SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= cesb0011
         (939 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_Q9H074 Cluster: Polyadenylate-binding protein-interacti...    60   2e-10
UniRef50_Q174D5 Cluster: Putative uncharacterized protein; n=2; ...    67   7e-10
UniRef50_Q4RSP5 Cluster: Chromosome 12 SCAF14999, whole genome s...    63   1e-08
UniRef50_A4FSE8 Cluster: Putative uncharacterized protein; n=1; ...    62   3e-08
UniRef50_Q7K581 Cluster: SD01637p; n=1; Drosophila melanogaster|...    57   7e-07
UniRef50_A7RXB2 Cluster: Predicted protein; n=1; Nematostella ve...    53   1e-05
UniRef50_UPI0000E4608E Cluster: PREDICTED: similar to poly(A) bi...    46   0.002
UniRef50_Q9VPK5 Cluster: CG4648-PA; n=3; Sophophora|Rep: CG4648-...    39   0.21 
UniRef50_Q7QC87 Cluster: ENSANGP00000021865; n=1; Anopheles gamb...    38   0.49 
UniRef50_A4R2G7 Cluster: Putative uncharacterized protein; n=1; ...    38   0.49 
UniRef50_A7S0M4 Cluster: Predicted protein; n=4; Eumetazoa|Rep: ...    37   0.64 
UniRef50_O67418 Cluster: Oxygen-independent coproporphyrinogen I...    37   0.85 
UniRef50_Q7PYX6 Cluster: ENSANGP00000019142; n=1; Anopheles gamb...    37   0.85 
UniRef50_Q6BST2 Cluster: Similar to CA4421|CaTAF19 Candida albic...    37   0.85 
UniRef50_UPI0000F1E2F0 Cluster: PREDICTED: similar to mFLJ00150 ...    36   1.1  
UniRef50_A3R6T0 Cluster: Erythrocyte membrane protein 1; n=14; P...    36   1.1  
UniRef50_Q8JJG5 Cluster: E1; n=1; Psittacus erithacus timneh pap...    36   2.0  
UniRef50_UPI0000DB6FC8 Cluster: PREDICTED: similar to turtle CG1...    35   2.6  
UniRef50_A2RVF5 Cluster: IP16971p; n=3; Sophophora|Rep: IP16971p...    35   2.6  
UniRef50_UPI0000499259 Cluster: hypothetical protein 388.t00006;...    35   3.4  
UniRef50_Q4RG15 Cluster: Chromosome 2 SCAF15106, whole genome sh...    35   3.4  
UniRef50_Q30T76 Cluster: Putative uncharacterized protein; n=1; ...    35   3.4  
UniRef50_A3EPE8 Cluster: Cation-transporting ATPase; n=1; Leptos...    35   3.4  
UniRef50_A7SIV8 Cluster: Predicted protein; n=1; Nematostella ve...    35   3.4  
UniRef50_A2QDU3 Cluster: Remark: the protein is only the half of...    35   3.4  
UniRef50_Q245S7 Cluster: BZIP transcription factor family protei...    34   4.5  
UniRef50_A2EJ16 Cluster: Putative uncharacterized protein; n=1; ...    34   4.5  
UniRef50_UPI00003C0619 Cluster: PREDICTED: similar to CG14801-PB...    34   6.0  
UniRef50_A6WEX5 Cluster: Cell envelope-related transcriptional a...    34   6.0  
UniRef50_Q4XZ20 Cluster: Putative uncharacterized protein; n=1; ...    34   6.0  
UniRef50_Q172F5 Cluster: Putative uncharacterized protein; n=1; ...    34   6.0  
UniRef50_UPI000155367C Cluster: PREDICTED: similar to hCG1732289...    33   7.9  
UniRef50_Q6R796 Cluster: ORF117; n=1; Ostreid herpesvirus 1|Rep:...    33   7.9  
UniRef50_Q9M1M3 Cluster: Putative uncharacterized protein T32A11...    33   7.9  
UniRef50_A4RRC9 Cluster: Predicted protein; n=2; Ostreococcus|Re...    33   7.9  

>UniRef50_Q9H074 Cluster: Polyadenylate-binding protein-interacting
           protein 1 (Poly(A)-binding protein-interacting protein
           1); n=36; Euteleostomi|Rep: Polyadenylate-binding
           protein-interacting protein 1 (Poly(A)-binding
           protein-interacting protein 1) - Homo sapiens (Human)
          Length = 479

