score = 44.8 bits (101), Expect = 0.002
 Identities = 29/92 (31%), Positives = 49/92 (53%), Gaps = 12/92 (13%)
 Frame = +2

Query: 401 IKSVMVIDLDETLVHSSFKPINNAHFVVPV-----EIDGAV-------HQVYVLKRPHVD 544
           ++  +V+D+DETL+H+S  P+ +A   +       E  G         ++++V  RPH++
Sbjct: 290 VRPTVVLDMDETLLHTSVMPMPDADAEIDALCPSDEAQGTGTSMTSGRYKLFVKYRPHLE 349

Query: 545 EFLRRCGELY*CVLFTASLAKYADPVADLLDR 640
            FL  C + +  V+FTAS A YA  V   L +
Sbjct: 350 RFLLFCLDHFEVVIFTASKALYAQTVLRQLQK 381


>UniRef50_Q16EJ3 Cluster: RNA polymerase ii ctd phosphatase; n=1;
           Aedes aegypti|Rep: RNA polymerase ii ctd phosphatase -
           Aedes aegypti (Yellowfever mosquito)
          Length = 569

 Score = 44.8 bits (101), Expect = 0.002
 Identities = 52/187 (27%), Positives = 81/187 (43%), Gaps = 10/187 (5%)
 Frame = +2

Query: 191 RGRPLWVGRNLAGPAASCDRCCAVGAVAEARDLP---EAMAPIVSTAGLLRPCWSCLNMP 361
           +G+PL      +      D C   GA     DL    EA  P++ +   L+   +     
Sbjct: 73  KGKPLLALEQCSHTTVINDMCADCGADLRQDDLAGGSEASVPMIHSVPELKVTETLAKK- 131

Query: 362 PDLCYRQ*DTRTCI---KSVMVIDLDETLVHSSFKPI-NNAHFVVPVEIDGAVHQVYVLK 529
                 Q DT   +   K V+++DLD+TL+H++   + NN   V   ++ G+    Y  +
Sbjct: 132 ----LGQADTERLLRDKKLVLLVDLDQTLIHTTNDNVPNNLKDVYHFQLYGSNSPWYHTR 187

Query: 530 -RPHVDEFLRRCGELY*CVLFTASLAKYADPVADLLDRWG-VFRAR-LFRDSCVFHRGNY 700
            RP   EFL +    Y   + T     YA  +A  LDR G +F  R L RD C F+  + 
Sbjct: 188 LRPGALEFLAKMHPYYELHICTFGARNYAHMIAQFLDRDGKLFSHRILSRDEC-FNATSK 246

Query: 701 VKDLNSL 721
             +L +L
Sbjct: 247 TDNLRAL 253


>UniRef50_Q5KNV7 Cluster: Import inner membrane translocase subunit
           TIM50, mitochondrial precursor; n=1; Filobasidiella
           neoformans|Rep: Import inner membrane translocase
           subunit TIM50, mitochondrial precursor - Cryptococcus
           neoformans (Filobasidiella neoformans)
          Length = 516

 Score = 44.8 bits (101), Expect = 0.002
 Identities = 32/106 (30%), Positives = 53/106 (50%), Gaps = 9/106 (8%)
 Frame = +2

Query: 431 ETLVHSSFKPINNAHFVVPVEIDGA-VHQVY-------VLKRPHVDEFLRRCGELY*CVL 586
           +TL+     P +   + + ++++G  VH  +         KRP VD FL    + Y  VL
Sbjct: 221 QTLLPDPLPPPHQRPYTLCIDLEGLLVHSSWDRTHGWRTAKRPGVDYFLGYLSQFYEIVL 280

Query: 587 FTASLAKYADPVADLLDRWGVFRA-RLFRDSCVFHRGNYVKDLNSL 721
           F++     A P+A+ +D +  F   RLFR+S    +G  VKD++ L
Sbjct: 281 FSSQPLYTAAPIAEKIDPYQAFMPYRLFRESTRSVKGKVVKDISFL 326


>UniRef50_UPI00006CA83D Cluster: NLI interacting factor-like
            phosphatase family protein; n=1; Tetrahymena thermophila
            SB210|Rep: NLI interacting factor-like phosphatase family
            protein - Tetrahymena thermophila SB210
          Length = 1122

 Score = 44.4 bits (100), Expect = 0.003
 Identities = 31/98 (31%), Positives = 52/98 (53%), Gaps = 3/98 (3%)
 Frame = +2

Query: 428  DETLVHSSFKPINNAHFVVPVEI-DGAVHQVYVLKRPHVDEFLRRCGELY*CVLFTASLA 604
            +ETL+H +  P   +  V+ V   +G + Q  +  RP+  E L+   + +  ++FTAS +
Sbjct: 831  NETLIHCNEDPNVYSDVVISVTFPNGELVQAGINIRPYAKECLKELSKYFEIIVFTASHS 890

Query: 605  KYADPVADLLD-RWGVFRARLFRDSCVFHR-GNYVKDL 712
             YA+ V + LD         L RD+CV  + G ++KDL
Sbjct: 891  CYAERVIEYLDPNRQYINYVLSRDNCVMTKEGVHIKDL 928


>UniRef50_Q0BYG6 Cluster: Phosphoprotein phosphatase; n=1;
           Hyphomonas neptunium ATCC 15444|Rep: Phosphoprotein
           phosphatase - Hyphomonas neptunium (strain ATCC 15444)
          Length = 197

 Score = 44.4 bits (100), Expect = 0.003
 Identities = 23/73 (31%), Positives = 41/73 (56%)
 Frame = +2

Query: 404 KSVMVIDLDETLVHSSFKPINNAHFVVPVEIDGAVHQVYVLKRPHVDEFLRRCGELY*CV 583
           ++++++DLDETLVH+S  P++ A        D  V   +V +RPH+D+FL      Y   
Sbjct: 7   RTLLILDLDETLVHASSTPLDRA-------ADFRVAHYHVYRRPHLDDFLTAVSATYDLA 59

Query: 584 LFTASLAKYADPV 622
           +++++   Y   V
Sbjct: 60  VWSSASDDYVKAV 72


>UniRef50_A5BUL8 Cluster: Putative uncharacterized protein; n=1;
           Vitis vinifera|Rep: Putative uncharacterized protein -
           Vitis vinifera (Grape)
          Length = 329

 Score = 44.4 bits (100), Expect = 0.003
 Identities = 30/102 (29%), Positives = 48/102 (47%)
 Frame = +2

Query: 413 MVIDLDETLVHSSFKPINNAHFVVPVEIDGAVHQVYVLKRPHVDEFLRRCGELY*CVLFT 592
           +V+DL+ETL++S +K                       KRP VD FL    + Y  V+++
Sbjct: 235 LVLDLNETLIYSDWKRDRGWR---------------TFKRPGVDAFLEXLAQFYEIVVYS 279

Query: 593 ASLAKYADPVADLLDRWGVFRARLFRDSCVFHRGNYVKDLNS 718
             L+ Y DPV + LD+    R RL R +  +  G + +  +S
Sbjct: 280 DQLSMYVDPVVERLDKKQCIRHRLSRAATRYQDGKHYRVFHS 321


>UniRef50_A0E8L2 Cluster: Chromosome undetermined scaffold_83, whole
           genome shotgun sequence; n=7; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_83,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 671

 Score = 44.4 bits (100), Expect = 0.003
 Identities = 33/106 (31%), Positives = 52/106 (49%), Gaps = 3/106 (2%)
 Frame = +2

Query: 404 KSVMVIDLDETLVHSSFKPINNAHFVVPVEID-GAVHQVYVLKRPHVDEFLRRCGELY*C 580
           K  +V DLDETLVH +      +  ++ +++      +  +  RP   + L      +  
Sbjct: 475 KITIVFDLDETLVHCNESLAIPSDLILSIQVSPQETIKAGINIRPGAVKLLELLVNDFEL 534

Query: 581 VLFTASLAKYADPVADLLD-RWGVFRARLFRDSCVFHRGN-YVKDL 712
           +LFTAS   YA  V + LD +  +F   L+R+SC+   G  Y KDL
Sbjct: 535 ILFTASHPCYAQKVIEHLDPQKTLFSHSLYRESCIMTTGGMYTKDL 580


