SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= cesb0013
         (823 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_Q9A749 Cluster: Ribonuclease, Rne/Rng family protein; n...    38   0.40 
UniRef50_Q2PC83 Cluster: Putative polyketide synthase; n=2; Acti...    36   0.93 
UniRef50_UPI0000D5610B Cluster: PREDICTED: similar to CG14066-PA...    36   1.6  
UniRef50_Q7UK42 Cluster: Excinuclease ABC subunit A; n=1; Pirell...    36   1.6  
UniRef50_A5NU23 Cluster: YdjC family protein; n=2; Methylobacter...    35   2.8  
UniRef50_A2R1D0 Cluster: Similarity to CSI2 like protein CAC2873...    35   2.8  
UniRef50_A4R8Y6 Cluster: Putative uncharacterized protein; n=1; ...    34   3.7  
UniRef50_Q9DW74 Cluster: PR121; n=1; Rat cytomegalovirus Maastri...    34   4.9  
UniRef50_P78993 Cluster: Putative uncharacterized protein; n=1; ...    33   6.5  
UniRef50_UPI000049978B Cluster: short chain dehydrogenase family...    33   8.6  
UniRef50_Q4Q996 Cluster: Protein kinase, putative; n=3; Leishman...    33   8.6  
UniRef50_A7T6Q7 Cluster: Predicted protein; n=1; Nematostella ve...    33   8.6  

>UniRef50_Q9A749 Cluster: Ribonuclease, Rne/Rng family protein; n=3;
           Alphaproteobacteria|Rep: Ribonuclease, Rne/Rng family
           protein - Caulobacter crescentus (Caulobacter
           vibrioides)
          Length = 898

 Score = 37.5 bits (83), Expect = 0.40
 Identities = 24/64 (37%), Positives = 33/64 (51%)
 Frame = +1

Query: 463 GGESNKENIEAHAEEALDAPPRPDIEEEEGFVPVISHGRRPGKNRRDRERKAPPRAHKTP 642
           GGES ++  E   + A +A PRP+  E E   P    GRR G++R  R+R   P A  T 
Sbjct: 710 GGESRRQAPEPRVDAATEAAPRPERAEREE-RPGRERGRR-GRDRGRRQRDEAPVAEMTS 767

Query: 643 QQHA 654
            + A
Sbjct: 768 VESA 771


>UniRef50_Q2PC83 Cluster: Putative polyketide synthase; n=2;
            Actinomycetales|Rep: Putative polyketide synthase -
            Streptomyces achromogenes subsp. rubradiris
          Length = 5349

 Score = 36.3 bits (80), Expect = 0.93
 Identities = 29/90 (32%), Positives = 41/90 (45%)
 Frame = +1

Query: 388  SGGVMAARVSAEGAGPSYASVLNFKGGESNKENIEAHAEEALDAPPRPDIEEEEGFVPVI 567
            +G    A VS+ G G + A V+  + GE   E+ +  A+E +   P  D   +EG VPV 
Sbjct: 3094 AGQPRRAGVSSFGIGGTNAHVILEEAGE---ESAQHDADEMMTGDPALDRPSDEGCVPVP 3150

Query: 568  SHGRRPGKNRRDRERKAPPRAHKTPQQHAD 657
              GR P   R    R A   A +   + AD
Sbjct: 3151 VSGRTPAALRAQAGRLADFVASRPELEPAD 3180


>UniRef50_UPI0000D5610B Cluster: PREDICTED: similar to CG14066-PA,
           isoform A; n=1; Tribolium castaneum|Rep: PREDICTED:
           similar to CG14066-PA, isoform A - Tribolium castaneum
          Length = 1094

 Score = 35.5 bits (78), Expect = 1.6
 Identities = 28/78 (35%), Positives = 43/78 (55%), Gaps = 11/78 (14%)
 Frame = +1

Query: 415 SAEGAGPSYA-SVLNFKGGE-SNKENI-EAHAE-------EALDAP-PRPDIEEEEGFVP 561
           S++  G SYA +VLNFK    SNKENI E   E       E + +P P+   ++ + F P
Sbjct: 22  SSDNPGASYAHAVLNFKQNHNSNKENIAERQTEHSAATKPEKVSSPEPQDPKDDSDNFTP 81