 Score = 60.1 bits (139), Expect(2) = 2e-10
 Identities = 33/114 (28%), Positives = 55/114 (48%), Gaps = 5/114 (4%)
 Frame = +1

Query: 544 ITFDPGKFDTLCGPLVDSFASTLNDESYTRPLVDAIVNQSIGEANFRYNGARLCS--MYD 717
           +T  PG F+T      ++    +  +   + LV+ I  Q+    NF Y GARLC+   + 
Sbjct: 169 LTEQPGSFETEIEQFAETLNGCVTTDDALQELVELIYQQATSIPNFSYMGARLCNYLSHH 228

Query: 718 SVAQPEESVFRECLLERCSVE---ENKIISGLETSEENMRGFAMFLAEIILSFE 870
               P+   FR+ LL+RC  E   +++   G E + +    F +FL E+ L+ E
Sbjct: 229 LTISPQSGNFRQLLLQRCRTEYEVKDQAAKGDEVTRKRFHAFVLFLGELYLNLE 282



 Score = 29.1 bits (62), Expect(2) = 2e-10
 Identities = 16/47 (34%), Positives = 22/47 (46%)
 Frame = +1

Query: 304 SKLSADAKEWYPANYTSQALPAYNTEPAPYRPSRPSVQGRLRQAQDQ 444
           SKLS +A E+YP+ Y+S    +Y      Y      VQ  L    +Q
Sbjct: 126 SKLSVNAPEFYPSGYSSSYTESYEDGCEDYPTLSEYVQDFLNHLTEQ 172


>UniRef50_Q174D5 Cluster: Putative uncharacterized protein; n=2;
           Aedes aegypti|Rep: Putative uncharacterized protein -
           Aedes aegypti (Yellowfever mosquito)
          Length = 604

 Score = 66.9 bits (156), Expect = 7e-10
 Identities = 37/113 (32%), Positives = 60/113 (53%)
 Frame = +1

Query: 523 LITVMCEITFDPGKFDTLCGPLVDSFASTLNDESYTRPLVDAIVNQSIGEANFRYNGARL 702
           L  V+ E+  +PG FD++   L  +FA   N+       V+ I  QSI E NFRY GARL
Sbjct: 309 LTEVIAELYDNPGMFDSIQRKLKGTFAEFRNNHFVLSNAVELIFEQSIKEQNFRYMGARL 368

Query: 703 CSMYDSVAQPEESVFRECLLERCSVEENKIISGLETSEENMRGFAMFLAEIIL 861
           C + DS+      V  + L  + S +++++   +   +  +RG  +FLAE+ +
Sbjct: 369 CKLLDSLDGDPAGVLWQLLSMKMSHQQSELHGFMTNQQIKVRGTTLFLAELYM 421


>UniRef50_Q4RSP5 Cluster: Chromosome 12 SCAF14999, whole genome
           shotgun sequence; n=2; Tetraodontidae|Rep: Chromosome 12
           SCAF14999, whole genome shotgun sequence - Tetraodon
           nigroviridis (Green puffer)
          Length = 474

 Score = 62.9 bits (146), Expect = 1e-08
 Identities = 39/126 (30%), Positives = 62/126 (49%), Gaps = 6/126 (4%)
 Frame = +1

Query: 511 NIANLIT-VMCEITFDPGKFDTLCGPLVDSFASTLNDESYTRPLVDAIVNQSIGEANFRY 687
           ++A+ +T  +  ++  PG FD+  G + D+  S +  E     LV  I  QS    NF Y
Sbjct: 133 SLADTVTEFLGHLSTSPGSFDSDIGYISDTLNSWVTTEETLNELVGLIFTQSTTIPNFSY 192

Query: 688 NGARLCS--MYDSVAQPEESVFRECLLERCSVE---ENKIISGLETSEENMRGFAMFLAE 852
            GARLC+   +     P    FR+ LL+RC VE    +    G   +++ +  F +FL E
Sbjct: 193 TGARLCNYLSHHLTINPPSGNFRQLLLKRCQVEYQQRDAAARGDADAQKKLHSFVLFLGE 252

Query: 853 IILSFE 870
           + L+ E
Sbjct: 253 LYLNLE 258


>UniRef50_A4FSE8 Cluster: Putative uncharacterized protein; n=1;
           Thermobia domestica|Rep: Putative uncharacterized
           protein - Thermobia domestica (firebrat)
          Length = 105