>UniRef50_UPI0000498B9D Cluster: phosphatase; n=1; Entamoeba
           histolytica HM-1:IMSS|Rep: phosphatase - Entamoeba
           histolytica HM-1:IMSS
          Length = 191

 Score = 44.0 bits (99), Expect = 0.004
 Identities = 29/108 (26%), Positives = 56/108 (51%), Gaps = 4/108 (3%)
 Frame = +2

Query: 410 VMVIDLDETLVHSSFKPIN---NAHFVVPVEIDGAVHQVYVLKRPHVDEFLRRCGELY*C 580
           ++V DLD+TL+H+     N   N+  +  + ++   +  Y   R  V E L R  + +  
Sbjct: 31  LVVFDLDDTLIHTHINTNNLCINSSDIFTIRVNEIKY--YCEVRKGVVETLERLSKQFRI 88

Query: 581 VLFTASLAKYADPVADLLDR-WGVFRARLFRDSCVFHRGNYVKDLNSL 721
           +++TAS  +YAD V   L++   +F   L+R+ C+   G   K ++++
Sbjct: 89  MIYTASKKEYADQVVSHLEKNCKLFSKILYREDCLEEEGFIYKTIHNI 136


>UniRef50_A2DKK7 Cluster: NLI interacting factor-like phosphatase
           family protein; n=2; Trichomonas vaginalis G3|Rep: NLI
           interacting factor-like phosphatase family protein -
           Trichomonas vaginalis G3
          Length = 198

 Score = 44.0 bits (99), Expect = 0.004
 Identities = 27/76 (35%), Positives = 43/76 (56%), Gaps = 1/76 (1%)
 Frame = +2

Query: 404 KSVMVIDLDETLVHS-SFKPINNAHFVVPVEIDGAVHQVYVLKRPHVDEFLRRCGELY*C 580
           + V+V+DLDET V S S KP    +F  P+ +    HQ+++  RP + E +++   +Y  
Sbjct: 28  RPVLVLDLDETCVFSTSLKPPEK-NF--PIRV--GKHQLFIQVRPGMPECIKQLSSMYEI 82

Query: 581 VLFTASLAKYADPVAD 628
             FTAS   YA+ + D
Sbjct: 83  FFFTASKPNYANKIID 98


>UniRef50_Q8SV03 Cluster: RNA polymerase II subunit A C-terminal
           domain phosphatase; n=1; Encephalitozoon cuniculi|Rep:
           RNA polymerase II subunit A C-terminal domain
           phosphatase - Encephalitozoon cuniculi
          Length = 411

 Score = 44.0 bits (99), Expect = 0.004
 Identities = 24/84 (28%), Positives = 49/84 (58%)
 Frame = +2

Query: 401 IKSVMVIDLDETLVHSSFKPINNAHFVVPVEIDGAVHQVYVLKRPHVDEFLRRCGELY*C 580
           +K ++V+DLD+T++H+++   ++    V   ID   + V +  RP++D  LRR  +LY  
Sbjct: 59  MKLILVLDLDQTVLHTTYGT-SSLEGTVKFVIDRCRYCVKL--RPNLDYMLRRISKLYEI 115

Query: 581 VLFTASLAKYADPVADLLDRWGVF 652
            ++T     YA+ + +++D  G +
Sbjct: 116 HVYTMGTRAYAERIVEIIDPSGKY 139


>UniRef50_UPI00006CAF35 Cluster: NLI interacting factor-like
           phosphatase family protein; n=1; Tetrahymena thermophila
           SB210|Rep: NLI interacting factor-like phosphatase
           family protein - Tetrahymena thermophila SB210
          Length = 426

 Score = 43.6 bits (98), Expect = 0.005
 Identities = 27/102 (26%), Positives = 52/102 (50%), Gaps = 2/102 (1%)
 Frame = +2

Query: 413 MVIDLDETLVHSSFKPINNAHFVVPVEIDGAVHQVYVLKRPHVDEFLRRCGELY*CVLFT 592
           +++DLDETL+H+     N    +      G    + +  RP   EFL++  + +   +FT
Sbjct: 243 LLLDLDETLIHTCSLKENPDQILKFKNEIGETQNIGLRIRPFCYEFLQKMTQFWDIFIFT 302

Query: 593 ASLAKYADPVADLLDRWGVFRARLF-RDSCV-FHRGNYVKDL 712
           AS + YA+ + + +D    + + +  R +C+    G ++KDL
Sbjct: 303 ASSSTYAEAIINFIDPTRKYISGILNRSNCMETKNGFFIKDL 344


>UniRef50_UPI00006CAA86 Cluster: NLI interacting factor-like
           phosphatase family protein; n=1; Tetrahymena thermophila
           SB210|Rep: NLI interacting factor-like phosphatase
           family protein - Tetrahymena thermophila SB210
          Length = 317

 Score = 43.6 bits (98), Expect = 0.005
 Identities = 35/119 (29%), Positives = 57/119 (47%), Gaps = 13/119 (10%)
 Frame = +2

Query: 404 KSVMVIDLDETLVHSSFKPINNAHFVVPVE-----IDGAVHQVY--VLKRPHVDEFLRRC 562
           K  +V+++DE L ++     + A+   P++      +   +  Y  V KRPH++EFL+  
Sbjct: 122 KLTVVLEMDEILFYTFVPDEHEAYINAPLKDHDYYFELPEYDTYLSVYKRPHLEEFLKYL 181

Query: 563 GELY*CVLFTASLAKYADPVADLLDRWGVFRARLFRDSC---VF---HRGNYVKDLNSL 721
            E    +LFT  +  YA+ V  L+D    F   L  + C   V+       YVKDL+ L
Sbjct: 182 RENTEPILFTKGVKSYAEKVLKLIDPENTFAHILTNEDCDKIVYPPEDMDEYVKDLDRL 240


>UniRef50_UPI00015B45FB Cluster: PREDICTED: similar to conserved
           hypothetical protein; n=1; Nasonia vitripennis|Rep:
           PREDICTED: similar to conserved hypothetical protein -
           Nasonia vitripennis
          Length = 560

 Score = 43.2 bits (97), Expect = 0.007
 Identities = 24/66 (36%), Positives = 35/66 (53%), Gaps = 1/66 (1%)
 Frame = +2

Query: 527 KRPHVDEFLRRCGE-LY*CVLFTASLAKYADPVADLLDRWGVFRARLFRDSCVFHRGNYV 703
           KRP +D FL       +  V++TA       P+ D LD  G    RL RD+  F  G+++
Sbjct: 383 KRPGIDHFLEAIAPPQFETVVYTAEQGMTVFPILDALDPQGYIMYRLVRDATRFVDGHHI 442

Query: 704 KDLNSL 721
           KDL++L
Sbjct: 443 KDLDAL 448


>UniRef50_A0BT40 Cluster: Chromosome undetermined scaffold_126,
           whole genome shotgun sequence; n=2; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_126,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 343

 Score = 43.2 bits (97), Expect = 0.007
 Identities = 32/106 (30%), Positives = 54/106 (50%), Gaps = 2/106 (1%)
 Frame = +2

Query: 410 VMVIDLDETLVHSSFKPINNAHFVVPVEIDGAVHQVYVLKRPHVDEFLRRCGELY*CVLF 589
           V+++DLDETL+H               +++  ++Q+    RP+ + FL +  ++Y   +F
Sbjct: 173 VLLLDLDETLIHCCGSKEQ-------AQVN--INQISFNVRPYTNYFLNKLSQVYSIFVF 223

Query: 590 TASLAKYADPVADLLDRWGVFRARLF-RDSCV-FHRGNYVKDLNSL 721
           TAS   YA  V D LD        +F R+ C+    G ++KDL +L
Sbjct: 224 TASSPSYASIVVDYLDPDQTKIIGIFSRNHCMETKNGFFIKDLRTL 269


>UniRef50_Q9Y5B0 Cluster: RNA polymerase II subunit A C-terminal
           domain phosphatase; n=34; Eumetazoa|Rep: RNA polymerase
           II subunit A C-terminal domain phosphatase - Homo
           sapiens (Human)
          Length = 961

 Score = 43.2 bits (97), Expect = 0.007
 Identities = 28/97 (28%), Positives = 48/97 (49%), Gaps = 4/97 (4%)
 Frame = +2