Query: 562 VISHGRRPGKNRRDRERK 615
           V +H R+  K+ + ++ K
Sbjct: 82  VPTHSRKDRKHDQLKKDK 99


>UniRef50_Q7UK42 Cluster: Excinuclease ABC subunit A; n=1; Pirellula
           sp.|Rep: Excinuclease ABC subunit A - Rhodopirellula
           baltica
          Length = 839

 Score = 35.5 bits (78), Expect = 1.6
 Identities = 20/71 (28%), Positives = 36/71 (50%)
 Frame = +1

Query: 382 RDSGGVMAARVSAEGAGPSYASVLNFKGGESNKENIEAHAEEALDAPPRPDIEEEEGFVP 561
           RD+  V++  VS  G        L  +G     +++  +A + LDA PRPD++  +G  P
Sbjct: 29  RDAITVISG-VSGSGKSSLAFDTLFAEGQRQYIDSLSTYARQYLDAIPRPDVDWIDGLAP 87

Query: 562 VISHGRRPGKN 594
            +S  ++ G +
Sbjct: 88  TLSIDQKSGSH 98


>UniRef50_A5NU23 Cluster: YdjC family protein; n=2; Methylobacterium
           sp. 4-46|Rep: YdjC family protein - Methylobacterium sp.
           4-46
          Length = 292

 Score = 34.7 bits (76), Expect = 2.8
 Identities = 26/65 (40%), Positives = 34/65 (52%), Gaps = 3/65 (4%)
 Frame = +1

Query: 277 NSHQNCWVNPQHGLLKHGCALVIASRRGARARTYIRDSGGVMA---ARVSAEGAGPSYAS 447
           + HQ+  V P  GL   G  L + +RRG   RT++RD G  +A   AR SA  AG   A 
Sbjct: 129 DGHQHVHVLP--GL--RGALLAVLARRGLAGRTWLRDPGDRLAALLARPSAPKAGLVRAL 184

Query: 448 VLNFK 462
            L F+
Sbjct: 185 ALGFR 189


>UniRef50_A2R1D0 Cluster: Similarity to CSI2 like protein CAC28732.1
           -Neurospora crassa precursor; n=5; Trichocomaceae|Rep:
           Similarity to CSI2 like protein CAC28732.1 -Neurospora
           crassa precursor - Aspergillus niger
          Length = 819

 Score = 34.7 bits (76), Expect = 2.8
 Identities = 20/48 (41%), Positives = 25/48 (52%)
 Frame = +2

Query: 539 KRRRASYRSSLMDGVLVKTGGTGNGKHPRELIKHHNSMLTLSPQRSNS 682
           KRR  S RS+   GV ++  G G   H R   +HH S  T +P  SNS
Sbjct: 176 KRRSRSRRSTSGPGVTLEKSGAGGHHHHRHSHRHHRSPSTKTPS-SNS 222


>UniRef50_A4R8Y6 Cluster: Putative uncharacterized protein; n=1;
            Magnaporthe grisea|Rep: Putative uncharacterized protein
            - Magnaporthe grisea (Rice blast fungus) (Pyricularia
            grisea)
          Length = 897

 Score = 34.3 bits (75), Expect = 3.7
 Identities = 25/86 (29%), Positives = 37/86 (43%)
 Frame = +1

Query: 334  ALVIASRRGARARTYIRDSGGVMAARVSAEGAGPSYASVLNFKGGESNKENIEAHAEEAL 513
            A VI SR    +      SGGV A RV  E    ++   L F GG++++    A     L
Sbjct: 779  APVIVSRLTRLSVAVAPRSGGVDAVRVRLEAGSNAHRRELAFSGGDTHEFVDAARGARTL 838

Query: 514  DAPPRPDIEEEEGFVPVISHGRRPGK 591
            +    P + + EG + V+      GK
Sbjct: 839  EVDVDPGLAQREGGLWVVIEQMGGGK 864


>UniRef50_Q9DW74 Cluster: PR121; n=1; Rat cytomegalovirus
           Maastricht|Rep: PR121 - Rat cytomegalovirus (strain
           Maastricht)
          Length = 533