 Score = 61.7 bits (143), Expect = 3e-08
 Identities = 36/92 (39%), Positives = 52/92 (56%), Gaps = 2/92 (2%)
 Frame = +1

Query: 637 LVDAIVNQSIGEANFRYNGARLCSM--YDSVAQPEESVFRECLLERCSVEENKIISGLET 810
           +V+ I  QS+ E+NFRYNGARL S   Y  + Q + + FR  LL RC+ E  +    + +
Sbjct: 15  IVNVIFEQSVVESNFRYNGARLRSYLSYQGI-QVDGTNFRTLLLHRCNDEHRRREELILS 73

Query: 811 SEENMRGFAMFLAEIILSFEDSQGGRIRLSVK 906
           S +   GF +F AE+ L  E  +G   RL V+
Sbjct: 74  SPQRFHGFVLFQAELYLQLEPVKGSGERLEVR 105


>UniRef50_Q7K581 Cluster: SD01637p; n=1; Drosophila
           melanogaster|Rep: SD01637p - Drosophila melanogaster
           (Fruit fly)
          Length = 559

 Score = 56.8 bits (131), Expect = 7e-07
 Identities = 40/181 (22%), Positives = 81/181 (44%), Gaps = 5/181 (2%)
 Frame = +1

Query: 370 YNTEPAPYRPSRPSVQGRLRQAQDQNPYNLDDMSYSLEEAENMDLREN----IANLITVM 537
           +N    P+       Q +  Q Q+Q P      + +   + N    +     +  L TV+
Sbjct: 218 HNQPQQPHHQQHNQQQQQYIQNQNQQPQPSTSTAAASSSSSNSSQPDMATIALEYLDTVI 277

Query: 538 CEITFDPGKFDTLCGPLVDSFASTLNDESYTRPLVDAIVNQSIGEANFRYNGARLCSMYD 717
             +  +PG+FD++    +  F    N++      ++ I  +SI + NFRY GA+L ++  
Sbjct: 278 HCLNQNPGQFDSIASRFLTIFDGMENNQFVLSIAMEDIFEKSIEQPNFRYMGAKLYNLLH 337

Query: 718 SVAQPEESVFRECLLERCSVEENKIISGLETSE-ENMRGFAMFLAEIILSFEDSQGGRIR 894
            +    +S+F   L  +    + ++   + ++E + +R  A+FLAE+ +        RI+
Sbjct: 338 MLNSKPDSLFHTLLKCKLDYHQEEVTKYMRSNEQQKVRETALFLAELYMQLRGDDDSRIQ 397

Query: 895 L 897
           L
Sbjct: 398 L 398


>UniRef50_A7RXB2 Cluster: Predicted protein; n=1; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 438

 Score = 52.8 bits (121), Expect = 1e-05
 Identities = 52/202 (25%), Positives = 81/202 (40%), Gaps = 7/202 (3%)
 Frame = +1

Query: 205 PKGRGRGWQMNNQARELRRPKAVSDEPKVDTSKSKLSADAKEWYPANYTSQALPAYNTEP 384
           P   GRG    +    LR+P   S     D  K  +  +  +  P   TS  L   N   
Sbjct: 5   PHSLGRGISSKDYTSPLRKPGEPSQNQ--DGGKEPIGIE-NDSIPTKGTSSKL---NVNA 58

Query: 385 APYRPSRPSVQGRLRQAQDQNPYNLDDMSYSLEEAENMDLRENIANLITVMCEITFDPGK 564
           A + P        +  +Q   P   +  + S  +    DL E +  +  ++ ++T  PG+
Sbjct: 59  AEFVPEMFKAPQYVPTSQAMPPPQTEQATPS-PQTTGPDL-EAVTFVKDILDQLTESPGE 116

Query: 565 FDTLCGPLVDSFASTLNDESYTRPLVDAIVNQ----SIGEANFRYNGARLCSMYDSVAQ- 729
           F+ L   LV ++ + +N++     +   I+ Q    SI E+NF Y GARLC    +    
Sbjct: 117 FENLVEDLVLAWKARVNNDETLNEIASVIMEQVLVYSILESNFTYTGARLCDFIANNTDD 176

Query: 730 --PEESVFRECLLERCSVEENK 789
              E   FR   L RC  E  K
Sbjct: 177 IPTEGKQFRSVFLTRCKEEHRK 198


>UniRef50_UPI0000E4608E Cluster: PREDICTED: similar to poly(A)
           binding protein interacting protein 1; n=1;
           Strongylocentrotus purpuratus|Rep: PREDICTED: similar to
           poly(A) binding protein interacting protein 1 -
           Strongylocentrotus purpuratus
          Length = 379