Query: 404 KSVMVIDLDETLVHSSFKPINNAHF--VVPVEIDGAVHQVYVLKRPHVDEFLRRCGELY* 577
           K V+++DLD+TL+H++ +         +   ++      ++   RPH  +FL +  +LY 
Sbjct: 182 KLVLMVDLDQTLIHTTEQHCQQMSNKGIFHFQLGRGEPMLHTRLRPHCKDFLEKIAKLYE 241

Query: 578 CVLFTASLAKYADPVADLLD-RWGVFRAR-LFRDSCV 682
             +FT     YA  +A  LD    +F  R L RD C+
Sbjct: 242 LHVFTFGSRLYAHTIAGFLDPEKKLFSHRILSRDECI 278


>UniRef50_A0EDA0 Cluster: Chromosome undetermined scaffold_9, whole
           genome shotgun sequence; n=1; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_9,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 346

 Score = 42.7 bits (96), Expect = 0.009
 Identities = 35/105 (33%), Positives = 50/105 (47%), Gaps = 2/105 (1%)
 Frame = +2

Query: 404 KSVMVIDLDETLVHSSFKPINNAHFVVPVEIDGAVHQVYVLKRPHVDEFLRRCGELY*CV 583
           K  + IDLDETLVHS     N  +       D    Q     RP+  +FL+   +     
Sbjct: 162 KYSIAIDLDETLVHSEELKPNRRY-------DFQNLQFGTFIRPYCLQFLQLLNKHANLF 214

Query: 584 LFTASLAKYADPVADLLD-RWGVFRARLFRDSCVFHRGN-YVKDL 712
           +FT+S  KYA  +  +LD +  +F+   FRD C   + N  VKD+
Sbjct: 215 VFTSSNIKYATTIMQILDPQKDLFQGLFFRDHCTILQDNSQVKDI 259


>UniRef50_A0DXE0 Cluster: Chromosome undetermined scaffold_68, whole
           genome shotgun sequence; n=1; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_68,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 321

 Score = 42.3 bits (95), Expect = 0.012
 Identities = 34/108 (31%), Positives = 53/108 (49%), Gaps = 2/108 (1%)
 Frame = +2

Query: 404 KSVMVIDLDETLVHSSFKPINNAHFVVPVEIDGAVHQVYVLKRPHVDEFLRRCGELY*CV 583
           K ++++DLDETL+HS       +   +  E DG + +  V  RP++  FL      Y   
Sbjct: 144 KKILILDLDETLIHSCTSK-EKSQVQLKTE-DGQLLRFNV--RPYLAYFLDCLSTFYQIF 199

Query: 584 LFTASLAKYADPVADLLDRWGVFRARLF-RDSCV-FHRGNYVKDLNSL 721
           +FTAS   YA  + D +D        +F R+ C+    G ++KDL  L
Sbjct: 200 IFTASSPSYALALVDYIDPLEDKILGIFTRNHCLETKNGYFIKDLRIL 247


>UniRef50_A0DQH2 Cluster: Chromosome undetermined scaffold_6, whole
           genome shotgun sequence; n=1; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_6,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 499

 Score = 42.3 bits (95), Expect = 0.012
 Identities = 29/102 (28%), Positives = 51/102 (50%), Gaps = 6/102 (5%)
 Frame = +2

Query: 434 TLVHSSFKPINNAH-FVVPVEIDGA-VHQVYVLK----RPHVDEFLRRCGELY*CVLFTA 595
           ++ H  + P    H F + +++D   +H V   K    RP  ++FL+   + Y   +FTA
Sbjct: 328 SVAHKPYLPNEATHDFTLILDMDETLIHYVEQTKSFLVRPFAEQFLQEMSKYYEIAVFTA 387

Query: 596 SLAKYADPVADLLDRWGVFRARLFRDSCVFHRGNYVKDLNSL 721
            L  YA+ V D        + RL+R   + ++ ++VKDL+ L
Sbjct: 388 GLPDYANWVLDQAAFNKYIQFRLYRQHAMQYQKHFVKDLSRL 429


>UniRef50_Q5BZ31 Cluster: SJCHGC03357 protein; n=1; Schistosoma
           japonicum|Rep: SJCHGC03357 protein - Schistosoma
           japonicum (Blood fluke)
          Length = 326

 Score = 41.9 bits (94), Expect = 0.015
 Identities = 24/66 (36%), Positives = 36/66 (54%), Gaps = 1/66 (1%)
 Frame = +2

Query: 527 KRPHVDEFLRRCGELY*CVLFTASLAKYADPVADLLDRWGVF-RARLFRDSCVFHRGNYV 703
           KRP ++ FL++    Y  V+FT   A    PV   +D  G F   RLFR++  +  G ++
Sbjct: 146 KRPALELFLQQLSPHYEVVVFTNESAMTGGPVLAQMDPQGQFIHFRLFREATRYKEGRHI 205

Query: 704 KDLNSL 721
           KDL+ L
Sbjct: 206 KDLSCL 211


>UniRef50_A7AM05 Cluster: Protein phosphatase family protein; n=1;
           Babesia bovis|Rep: Protein phosphatase family protein -
           Babesia bovis
          Length = 806

 Score = 41.9 bits (94), Expect = 0.015
 Identities = 26/63 (41%), Positives = 34/63 (53%), Gaps = 1/63 (1%)
 Frame = +2

Query: 491 EIDGAVHQVYVLKRPHVDEFLRRCGELY*CVLFTASLAKYADPVADLLDRWG-VFRARLF 667
           E+DG++   Y   RP V +FLRR  ELY   LFT     +A+    +LD  G  F AR+F
Sbjct: 330 EMDGSLFVNYYKLRPGVYDFLRRSAELYELYLFTMGTRAHANAALKILDPDGKYFGARVF 389

Query: 668 RDS 676
             S
Sbjct: 390 SRS 392


>UniRef50_Q7QZ65 Cluster: GLP_22_23484_22576; n=1; Giardia lamblia
           ATCC 50803|Rep: GLP_22_23484_22576 - Giardia lamblia
           ATCC 50803
          Length = 302

 Score = 41.5 bits (93), Expect = 0.020
 Identities = 29/108 (26%), Positives = 56/108 (51%), Gaps = 2/108 (1%)
 Frame = +2

Query: 404 KSVMVIDLDETLVHSSFKPINNAHFVVPVEIDGAVHQVYVLKRPHVDEFLRRCGELY*CV 583
           +  +V+DLD TL ++S + +N       +  +     +Y+  RP+  +FL     ++  +
Sbjct: 114 RPTLVLDLDATLFYTSAELLNTPLDYFDMGEESTYRYLYL--RPYALDFLGWASTVFEVI 171

Query: 584 LFTASLAKYADP--VADLLDRWGVFRARLFRDSCVFHRGNYVKDLNSL 721
           ++TA++  YA+P   A  +DR+      L+R +C    G+ VK+L  L
Sbjct: 172 IWTAAMESYAEPRIRATEIDRYA--DVVLYRGACDMIDGSLVKNLAKL 217


>UniRef50_Q4E2U9 Cluster: Putative uncharacterized protein; n=2;
           Trypanosoma cruzi|Rep: Putative uncharacterized protein
           - Trypanosoma cruzi
          Length = 766

 Score = 40.7 bits (91), Expect = 0.035
 Identities = 25/69 (36%), Positives = 37/69 (53%), Gaps = 1/69 (1%)
 Frame = +2

Query: 518 YVLKRPHVDEFLRRCGELY*CVLFTASLAKYADPVADLLDRWGVFRARLFRDSC-VFHRG 694
           YV  RP+  EF++ C + +  V FT+   +YA P+ D L+   V   R +R  C     G
Sbjct: 574 YVCIRPYALEFVQFCLDKFELVFFTSGTEEYARPIFDRLEPKRVAH-RFYRQHCTACGDG 632

Query: 695 NYVKDLNSL 721
            Y+KDL+ L
Sbjct: 633 MYMKDLSML 641


>UniRef50_A0DR00 Cluster: Chromosome undetermined scaffold_6, whole
           genome shotgun sequence; n=3; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_6,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 414

 Score = 40.7 bits (91), Expect = 0.035
 Identities = 30/107 (28%), Positives = 52/107 (48%), Gaps = 5/107 (4%)
 Frame = +2