 Score = 33.9 bits (74), Expect = 4.9
 Identities = 21/64 (32%), Positives = 28/64 (43%), Gaps = 3/64 (4%)
 Frame = +1

Query: 469 ESNKENIEAHAEEALDAPPRPDIEEEEGFVPVISHGRRPGKNRRDRERKAPP-RAHKTP- 642
           E NKE +  H  +    P  P +    G    +S G +  K RR   RK PP +  + P 
Sbjct: 429 EQNKEAVSPHERKDTSPPSSPSLTPNTGS-ETLSEGAKNEKMRRQSRRKRPPQQVRQLPR 487

Query: 643 -QQH 651
            QQH
Sbjct: 488 DQQH 491


>UniRef50_P78993 Cluster: Putative uncharacterized protein; n=1;
           Saccharomyces pastorianus|Rep: Putative uncharacterized
           protein - Saccharomyces pastorianus (Lager yeast)
           (Saccharomycescarlsbergensis)
          Length = 193

 Score = 33.5 bits (73), Expect = 6.5
 Identities = 19/54 (35%), Positives = 26/54 (48%)
 Frame = +1

Query: 469 ESNKENIEAHAEEALDAPPRPDIEEEEGFVPVISHGRRPGKNRRDRERKAPPRA 630
           E N+EN E   +E   A P P  ++  G  P  + G+ PGK       KAP +A
Sbjct: 81  EKNEENTEEVEDEEKAATPSPQGKKTPGKAPGKAPGKAPGKAPGKAPGKAPGKA 134


>UniRef50_UPI000049978B Cluster: short chain dehydrogenase family
           protein; n=1; Entamoeba histolytica HM-1:IMSS|Rep: short
           chain dehydrogenase family protein - Entamoeba
           histolytica HM-1:IMSS
          Length = 305

 Score = 33.1 bits (72), Expect = 8.6
 Identities = 20/53 (37%), Positives = 30/53 (56%), Gaps = 2/53 (3%)
 Frame = +2

Query: 545 RRASYRSSLMDGVLVKTGGT-GNG-KHPRELIKHHNSMLTLSPQRSNSNKLQN 697
           R+      L D V+V TGGT G G    REL+KHH ++++ S   S + ++ N
Sbjct: 24  RQNLVEKDLKDKVVVLTGGTHGMGIALVRELLKHHATVVSFSRNESLAQRISN 76


>UniRef50_Q4Q996 Cluster: Protein kinase, putative; n=3;
           Leishmania|Rep: Protein kinase, putative - Leishmania
           major
          Length = 1311

 Score = 33.1 bits (72), Expect = 8.6
 Identities = 24/65 (36%), Positives = 29/65 (44%), Gaps = 2/65 (3%)
 Frame = +1

Query: 322 KHGCALVIASRRGA--RARTYIRDSGGVMAARVSAEGAGPSYASVLNFKGGESNKENIEA 495
           K G A V AS  G   R RT +R +G V A  V++   GP       F GG S    + A
Sbjct: 723 KGGTAGVAASGTGRLERVRTVVR-AGSVSARNVASRQRGPREKFAATFAGGSSFSSKVAA 781

Query: 496 HAEEA 510
            A  A
Sbjct: 782 SASSA 786


>UniRef50_A7T6Q7 Cluster: Predicted protein; n=1; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 381

 Score = 33.1 bits (72), Expect = 8.6
 Identities = 15/38 (39%), Positives = 20/38 (52%)
 Frame = -2

Query: 234 ITNRTQKHGFTN*FDRNW*HTTLTLAGPYLHQKNSLPS 121
           IT  TQ H  TN     + H T+T+   Y H  N++PS
Sbjct: 229 ITTPTQYHHDTNTIPSQYHHNTITIPSQYHHNTNTIPS 266


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 801,888,808
Number of Sequences: 1657284
Number of extensions: 16363481
Number of successful extensions: 63585
Number of sequences better than 10.0: 12
Number of HSP's better than 10.0 without gapping: 58027
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 63369
length of database: 575,637,011
effective HSP length: 100
effective length of database: 409,908,611
effective search space used: 70914189703
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).