 Score = 45.6 bits (103), Expect = 0.002
 Identities = 27/117 (23%), Positives = 54/117 (46%), Gaps = 4/117 (3%)
 Frame = +1

Query: 532 VMCEITFDPGKFDTLCGPLVDSFASTLNDESYTRPLVDAIVNQSIGEANFRYNGARLCS- 708
           ++ +++ +PG F      L D  +  + ++     + D I  QS  E NF Y GAR+   
Sbjct: 36  ILYQLSINPGLFQECMNSLTDILSVAIREDWQLDEVADVIFEQSTMEPNFTYTGARMVDH 95

Query: 709 MYDSVAQPEESVFRECLLERCS---VEENKIISGLETSEENMRGFAMFLAEIILSFE 870
           +Y ++  P        L+ + +   V   K ++     ++ + G  MF+AE+ ++ E
Sbjct: 96  LYRNLPNPPGRRHMRTLINQRAKNVVVRRKEMALDPAQQKRLHGVTMFMAELFMNME 152


>UniRef50_Q9VPK5 Cluster: CG4648-PA; n=3; Sophophora|Rep: CG4648-PA
           - Drosophila melanogaster (Fruit fly)
          Length = 953

 Score = 38.7 bits (86), Expect = 0.21
 Identities = 23/68 (33%), Positives = 37/68 (54%)
 Frame = +2

Query: 644 MPLLISQSAKQISGTMELVCVQCTIQWRNLRSLYSASACSSAVPLRKTRLSAAWKLQRRI 823
           M  LI   A+ +   M + C+Q T   RNLRS  + ++C +A  L   + ++   LQ+  
Sbjct: 755 MVRLIRYHAETLDNQMHMTCIQLTRSVRNLRSQVARASCQAAAELFSLKSTS---LQQE- 810

Query: 824 CVDLLCSL 847
           C DL+C+L
Sbjct: 811 CDDLVCAL 818


>UniRef50_Q7QC87 Cluster: ENSANGP00000021865; n=1; Anopheles gambiae
           str. PEST|Rep: ENSANGP00000021865 - Anopheles gambiae
           str. PEST
          Length = 1040

 Score = 37.5 bits (83), Expect = 0.49
 Identities = 28/101 (27%), Positives = 51/101 (50%), Gaps = 1/101 (0%)
 Frame = +1

Query: 481 EEAENMDLRENIANLITVMCEITFDPGKFDTLCGPLVDSFASTLNDESYTRPLVDAIVNQ 660
           E AE  + ++ + ++ +++ ++T  P  F  L   +     S   DE + +  +  +  +
Sbjct: 143 ESAEQDETQKLLKSMRSILNKLT--PENFTKLVEQV--KMLSIKTDEQF-KGCIRLVFEK 197

Query: 661 SIGEANFRYNGARLCSMYDSVAQPEE-SVFRECLLERCSVE 780
           +I E NF    A++C    S+A P++ S FR  LLERC  E
Sbjct: 198 AISEPNFSEAYAKMCREIGSLAVPDQKSDFRTQLLERCQCE 238


>UniRef50_A4R2G7 Cluster: Putative uncharacterized protein; n=1;
            Magnaporthe grisea|Rep: Putative uncharacterized protein
            - Magnaporthe grisea (Rice blast fungus) (Pyricularia
            grisea)
          Length = 1415

 Score = 37.5 bits (83), Expect = 0.49
 Identities = 23/72 (31%), Positives = 34/72 (47%)
 Frame = +1

Query: 193  DISAPKGRGRGWQMNNQARELRRPKAVSDEPKVDTSKSKLSADAKEWYPANYTSQALPAY 372
            D+S PK RGR  +   Q      P +  + P+++  + K+  DA E  PA    + +PA 
Sbjct: 968  DVSTPKARGRVPRGKMQEAPKSPPASAHETPRLE-PQDKMQVDAAEPVPAR-VPEPVPAR 1025

Query: 373  NTEPAPYRPSRP 408
              EP P R   P
Sbjct: 1026 VPEPVPARVPEP 1037


>UniRef50_A7S0M4 Cluster: Predicted protein; n=4; Eumetazoa|Rep:
           Predicted protein - Nematostella vectensis
          Length = 231