Query: 407 SVMVIDLDETLVHSSFKPINNAHFVVPVEIDGAVH---QVYVLKRPHVDEFLRRCGELY* 577
           + + +DLDETL+H+       +  +     DG+     QV +  RP+   FL+   + Y 
Sbjct: 229 NTIFLDLDETLIHACHARETPSVKLKQQNEDGSETDSMQVGINVRPYTGYFLQELAQYYT 288

Query: 578 CVLFTASLAKYADPVADLLDRWGVF-RARLFRDSCV-FHRGNYVKDL 712
             ++TAS  +YA  + + LD    +    L R +C+    G ++KDL
Sbjct: 289 IYIYTASSQQYAQTIVNYLDPLKQYISGILSRSNCMETKNGFFIKDL 335


>UniRef50_O13636 Cluster: Import inner membrane translocase subunit
           tim50, mitochondrial precursor; n=4; Schizosaccharomyces
           pombe|Rep: Import inner membrane translocase subunit
           tim50, mitochondrial precursor - Schizosaccharomyces
           pombe (Fission yeast)
          Length = 452

 Score = 40.7 bits (91), Expect = 0.035
 Identities = 24/66 (36%), Positives = 34/66 (51%), Gaps = 1/66 (1%)
 Frame = +2

Query: 527 KRPHVDEFLRRCGELY*CVLFTASLAKYADPVADLLDRWGV-FRARLFRDSCVFHRGNYV 703
           KRP +D FL      Y  V+FT      A P+ D +D + V   A L R+S  + +G  +
Sbjct: 202 KRPGLDYFLGYLSMYYEVVIFTRQYLATAKPIIDKIDPYHVSISAVLTRESSKYEKGKVI 261

Query: 704 KDLNSL 721
           KDL+ L
Sbjct: 262 KDLSYL 267


>UniRef50_UPI0000519ABE Cluster: PREDICTED: similar to CG12252-PA;
           n=1; Apis mellifera|Rep: PREDICTED: similar to
           CG12252-PA - Apis mellifera
          Length = 711

 Score = 40.3 bits (90), Expect = 0.047
 Identities = 32/96 (33%), Positives = 47/96 (48%), Gaps = 4/96 (4%)
 Frame = +2

Query: 404 KSVMVIDLDETLVHSSFKPIN-NAHFVVPVEIDGAVHQVYVLK-RPHVDEFLRRCGELY* 577
           K  +++DLD+T+VH++   +  N   V   ++ G     Y  + RP+   FL     LY 
Sbjct: 153 KLALLVDLDQTIVHTTNDNVPPNMKDVYHYQLYGPNSPWYHTRLRPNTRHFLSEMSRLYE 212

Query: 578 CVLFTASLAKYADPVADLLDRWG-VFRAR-LFRDSC 679
             + T     YA  VA LLD+ G +F  R L RD C
Sbjct: 213 LHICTFGARNYAHTVAALLDKDGTLFSHRILSRDEC 248


>UniRef50_UPI0000E494F0 Cluster: PREDICTED: similar to CG5830-PA,
           partial; n=1; Strongylocentrotus purpuratus|Rep:
           PREDICTED: similar to CG5830-PA, partial -
           Strongylocentrotus purpuratus
          Length = 115

 Score = 39.9 bits (89), Expect = 0.062
 Identities = 37/119 (31%), Positives = 52/119 (43%), Gaps = 5/119 (4%)
 Frame = +1

Query: 70  MDASSIITQVSRDDEQLNNYGPDRGSSPGVQHNEGDGTPVSGSTPLGGKKSSGTGGFLRS 249
           M+++SIITQV+RD+EQ+N++                  P S S P   KK   +   L +
Sbjct: 1   MESTSIITQVNRDEEQINSF------------------PTSESGPSSSKKPR-SRSLLNT 41

Query: 250 LLCCWXXXXXXXXXXXXXT-NSIDGRA----SPPLLVMSEHAPRPLLPPVRHQDMHKKC 411
            LCC+             T +  D R+      P+   S    + LLP VR QD HK C
Sbjct: 42  FLCCFGSGRHGTHQSVPQTSDQTDQRSLEHRPAPVNDPSTQPNKYLLPQVRQQDAHKCC 100



 Score = 33.9 bits (74), Expect = 4.1
 Identities = 18/27 (66%), Positives = 19/27 (70%)
 Frame = +2

Query: 377 RQ*DTRTCIKSVMVIDLDETLVHSSFK 457
           RQ D   C    +VIDLDETLVHSSFK
Sbjct: 92  RQQDAHKCC---IVIDLDETLVHSSFK 115


>UniRef50_Q388H5 Cluster: Putative uncharacterized protein; n=1;
           Trypanosoma brucei|Rep: Putative uncharacterized protein
           - Trypanosoma brucei
          Length = 677

 Score = 39.9 bits (89), Expect = 0.062
 Identities = 25/70 (35%), Positives = 32/70 (45%)
 Frame = +2

Query: 512 QVYVLKRPHVDEFLRRCGELY*CVLFTASLAKYADPVADLLDRWGVFRARLFRDSCVFHR 691
           ++YV  RP   E L  C E +  V FT    +YA  + D LD       RL+R  C    
Sbjct: 519 RLYVCIRPFAKELLEYCFETFEVVFFTTGTEEYATSIFDHLDPHHKAH-RLYRHHCTAVG 577

Query: 692 GNYVKDLNSL 721
             Y KDL+ L
Sbjct: 578 DTYKKDLSLL 587


>UniRef50_A7AQ81 Cluster: Putative uncharacterized protein; n=1;
           Babesia bovis|Rep: Putative uncharacterized protein -
           Babesia bovis
          Length = 384

 Score = 39.9 bits (89), Expect = 0.062
 Identities = 24/67 (35%), Positives = 37/67 (55%), Gaps = 2/67 (2%)
 Frame = +2

Query: 527 KRPHVDEFLRRCGELY*CVLFTASLAKYADPVA-DLLDRWGV-FRARLFRDSCVFHRGNY 700
           KRP+ D F R     Y  V+++      + PVA D+ +RWG+     + RD C   +G+Y
Sbjct: 221 KRPYADRFFRELINYYEIVVWSDD----SYPVATDVANRWGLPVIGCIHRDRCTKFKGSY 276

Query: 701 VKDLNSL 721
           +KDL+ L
Sbjct: 277 IKDLSKL 283


>UniRef50_Q6BVY9 Cluster: Import inner membrane translocase subunit
           TIM50, mitochondrial precursor; n=6;
           Saccharomycetales|Rep: Import inner membrane translocase
           subunit TIM50, mitochondrial precursor - Debaryomyces
           hansenii (Yeast) (Torulaspora hansenii)
          Length = 471

 Score = 39.9 bits (89), Expect = 0.062
 Identities = 22/66 (33%), Positives = 36/66 (54%), Gaps = 1/66 (1%)
 Frame = +2

Query: 527 KRPHVDEFLRRCGELY*CVLFTASLAKYADPVADLLDRWGVFRA-RLFRDSCVFHRGNYV 703
           KRP +D FL    + Y  V+F ++   Y++     LD +  + +  LFR++C +  G  V
Sbjct: 215 KRPGLDYFLGYLSQYYEIVIFGSNYQMYSENTVGKLDPFHAYVSYALFREACRYKDGKLV 274

Query: 704 KDLNSL 721
           KDL+ L
Sbjct: 275 KDLSLL 280


>UniRef50_UPI0000E48F15 Cluster: PREDICTED: similar to SD01014p;
           n=1; Strongylocentrotus purpuratus|Rep: PREDICTED:
           similar to SD01014p - Strongylocentrotus purpuratus
          Length = 641

 Score = 39.5 bits (88), Expect = 0.082
 Identities = 29/98 (29%), Positives = 51/98 (52%), Gaps = 5/98 (5%)
 Frame = +2

Query: 404 KSVMVIDLDETLVHSSFKPIN-NAHFVVPVEI-DGAVHQVYVLK-RPHVDEFLRRCGELY 574
           K V+++DLD+TL+H++   +  +   V   ++  G +   Y  + R +  +FL    + Y
Sbjct: 55  KLVLLVDLDQTLIHTTLDEVPADMPGVHHFQLRKGPMFPWYHTRIRDNYQQFLDLISQFY 114

Query: 575 *CVLFTASLAKYADPVADLLDRWGVFRAR--LFRDSCV 682
              +FT  +  YA  VA+++D  G F +   L RD CV
Sbjct: 115 QLHIFTMGVRLYAHTVAEIIDPEGKFFSHRILSRDECV 152


>UniRef50_Q5S7T7 Cluster: Import inner membrane translocase subunit
           TIM50, mitochondrial precursor; n=2; Phytophthora|Rep:
           Import inner membrane translocase subunit TIM50,
           mitochondrial precursor - Phytophthora infestans (Potato
           late blight fungus)
          Length = 409

 Score = 39.5 bits (88), Expect = 0.082
 Identities = 39/120 (32%), Positives = 56/120 (46%)
 Frame = +2

Query: 362 PDLCYRQ*DTRTCIKSVMVIDLDETLVHSSFKPINNAHFVVPVEIDGAVHQVYVLKRPHV 541
           PD    Q    T    V+V+DL++TLVHS +   +  H        G  H     KRP V
Sbjct: 154 PDWPIPQVPADTPTVPVLVLDLEDTLVHSEW---SRKH--------GWRHA----KRPGV 198

Query: 542 DEFLRRCGELY*CVLFTASLAKYADPVADLLDRWGVFRARLFRDSCVFHRGNYVKDLNSL 721
           DEFL    + Y  V+F+ +    A+ +   LD        L RD+  +  G +VKDL++L
Sbjct: 199 DEFLETLCQYYEIVIFSQNYG--AEEIVQKLDPKQCALHILSRDATRYLNGAHVKDLSNL 256


>UniRef50_A0DPW6 Cluster: Chromosome undetermined scaffold_6, whole
           genome shotgun sequence; n=2; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_6,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 592

 Score = 39.1 bits (87), Expect = 0.11
 Identities = 23/67 (34%), Positives = 33/67 (49%)
 Frame = +2

Query: 521 VLKRPHVDEFLRRCGELY*CVLFTASLAKYADPVADLLDRWGVFRARLFRDSCVFHRGNY 700
           V +RP +  FL++   LY  +LFTA L  YA+ +   +     F   LFR     ++  Y
Sbjct: 453 VHQRPFLLTFLKQMSRLYQLILFTAGLESYANRILSQITIKKYFTHLLFRQHTNIYQDFY 512

Query: 701 VKDLNSL 721
            KDL  L
Sbjct: 513 GKDLRKL 519


>UniRef50_Q8IBI8 Cluster: Putative uncharacterized protein
           PF07_0110; n=1; Plasmodium falciparum 3D7|Rep: Putative
           uncharacterized protein PF07_0110 - Plasmodium
           falciparum (isolate 3D7)
          Length = 519

 Score = 38.3 bits (85), Expect = 0.19
 Identities = 22/68 (32%), Positives = 34/68 (50%), Gaps = 1/68 (1%)
 Frame = +2

Query: 521 VLKRPHVDEFLRRCGELY*CVLFTASLAKYADPVADLLDRWGV-FRARLFRDSCVFHRGN 697
           VLKRP+ D F +     Y  V+++      A    +++ +WG+     L RD C   + +
Sbjct: 345 VLKRPYADRFFKELSSFYEIVIWSDDNFPVAQ---EVISKWGIPAIGCLHRDQCSKKKKS 401

Query: 698 YVKDLNSL 721
           YVKDL  L
Sbjct: 402 YVKDLKRL 409


>UniRef50_Q4UIJ8 Cluster: Putative uncharacterized protein; n=2;
           Theileria|Rep: Putative uncharacterized protein -
           Theileria annulata
          Length = 372

 Score = 38.3 bits (85), Expect = 0.19
 Identities = 24/69 (34%), Positives = 37/69 (53%), Gaps = 2/69 (2%)
 Frame = +2

Query: 521 VLKRPHVDEFLRRCGELY*CVLFTASLAKYADPVA-DLLDRWGV-FRARLFRDSCVFHRG 694
           V KRP+ D F +     Y  V+++      A PVA D+ + WG+     + RD C   +G
Sbjct: 208 VKKRPYADNFFKELINYYEIVIWSDD----AYPVAYDIANHWGLPVIGCIHRDHCKKFKG 263

Query: 695 NYVKDLNSL 721
           +Y+KDL+ L
Sbjct: 264 SYIKDLSRL 272


>UniRef50_A0DYU6 Cluster: Chromosome undetermined scaffold_7, whole
           genome shotgun sequence; n=1; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_7,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 517

 Score = 38.3 bits (85), Expect = 0.19
 Identities = 19/66 (28%), Positives = 36/66 (54%)
 Frame = +2

Query: 524 LKRPHVDEFLRRCGELY*CVLFTASLAKYADPVADLLDRWGVFRARLFRDSCVFHRGNYV 703
           L RP+ ++FL+     +   +FTA L  YA+ + D +D+    + RL+R   + ++ ++V
Sbjct: 387 LIRPYTEQFLQEMSNYFEIAVFTAGLPDYANWILDQVDKNRHIQYRLYRQHAMQYQNHFV 446

Query: 704 KDLNSL 721
             L  L
Sbjct: 447 VVLRKL 452


>UniRef50_Q22647 Cluster: Import inner membrane translocase subunit
           TIM50, mitochondrial precursor; n=2; Caenorhabditis|Rep:
           Import inner membrane translocase subunit TIM50,
           mitochondrial precursor - Caenorhabditis elegans
          Length = 452

 Score = 38.3 bits (85), Expect = 0.19
 Identities = 24/67 (35%), Positives = 35/67 (52%), Gaps = 1/67 (1%)
 Frame = +2

Query: 524 LKRPHVDEFLRRCG-ELY*CVLFTASLAKYADPVADLLDRWGVFRARLFRDSCVFHRGNY 700
           LKRP +D FL   G   +  V++++     A PV D  D       +LFRD   +  G++
Sbjct: 272 LKRPALDYFLDVIGYPNFEVVIYSSESMMTAAPVVDSFDPKQRIMYKLFRDCTKYMNGHH 331

Query: 701 VKDLNSL 721
           VKDL+ L
Sbjct: 332 VKDLSKL 338


>UniRef50_UPI0000D56AA7 Cluster: PREDICTED: similar to CG12252-PA;
           n=1; Tribolium castaneum|Rep: PREDICTED: similar to
           CG12252-PA - Tribolium castaneum
          Length = 760

 Score = 37.9 bits (84), Expect = 0.25
 Identities = 29/96 (30%), Positives = 45/96 (46%), Gaps = 4/96 (4%)
 Frame = +2

Query: 404 KSVMVIDLDETLVHSSFKPIN-NAHFVVPVEIDGAVHQVYVLK-RPHVDEFLRRCGELY* 577
           K V+++DLD+TL+H++   I  N   +   ++ G     Y  + RP   +FL      Y 
Sbjct: 142 KLVLLVDLDQTLIHTTNDHIQPNIKDIYRFQLYGPNSPWYFTRLRPGTHQFLNNIYPFYE 201

Query: 578 CVLFTASLAKYADPVADLLDRWGVFRAR--LFRDSC 679
             + T     YA  +A +LDR   F +   L RD C
Sbjct: 202 LHICTFGARNYAHMIAAVLDRDQKFFSNRILSRDEC 237


>UniRef50_Q8NJS0 Cluster: RNA polymerase II C-terminal domain
           phosphatase component; n=2; Pleosporales|Rep: RNA
           polymerase II C-terminal domain phosphatase component -
           Leptosphaeria maculans (Blackleg fungus)
          Length = 804

 Score = 37.9 bits (84), Expect = 0.25
 Identities = 33/126 (26%), Positives = 57/126 (45%), Gaps = 20/126 (15%)
 Frame = +2

Query: 404 KSVMVIDLDETLVHSSFK---------PINNAHFVVPVEIDG-----------AVHQVYV 523
           K  +++DLD+T++H++ +         P N  H  V  +++G           A +  YV
Sbjct: 160 KLTLIVDLDQTVIHTTCERTIAEWQADPENPNHGAVK-DVEGFQLADDNVSNVAANWYYV 218

Query: 524 LKRPHVDEFLRRCGELY*CVLFTASLAKYADPVADLLDRWGVFRARLFRDSCVFHRGNYV 703
            KRP +++F +R  +LY   ++T +   YA  V  ++D       R F D  +    NY 
Sbjct: 219 KKRPGLEDFFKRMSKLYEMHVYTMATRAYAQAVCKIIDP----DRRYFGDRILSRDENYT 274