 Score = 37.1 bits (82), Expect = 0.64
 Identities = 16/45 (35%), Positives = 29/45 (64%)
 Frame = +2

Query: 728 NLRSLYSASACSSAVPLRKTRLSAAWKLQRRICVDLLCSLPRLYS 862
           +L  + S+S CSS   L+ T L+A  ++ ++I VD +C L R+++
Sbjct: 64  SLDKIVSSSNCSSPTTLQNTALTAKLEIDKKILVDKICRLQRIHA 108


>UniRef50_O67418 Cluster: Oxygen-independent coproporphyrinogen III
           oxidase; n=1; Aquifex aeolicus|Rep: Oxygen-independent
           coproporphyrinogen III oxidase - Aquifex aeolicus
          Length = 370

 Score = 36.7 bits (81), Expect = 0.85
 Identities = 21/82 (25%), Positives = 41/82 (50%), Gaps = 1/82 (1%)
 Frame = +1

Query: 676 NFRYNGARLCSMYDS-VAQPEESVFRECLLERCSVEENKIISGLETSEENMRGFAMFLAE 852
           N RY   +  S Y   + + ++ V     L+   +E+ +I+ GL T+E     +  F+ E
Sbjct: 270 NVRYGNTKNISKYVKFLKEDKKPVEFRVQLDETELEKERIMLGLRTTEGIEEKYLKFVPE 329

Query: 853 IILSFEDSQGGRIRLSVKSLQV 918
            +  F + +GGR+R+  + L +
Sbjct: 330 YLRDFFEVKGGRLRIKEEHLLI 351


>UniRef50_Q7PYX6 Cluster: ENSANGP00000019142; n=1; Anopheles gambiae
           str. PEST|Rep: ENSANGP00000019142 - Anopheles gambiae
           str. PEST
          Length = 261

 Score = 36.7 bits (81), Expect = 0.85
 Identities = 16/63 (25%), Positives = 33/63 (52%)
 Frame = +1

Query: 691 GARLCSMYDSVAQPEESVFRECLLERCSVEENKIISGLETSEENMRGFAMFLAEIILSFE 870
           GARLC + DS+ +    + RE L  +   + +++   ++  +  +RG  +FLAE+ +   
Sbjct: 2   GARLCQLLDSINKAPNLMLRELLQLKMDHQNSELPEFMKQEQVKVRGATLFLAELYMQLR 61

Query: 871 DSQ 879
             +
Sbjct: 62  QPE 64


>UniRef50_Q6BST2 Cluster: Similar to CA4421|CaTAF19 Candida albicans
           CaTAF19; n=1; Debaryomyces hansenii|Rep: Similar to
           CA4421|CaTAF19 Candida albicans CaTAF19 - Debaryomyces
           hansenii (Yeast) (Torulaspora hansenii)
          Length = 172

 Score = 36.7 bits (81), Expect = 0.85
 Identities = 23/99 (23%), Positives = 43/99 (43%)
 Frame = +1

Query: 367 AYNTEPAPYRPSRPSVQGRLRQAQDQNPYNLDDMSYSLEEAENMDLRENIANLITVMCEI 546
           ++NT+P      R   Q    +  +Q  Y+L D  Y+ ++  N  L E +   ++ +C  
Sbjct: 9   SFNTQPPITNTKRRRKQRLFTRDIEQLLYSLGDGPYTSDQTVNA-LEETLVTYLSELCHT 67

Query: 547 TFDPGKFDTLCGPLVDSFASTLNDESYTRPLVDAIVNQS 663
           T    +        +D F   L ++ Y    ++ I+NQS
Sbjct: 68  TLQFARNQGRSRVKIDDFPFALRNDPYKLSRLEYIINQS 106


>UniRef50_UPI0000F1E2F0 Cluster: PREDICTED: similar to mFLJ00150
           protein, partial; n=1; Danio rerio|Rep: PREDICTED:
           similar to mFLJ00150 protein, partial - Danio rerio
          Length = 459

 Score = 36.3 bits (80), Expect = 1.1
 Identities = 29/88 (32%), Positives = 39/88 (44%)
 Frame = +1

Query: 226 WQMNNQARELRRPKAVSDEPKVDTSKSKLSADAKEWYPANYTSQALPAYNTEPAPYRPSR 405
           W++N    EL  P + S     DT         KE  PA   S   PAYNTE   +R   
Sbjct: 322 WEINRSTAELETPSSASS----DTDS------LKENRPAVTLSMGNPAYNTEDEQWRGE- 370