Query: 704 KDLNSL 721
               SL
Sbjct: 275 DKTKSL 280


>UniRef50_UPI00006D007D Cluster: NLI interacting factor-like
            phosphatase family protein; n=1; Tetrahymena thermophila
            SB210|Rep: NLI interacting factor-like phosphatase family
            protein - Tetrahymena thermophila SB210
          Length = 1338

 Score = 37.1 bits (82), Expect = 0.44
 Identities = 27/68 (39%), Positives = 35/68 (51%)
 Frame = +2

Query: 413  MVIDLDETLVHSSFKPINNAHFVVPVEIDGAVHQVYVLKRPHVDEFLRRCGELY*CVLFT 592
            +V+DLDETL+H  F    N          G  +Q    KRP  D+FLR   +LY  V+FT
Sbjct: 1188 LVLDLDETLIH--FYETRN----------GGQYQ----KRPFCDKFLREMSKLYELVIFT 1231

Query: 593  ASLAKYAD 616
            A    YA+
Sbjct: 1232 AGTEDYAN 1239


>UniRef50_Q7RIY6 Cluster: NLI interacting factor, putative; n=4;
           Plasmodium (Vinckeia)|Rep: NLI interacting factor,
           putative - Plasmodium yoelii yoelii
          Length = 1251

 Score = 37.1 bits (82), Expect = 0.44
 Identities = 28/102 (27%), Positives = 47/102 (46%), Gaps = 2/102 (1%)
 Frame = +2

Query: 422 DLDETLVHSSFKPINNAHFVVPVEIDGAVHQVYVLKRPHVDEFLRRCGELY*CVLFTASL 601
           DL++  + +  K   ++     V+ D  ++ +Y   RP V EFL++  + Y   L+T   
Sbjct: 397 DLNDEAIKAKIKKFESSVLKTTVKYDKGLYTIYYKLRPGVIEFLQKMNQKYEIYLYTMGT 456

Query: 602 AKYADPVADLLDRW-GVFRARLF-RDSCVFHRGNYVKDLNSL 721
            ++A     LLD     F  R+F R  C     N +K LN +
Sbjct: 457 IEHAKSCLFLLDPLKKFFGNRIFSRKDCT----NGMKHLNRI 494


>UniRef50_Q55AP7 Cluster: Putative uncharacterized protein; n=2;
           Dictyostelium discoideum|Rep: Putative uncharacterized
           protein - Dictyostelium discoideum AX4
          Length = 782

 Score = 37.1 bits (82), Expect = 0.44
 Identities = 25/99 (25%), Positives = 51/99 (51%), Gaps = 12/99 (12%)
 Frame = +2

Query: 404 KSVMVIDLDETLVHS------SFKPI-----NNAHFVVPVEIDGAVHQVYVLKRPHVDEF 550
           K  +V+DLD T++H+      +  P       N + +  + ++G ++   + KRPH+ +F
Sbjct: 135 KLSLVLDLDHTVIHAVTEQGFNSSPEWRNKDKNKNGIHTITVNGPMNYC-IKKRPHLVKF 193

Query: 551 LRRCGELY*CVLFTASLAKYADPVADLLD-RWGVFRARL 664
           L    ++Y   ++T     YA+ +A L+D    +F+ R+
Sbjct: 194 LTEVNKIYELHIYTMGTRNYANEIAKLIDPESSIFKERI 232


>UniRef50_A0CD30 Cluster: Chromosome undetermined scaffold_169,
           whole genome shotgun sequence; n=2; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_169,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 508

 Score = 37.1 bits (82), Expect = 0.44
 Identities = 22/66 (33%), Positives = 33/66 (50%)
 Frame = +2

Query: 524 LKRPHVDEFLRRCGELY*CVLFTASLAKYADPVADLLDRWGVFRARLFRDSCVFHRGNYV 703
           ++RP + E L+   E    V+FTA L  YAD     L        RL+R    F+  N+V
Sbjct: 371 IRRPGLVELLQGIKEHCEIVIFTAGLQSYADHAIAELQCDEYIDYRLYRPHTTFNGNNFV 430

Query: 704 KDLNSL 721
           KD++ +
Sbjct: 431 KDISKV 436


>UniRef50_Q3TF86 Cluster: 17 days embryo kidney cDNA, RIKEN
           full-length enriched library, clone:I920098H14
           product:hypothetical protein, full insert sequence; n=2;
           Murinae|Rep: 17 days embryo kidney cDNA, RIKEN
           full-length enriched library, clone:I920098H14
           product:hypothetical protein, full insert sequence - Mus
           musculus (Mouse)
          Length = 300

 Score = 36.7 bits (81), Expect = 0.58
 Identities = 17/43 (39%), Positives = 25/43 (58%)
 Frame = +2

Query: 389 TRTCIKSVMVIDLDETLVHSSFKPINNAHFVVPVEIDGAVHQV 517
           TR+  +  +V+DLDETLVH S   + +A    PV     ++QV
Sbjct: 231 TRSTPEFSLVLDLDETLVHCSLNELEDAALTFPVLFQDVIYQV 273


>UniRef50_Q55FU7 Cluster: Putative uncharacterized protein; n=1;
           Dictyostelium discoideum AX4|Rep: Putative
           uncharacterized protein - Dictyostelium discoideum AX4
          Length = 898

 Score = 36.7 bits (81), Expect = 0.58
 Identities = 18/63 (28%), Positives = 33/63 (52%)
 Frame = +1

Query: 16  NFTETLSPFVLRPKTNV*MDASSIITQVSRDDEQLNNYGPDRGSSPGVQHNEGDGTPVSG 195
           N   +L+P +L P  N  MD + ++ ++ +DDE+L +  P    S   QH     + V+ 
Sbjct: 687 NGAGSLTPTILIPSLNKSMDKNEMVARLKQDDERLESPKPHHTRSRSRQHLISSSSQVNS 746

Query: 196 STP 204
           ++P
Sbjct: 747 TSP 749


>UniRef50_A5K9Z0 Cluster: Putative uncharacterized protein; n=4;
           Plasmodium|Rep: Putative uncharacterized protein -
           Plasmodium vivax
          Length = 528

 Score = 36.3 bits (80), Expect = 0.76
 Identities = 22/68 (32%), Positives = 33/68 (48%), Gaps = 1/68 (1%)
 Frame = +2

Query: 521 VLKRPHVDEFLRRCGELY*CVLFTASLAKYADPVADLLDRWGV-FRARLFRDSCVFHRGN 697
           VLKRP+ D F +     Y  V+++      A    +++ +WG+     L RD C   +  
Sbjct: 354 VLKRPYADLFFKELSSFYEIVIWSDDNFPVAQ---EVISKWGIPAIGCLHRDQCSKRKRY 410

Query: 698 YVKDLNSL 721
           YVKDL  L
Sbjct: 411 YVKDLKRL 418


>UniRef50_Q2H1T0 Cluster: Predicted protein; n=1; Chaetomium
           globosum|Rep: Predicted protein - Chaetomium globosum
           (Soil fungus)
          Length = 341

 Score = 36.3 bits (80), Expect = 0.76
 Identities = 18/41 (43%), Positives = 22/41 (53%)
 Frame = +1

Query: 130 GPDRGSSPGVQHNEGDGTPVSGSTPLGGKKSSGTGGFLRSL 252
           G DRG SPG   + G G    GST +GG +    GG L S+
Sbjct: 143 GCDRGGSPGSDADAGSGWSSDGSTAVGGGEGEVDGGVLDSV 183


>UniRef50_UPI000023E490 Cluster: hypothetical protein FG06023.1;
           n=1; Gibberella zeae PH-1|Rep: hypothetical protein
           FG06023.1 - Gibberella zeae PH-1
          Length = 294

 Score = 35.9 bits (79), Expect = 1.0
 Identities = 18/46 (39%), Positives = 22/46 (47%)
 Frame = +1

Query: 100 SRDDEQLNNYGPDRGSSPGVQHNEGDGTPVSGSTPLGGKKSSGTGG 237
           S DD+  ++ G D GS  G     G GTP SGS    G   + T G
Sbjct: 220 SSDDDSSSDDGSDDGSEDGSGSGSGSGTPTSGSPLTPGSAGTPTAG 265