Query: 406 PSVQGRLRQAQDQNPYNLDDMSYSLEEA 489
            +++ RLRQ +D     L    +S +EA
Sbjct: 371 -ALRERLRQQEDHLKVQLRRRMFSQQEA 397


>UniRef50_A3R6T0 Cluster: Erythrocyte membrane protein 1; n=14;
            Plasmodium|Rep: Erythrocyte membrane protein 1 -
            Plasmodium falciparum
          Length = 2204

 Score = 36.3 bits (80), Expect = 1.1
 Identities = 26/113 (23%), Positives = 51/113 (45%)
 Frame = +1

Query: 184  NNGDISAPKGRGRGWQMNNQARELRRPKAVSDEPKVDTSKSKLSADAKEWYPANYTSQAL 363
            NN   S       G Q + Q  +    K   +E   +T K +  ++  +  P +Y S  +
Sbjct: 1866 NNTTASGKNTTASGTQNDIQNDDTPSSKITDNE--WNTLKDEFISNMLQNQPNDYKSGDI 1923

Query: 364  PAYNTEPAPYRPSRPSVQGRLRQAQDQNPYNLDDMSYSLEEAENMDLRENIAN 522
            P +NT+P     ++P  +  +    D+N Y  ++ SY++    +MD  + ++N
Sbjct: 1924 P-FNTQPNTLYFNKPEAKPFITSIHDRNLYTGEEYSYNVNMVNSMDDTKYVSN 1975


>UniRef50_Q8JJG5 Cluster: E1; n=1; Psittacus erithacus timneh
           papillomavirus|Rep: E1 - Psittacus erithacus timneh
           papillomavirus
          Length = 678

 Score = 35.5 bits (78), Expect = 2.0
 Identities = 18/55 (32%), Positives = 33/55 (60%)
 Frame = +1

Query: 655 NQSIGEANFRYNGARLCSMYDSVAQPEESVFRECLLERCSVEENKIISGLETSEE 819
           N S G  ++  NGARL   Y++ ++  ++  ++ LL+RC V +NK ++ L   +E
Sbjct: 195 NVSAGGTHYGENGARLPPPYETASETRQTEGQK-LLQRCLVSKNKTLTALAVFKE 248


>UniRef50_UPI0000DB6FC8 Cluster: PREDICTED: similar to turtle
           CG15427-PD, isoform D; n=1; Apis mellifera|Rep:
           PREDICTED: similar to turtle CG15427-PD, isoform D -
           Apis mellifera
          Length = 430

 Score = 35.1 bits (77), Expect = 2.6
 Identities = 25/85 (29%), Positives = 36/85 (42%), Gaps = 5/85 (5%)
 Frame = +1

Query: 205 PKGRGRGWQMNNQARELRRPKAVSDEPKVDTSKSKLSADA----KEWYPANYTSQA-LPA 369
           P GR R       AR  R    ++  P ++TS    S+ +    K     N +S++    
Sbjct: 250 PAGRSRARLPPRHARHARSAPELAASPDLETSPESRSSSSGFGSKNTSQQNQSSRSGSTV 309

Query: 370 YNTEPAPYRPSRPSVQGRLRQAQDQ 444
               P PYRP  P + GR  + QDQ
Sbjct: 310 AEWRPPPYRPPPPPLVGRWLELQDQ 334


>UniRef50_A2RVF5 Cluster: IP16971p; n=3; Sophophora|Rep: IP16971p -
           Drosophila melanogaster (Fruit fly)
          Length = 637

 Score = 35.1 bits (77), Expect = 2.6
 Identities = 20/69 (28%), Positives = 29/69 (42%), Gaps = 2/69 (2%)
 Frame = +1

Query: 205 PKGR-GRGWQMNNQARELRRPKAVSDEPKVDTSKSKLSADAKEWYPANYTSQALPAYNTE 381
           P GR   G      +   R P+  +D P+      + +AD  E+ P  Y     P+Y   
Sbjct: 293 PTGRPSSGSSEERPSYAARPPRPTADRPEYPPGPPRPTADRPEYPPRPYEGSTPPSYGPR 352