>UniRef50_Q01AF0 Cluster: Chromosome 04 contig 1, DNA sequence; n=1;
           Ostreococcus tauri|Rep: Chromosome 04 contig 1, DNA
           sequence - Ostreococcus tauri
          Length = 256

 Score = 35.9 bits (79), Expect = 1.0
 Identities = 25/68 (36%), Positives = 32/68 (47%), Gaps = 1/68 (1%)
 Frame = -2

Query: 396 VLVSHWR*QRSGGMFRHDQQGRRSPAVDTIGA-IASGRSLASATAPTAQQRSQEAAGPAR 220
           V ++  R + SG M     Q RR+P    + + +A  R L  A APTA  R    A PAR
Sbjct: 133 VAIASTRARASGSM-----QSRRAPVPSPVPSRVAESRDLRDARAPTASNRIDRDARPAR 187

Query: 219 FLPTQRGR 196
             P  R R
Sbjct: 188 RAPATRTR 195


>UniRef50_Q4E136 Cluster: Nuclear lim interactor-interacting factor,
           putative; n=2; Trypanosoma|Rep: Nuclear lim
           interactor-interacting factor, putative - Trypanosoma
           cruzi
          Length = 256

 Score = 35.9 bits (79), Expect = 1.0
 Identities = 32/103 (31%), Positives = 49/103 (47%)
 Frame = +2

Query: 413 MVIDLDETLVHSSFKPINNAHFVVPVEIDGAVHQVYVLKRPHVDEFLRRCGELY*CVLFT 592
           +V+DLDETLV++   P+                  YV  RP ++E  +   E    V++T
Sbjct: 52  VVLDLDETLVYAREGPL------------------YV--RPGIEELFQFLEENCESVVWT 91

Query: 593 ASLAKYADPVADLLDRWGVFRARLFRDSCVFHRGNYVKDLNSL 721
           A + +YA+ V  L+D  G     ++RDS  F   +  KDL  L
Sbjct: 92  AGMKQYAEAVVRLIDTNGSVHHTIYRDSTWFRGRSCRKDLTLL 134


>UniRef50_Q9P376 Cluster: RNA polymerase II subunit A C-terminal
           domain phosphatase; n=1; Schizosaccharomyces pombe|Rep:
           RNA polymerase II subunit A C-terminal domain
           phosphatase - Schizosaccharomyces pombe (Fission yeast)
          Length = 723

 Score = 35.9 bits (79), Expect = 1.0
 Identities = 27/104 (25%), Positives = 50/104 (48%), Gaps = 17/104 (16%)
 Frame = +2

Query: 413 MVIDLDETLVHSSFKPI--------NNAHFVVPVEI---------DGAVHQVYVLKRPHV 541
           +++DLD+T++H++  P          N ++ V  ++          G     Y+  RP +
Sbjct: 167 LIVDLDQTIIHATVDPTVGEWMSDPGNVNYDVLRDVRSFNLQEGPSGYTSCYYIKFRPGL 226

Query: 542 DEFLRRCGELY*CVLFTASLAKYADPVADLLDRWGVFRARLFRD 673
            +FL++  ELY   ++T     YA  VA ++D  G    +LF+D
Sbjct: 227 AQFLQKISELYELHIYTMGTKAYAKEVAKIIDPTG----KLFQD 266


>UniRef50_UPI0000D56B64 Cluster: PREDICTED: similar to CG2713-PA;
           n=1; Tribolium castaneum|Rep: PREDICTED: similar to
           CG2713-PA - Tribolium castaneum
          Length = 373

 Score = 35.5 bits (78), Expect = 1.3
 Identities = 20/65 (30%), Positives = 33/65 (50%)
 Frame = +2

Query: 527 KRPHVDEFLRRCGELY*CVLFTASLAKYADPVADLLDRWGVFRARLFRDSCVFHRGNYVK 706
           KRP +D FL      +  V++TA       P+ + +D   +   +L RD+  F  G++VK
Sbjct: 197 KRPGLDYFLESLHGHFEIVVYTAEQGMTVFPLIEAMDPKNLISYKLVRDATHFVGGHHVK 256

Query: 707 DLNSL 721
            L+ L
Sbjct: 257 SLDKL 261


>UniRef50_UPI00006CC9FF Cluster: NLI interacting factor-like
           phosphatase family protein; n=1; Tetrahymena thermophila
           SB210|Rep: NLI interacting factor-like phosphatase
           family protein - Tetrahymena thermophila SB210
          Length = 874

 Score = 35.5 bits (78), Expect = 1.3
 Identities = 28/85 (32%), Positives = 44/85 (51%), Gaps = 8/85 (9%)
 Frame = +2

Query: 404 KSVMVIDLDETLVHSSFKPINNAHF--VVPVEIDGAV-----HQVYVLK-RPHVDEFLRR 559
           K ++V+DLD T++H+    I NA F     ++ D        +  YV+K RP++ EFL+ 
Sbjct: 281 KLILVLDLDNTILHA-VPAIKNALFDNADGIQQDSFKEFHNRYSKYVIKFRPYMKEFLQT 339

Query: 560 CGELY*CVLFTASLAKYADPVADLL 634
               Y   +FT ++  YA  V D L
Sbjct: 340 VLPHYEIYIFTMAMLDYAKCVCDYL 364


>UniRef50_Q6CDV7 Cluster: Import inner membrane translocase subunit
           TIM50, mitochondrial precursor; n=1; Yarrowia
           lipolytica|Rep: Import inner membrane translocase
           subunit TIM50, mitochondrial precursor - Yarrowia
           lipolytica (Candida lipolytica)
          Length = 466

 Score = 35.5 bits (78), Expect = 1.3
 Identities = 24/70 (34%), Positives = 33/70 (47%), Gaps = 1/70 (1%)
 Frame = +2

Query: 509 HQVYVLKRPHVDEFLRRCGELY*CVLFTASLAKYADPVADLLDRWGV-FRARLFRDSCVF 685
           H   V KRP VD FL   G+ Y  VLF++      + +   LD +   F   L R+   +
Sbjct: 212 HGWRVAKRPGVDYFLGYLGQYYEIVLFSSQYMANCEKLIMKLDPYHAWFSHVLTREHTTY 271

Query: 686 HRGNYVKDLN 715
             G  VKDL+
Sbjct: 272 EDGKLVKDLS 281


>UniRef50_UPI00006CCA92 Cluster: hypothetical protein TTHERM_00283920;
            n=1; Tetrahymena thermophila SB210|Rep: hypothetical
            protein TTHERM_00283920 - Tetrahymena thermophila SB210
          Length = 1676

 Score = 34.7 bits (76), Expect = 2.3
 Identities = 18/36 (50%), Positives = 18/36 (50%)
 Frame = +1

Query: 130  GPDRGSSPGVQHNEGDGTPVSGSTPLGGKKSSGTGG 237
            G     S G   N G GT  SGST  GG  SSG GG
Sbjct: 1186 GTGGSGSTGASGNSGTGTGGSGSTGKGGSGSSGKGG 1221


>UniRef50_Q4SUU0 Cluster: Chromosome undetermined SCAF13842, whole
           genome shotgun sequence; n=2; Tetraodon
           nigroviridis|Rep: Chromosome undetermined SCAF13842,
           whole genome shotgun sequence - Tetraodon nigroviridis
           (Green puffer)
          Length = 783

 Score = 34.3 bits (75), Expect = 3.1
 Identities = 17/36 (47%), Positives = 17/36 (47%)
 Frame = +1

Query: 130 GPDRGSSPGVQHNEGDGTPVSGSTPLGGKKSSGTGG 237
           GPD GS PG   N GD     GS   GG    G GG
Sbjct: 557 GPDAGSPPGADGNRGDEGGGGGSGGSGGGGGGGGGG 592


>UniRef50_Q6C770 Cluster: Yarrowia lipolytica chromosome E of strain
           CLIB 122 of Yarrowia lipolytica; n=1; Yarrowia
           lipolytica|Rep: Yarrowia lipolytica chromosome E of
           strain CLIB 122 of Yarrowia lipolytica - Yarrowia
           lipolytica (Candida lipolytica)
          Length = 750

 Score = 34.3 bits (75), Expect = 3.1
 Identities = 15/40 (37%), Positives = 23/40 (57%)
 Frame = +2

Query: 518 YVLKRPHVDEFLRRCGELY*CVLFTASLAKYADPVADLLD 637
           YV  RPH+ EFL    E Y   ++T +   YA  +A+++D
Sbjct: 234 YVKLRPHLKEFLEVVSEKYELHIYTMATRAYAKAIAEIID 273


>UniRef50_UPI00006CB701 Cluster: NLI interacting factor-like
           phosphatase family protein; n=1; Tetrahymena thermophila
           SB210|Rep: NLI interacting factor-like phosphatase
           family protein - Tetrahymena thermophila SB210
          Length = 329

 Score = 33.9 bits (74), Expect = 4.1
 Identities = 23/68 (33%), Positives = 34/68 (50%), Gaps = 1/68 (1%)
 Frame = +2

Query: 521 VLKRPHVDEFLRRCGELY*CVLFTASLAKYADPVADLLD-RWGVFRARLFRDSCVFHRGN 697
           + KRP ++EFL R  E Y  V+     + + D V   LD    +F     +++ VF  G 
Sbjct: 149 IKKRPGLNEFLNRLSEHYEIVILADEDSFFVDEVRQHLDPNQRIFFNGFGKEAMVF-EGK 207

Query: 698 YVKDLNSL 721
           Y KDL+ L
Sbjct: 208 YYKDLSYL 215


>UniRef50_Q1FIZ6 Cluster: Phosphoesterase,
           RecJ-like:Phosphoesterase, DHHA1; n=2;
           Clostridiales|Rep: Phosphoesterase,
           RecJ-like:Phosphoesterase, DHHA1 - Clostridium
           phytofermentans ISDg
          Length = 324

 Score = 33.9 bits (74), Expect = 4.1
 Identities = 18/55 (32%), Positives = 32/55 (58%)
 Frame = +2

Query: 392 RTCIKSVMVIDLDETLVHSSFKPINNAHFVVPVEIDGAVHQVYVLKRPHVDEFLR 556
           R  ++S++++D  + +V S  K   N + VVP ++DG + Q+ + K   V  FLR
Sbjct: 207 RCLLESILLLD-GKIIVSSISKRAQNFYNVVPSDLDGVIDQLRITKGVEVAIFLR 260


>UniRef50_Q54IJ8 Cluster: Putative uncharacterized protein; n=1;
           Dictyostelium discoideum AX4|Rep: Putative
           uncharacterized protein - Dictyostelium discoideum AX4
          Length = 985

 Score = 33.9 bits (74), Expect = 4.1
 Identities = 21/83 (25%), Positives = 40/83 (48%), Gaps = 5/83 (6%)
 Frame = +2

Query: 404 KSVMVIDLDETLVHSSFKPINNAHFVVPVEIDGAV-----HQVYVLKRPHVDEFLRRCGE 568
           K  +++D+D TL+HS+  P   ++++    I+           YV +RP+  EFL     
Sbjct: 574 KMYLIVDIDHTLLHSTKDPNAESYYLKDNSINKFTITETNETFYVKQRPNAIEFLSSLSS 633

Query: 569 LY*CVLFTASLAKYADPVADLLD 637
            +   L++     Y + +A +LD
Sbjct: 634 QFKIYLYSFHPKYYVEQLALILD 656


>UniRef50_Q01916 Cluster: IpiB3 protein precursor; n=3; Phytophthora
           infestans|Rep: IpiB3 protein precursor - Phytophthora
           infestans (Potato late blight fungus)
          Length = 347

 Score = 33.5 bits (73), Expect = 5.4
 Identities = 16/36 (44%), Positives = 20/36 (55%)
 Frame = +1

Query: 130 GPDRGSSPGVQHNEGDGTPVSGSTPLGGKKSSGTGG 237
           G   G++ GV  N G G  V GS  +GG  S+G GG
Sbjct: 261 GASGGANGGVSANAGVGGGVGGSAGVGGAASTGVGG 296


>UniRef50_A5AFP2 Cluster: Putative uncharacterized protein; n=1;
           Vitis vinifera|Rep: Putative uncharacterized protein -
           Vitis vinifera (Grape)
          Length = 147

 Score = 33.5 bits (73), Expect = 5.4
 Identities = 14/52 (26%), Positives = 30/52 (57%)
 Frame = +2

Query: 515 VYVLKRPHVDEFLRRCGELY*CVLFTASLAKYADPVADLLDRWGVFRARLFR 670
           +Y+ +RP +  F  R  E++  ++FTA+ + YA+ + D ++  G     ++R
Sbjct: 89  IYMRQRPFLPIFFSRVAEMFEIIVFTANQSIYAEQLLDKMEGVGYTNIAVYR 140


>UniRef50_Q4D0U8 Cluster: Putative uncharacterized protein; n=2;
           Trypanosoma cruzi|Rep: Putative uncharacterized protein
           - Trypanosoma cruzi
          Length = 396

 Score = 33.5 bits (73), Expect = 5.4
 Identities = 14/44 (31%), Positives = 25/44 (56%)
 Frame = +1

Query: 103 RDDEQLNNYGPDRGSSPGVQHNEGDGTPVSGSTPLGGKKSSGTG 234
           +  +Q + + P     PGV+H EG+GT +SG+  + G  ++  G
Sbjct: 251 QQQQQQHRFQPYNLPPPGVRHGEGEGTTISGNEVVLGTTAAHVG 294


>UniRef50_Q22WR0 Cluster: NLI interacting factor-like phosphatase
           family protein; n=1; Tetrahymena thermophila SB210|Rep:
           NLI interacting factor-like phosphatase family protein -
           Tetrahymena thermophila SB210
          Length = 901

 Score = 33.5 bits (73), Expect = 5.4
 Identities = 24/81 (29%), Positives = 41/81 (50%), Gaps = 4/81 (4%)
 Frame = +2

Query: 410 VMVIDLDETLVHSSF--KPINNAHFVVPVEIDGAVHQ--VYVLKRPHVDEFLRRCGELY* 577
           ++++DLD TLVHS      I         +I+  V+Q  +Y+ +RP++ EF     + + 
Sbjct: 500 ILILDLDNTLVHSYMGGPSILGKGDPTVNKIETHVNQQKLYIKRRPYLKEFFEVAFKNFK 559

Query: 578 CVLFTASLAKYADPVADLLDR 640
            V++T     YA  V  LL +
Sbjct: 560 VVMYTLGSLGYAKAVYYLLKK 580


>UniRef50_UPI000150A05F Cluster: NLI interacting factor-like
           phosphatase family protein; n=1; Tetrahymena thermophila
           SB210|Rep: NLI interacting factor-like phosphatase
           family protein - Tetrahymena thermophila SB210
          Length = 926

 Score = 33.1 bits (72), Expect = 7.1
 Identities = 16/52 (30%), Positives = 27/52 (51%), Gaps = 1/52 (1%)
 Frame = +2

Query: 530 RPHVDEFLRRCGELY*CVLFTASLAKYADPVADLLDRWG-VFRARLFRDSCV 682
           RPH  + L+   + +  +L TA+   YAD V   LD    +F  + +R+ C+
Sbjct: 756 RPHAQQILQELSKDFELILLTAARKIYADAVLQKLDPENKIFSHKFYRECCI 807


>UniRef50_UPI0000E7FEB9 Cluster: PREDICTED: hypothetical protein;
           n=1; Gallus gallus|Rep: PREDICTED: hypothetical protein
           - Gallus gallus
          Length = 197

 Score = 33.1 bits (72), Expect = 7.1
 Identities = 18/40 (45%), Positives = 22/40 (55%)
 Frame = -2

Query: 333 RRSPAVDTIGAIASGRSLASATAPTAQQRSQEAAGPARFL 214
           R +PAV T  AIA+G+ L    A     R + AAGP R L
Sbjct: 60  RTAPAVKTHCAIAAGKPLPGEGAAVPLGREEAAAGPGRLL 99


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 744,344,467
Number of Sequences: 1657284
Number of extensions: 16065119
Number of successful extensions: 53733
Number of sequences better than 10.0: 265
Number of HSP's better than 10.0 without gapping: 49233
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 53484
length of database: 575,637,011
effective HSP length: 98
effective length of database: 413,223,179
effective search space used: 58264468239
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).