Query: 382 PAP-YRPSR 405
           P+P Y P R
Sbjct: 353 PSPSYDPDR 361


>UniRef50_UPI0000499259 Cluster: hypothetical protein 388.t00006;
           n=1; Entamoeba histolytica HM-1:IMSS|Rep: hypothetical
           protein 388.t00006 - Entamoeba histolytica HM-1:IMSS
          Length = 1598

 Score = 34.7 bits (76), Expect = 3.4
 Identities = 25/95 (26%), Positives = 41/95 (43%), Gaps = 4/95 (4%)
 Frame = +1

Query: 550 FDPGKFDTLCGPLVDSFASTLNDESYTRPLVDAIVNQSIGEANFRYNGARLCSMYDSVAQ 729
           FDP  F ++    VDS     + ++ T P++D+I +  I +      G    + +D V +
Sbjct: 278 FDPSLFGSVNESSVDSEEDRKDQQNQTIPIIDSIGSSRIKKTQKEQRGLNKINSFDEVVE 337

Query: 730 PEESVFRECLL----ERCSVEENKIISGLETSEEN 822
            +     E L     E   +EE KI +  E  E N
Sbjct: 338 KKRKEDLEKLKKAKEELSKLEEEKIAAEKEKEEAN 372


>UniRef50_Q4RG15 Cluster: Chromosome 2 SCAF15106, whole genome
           shotgun sequence; n=1; Tetraodon nigroviridis|Rep:
           Chromosome 2 SCAF15106, whole genome shotgun sequence -
           Tetraodon nigroviridis (Green puffer)
          Length = 1019

 Score = 34.7 bits (76), Expect = 3.4
 Identities = 27/73 (36%), Positives = 37/73 (50%), Gaps = 1/73 (1%)
 Frame = +1

Query: 259 RPKAVSDEPKVDTSKSKLSADAKEWYPANYTSQALPAYNTEPAPYRPSRPSVQGRLRQAQ 438
           R + V+D+ K    KS L+ +AKE+ P       +P  NT P P RP+ PS    L+   
Sbjct: 552 RTEGVADQVK----KSTLNPNAKEFNPIK-PQMPMPKPNTAPTPPRPTPPS-PVVLQHPG 605

Query: 439 DQNP-YNLDDMSY 474
            Q P YN   +SY
Sbjct: 606 GQGPLYNAPYLSY 618


>UniRef50_Q30T76 Cluster: Putative uncharacterized protein; n=1;
           Thiomicrospira denitrificans ATCC 33889|Rep: Putative
           uncharacterized protein - Thiomicrospira denitrificans
           (strain ATCC 33889 / DSM 1351)
          Length = 334

 Score = 34.7 bits (76), Expect = 3.4
 Identities = 26/101 (25%), Positives = 45/101 (44%), Gaps = 14/101 (13%)
 Frame = +1

Query: 253 LRRPKAVSDEPKVDTSKSKLSADAKEWYPANYTSQALPAYNTEPAP-YRPSRPS------ 411
           +++ K V D  +   SK +   + K      Y S+  P Y +EP P Y+P + S      
Sbjct: 79  IKKDKHVEDRVE---SKPEPKKEFKAEVKKEYKSEPKPEYKSEPKPDYKPKKESPKQHHN 135

Query: 412 -------VQGRLRQAQDQNPYNLDDMSYSLEEAENMDLREN 513
                   Q  +    D + YN++D++Y+ +  E+ D  EN
Sbjct: 136 IVNDTIMPQSFVSMQDDDDDYNIEDINYTADYDEDEDYNEN 176


>UniRef50_A3EPE8 Cluster: Cation-transporting ATPase; n=1;
           Leptospirillum sp. Group II UBA|Rep: Cation-transporting
           ATPase - Leptospirillum sp. Group II UBA
          Length = 843

 Score = 34.7 bits (76), Expect = 3.4
 Identities = 32/101 (31%), Positives = 46/101 (45%), Gaps = 4/101 (3%)
 Frame = +1

Query: 358 ALPAYNTEPAPYRPSRPSVQGRLRQAQDQ-NPYNLDDMSYSLEEAENMD---LRENIANL 525
           A PA + EPA   P R S  G LR+   +    +     +++E+    D    R N+ NL
Sbjct: 83  AAPANSDEPA-LAPDRTSPTGPLRRTSFRVEGMHCATCVFTIEKTLRKDPGVTRANV-NL 140

Query: 526 ITVMCEITFDPGKFDTLCGPLVDSFASTLNDESYTRPLVDA 648
            T  C++TFDP K        +D   S + +  YT  L DA
Sbjct: 141 ATESCDLTFDPEK------TTLDRIFSAVREAGYTPLLPDA 175


>UniRef50_A7SIV8 Cluster: Predicted protein; n=1; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 1096

 Score = 34.7 bits (76), Expect = 3.4
 Identities = 27/95 (28%), Positives = 38/95 (40%), Gaps = 7/95 (7%)
 Frame = +1

Query: 229 QMNNQARELRRPKAVSDEPKVDTSKSKLSADAK---EWYPANYTSQALPAYNTEPAPYRP 399
           Q  N    LR+PK +     V ++KS L           P +  S + P     P P RP
Sbjct: 268 QPTNPIPSLRQPKNIPLSTSVTSAKSSLDHCTSFQINMLPEHACSSSHPLTRPIPKPQRP 327

Query: 400 SRPSVQG----RLRQAQDQNPYNLDDMSYSLEEAE 492
            +PS  G    R    + Q+ Y +  +  S EE E
Sbjct: 328 PQPSKSGSGWARNSTQRQQSQYEMQQLQPSTEEEE 362


>UniRef50_A2QDU3 Cluster: Remark: the protein is only the half of
           the length of PTH11; n=2; Aspergillus niger|Rep: Remark:
           the protein is only the half of the length of PTH11 -
           Aspergillus niger
          Length = 380

 Score = 34.7 bits (76), Expect = 3.4
 Identities = 14/27 (51%), Positives = 18/27 (66%)
 Frame = -1

Query: 423 STLYRGARWSIWGRFSVVSG*GLRSVI 343
           ST+ RG RW+IWG F+   G G+ S I
Sbjct: 136 STIVRGVRWTIWGLFAFCLGLGVASTI 162


>UniRef50_Q245S7 Cluster: BZIP transcription factor family protein;
           n=1; Tetrahymena thermophila SB210|Rep: BZIP
           transcription factor family protein - Tetrahymena
           thermophila SB210
          Length = 504

 Score = 34.3 bits (75), Expect = 4.5
 Identities = 24/106 (22%), Positives = 47/106 (44%), Gaps = 5/106 (4%)
 Frame = +1

Query: 322 AKEWYPANYTSQALPAYNTEPAPYRPSRPSVQGR-----LRQAQDQNPYNLDDMSYSLEE 486
           AK+ Y   Y +  +  Y  +P  Y+ +R  +Q R     +R  +     NL+ M+    +
Sbjct: 253 AKKKYEPLYDNNQVYRYEDDPLEYKKARKRIQNRQSARKVRSIKKNQTENLE-MNVDQLK 311

Query: 487 AENMDLRENIANLITVMCEITFDPGKFDTLCGPLVDSFASTLNDES 624
            EN DL+  +ANL      +  +   F  + G ++ ++    N+ +
Sbjct: 312 QENQDLKVQVANLSAQNKRLLDEVEYFRRMYGNIIQNYHQENNNSN 357


>UniRef50_A2EJ16 Cluster: Putative uncharacterized protein; n=1;
           Trichomonas vaginalis G3|Rep: Putative uncharacterized
           protein - Trichomonas vaginalis G3
          Length = 1645

 Score = 34.3 bits (75), Expect = 4.5
 Identities = 23/126 (18%), Positives = 56/126 (44%), Gaps = 3/126 (2%)
 Frame = +1

Query: 460 DDMSYSLEEAENMDLRENIANLITVMCEITFDPGKFDTLCGPLVD-SFASTLNDESYTRP 636
           DD  +  ++   + +R+NI   ++  C +     + D LC  L+    A  +    Y   
Sbjct: 542 DDAQHHKDQITGISIRDNIIASVSDDCHLMIWNYRLDMLCSILLPVPLAGVVIVNGYRDV 601

Query: 637 LVDAIVNQSIGEANFRYNGARL--CSMYDSVAQPEESVFRECLLERCSVEENKIISGLET 810
           +V    N  I   N+ ++G  +   +++DS  + +++++ + + +   +EE  ++     
Sbjct: 602 IVGTGTNLMIIHGNYLFDGPPVPEDTVFDSYCRLDDALYEKYIKKNIEIEEIPVVMQETR 661

Query: 811 SEENMR 828
           S   +R
Sbjct: 662 SPRRVR 667


>UniRef50_UPI00003C0619 Cluster: PREDICTED: similar to CG14801-PB,
           isoform B; n=1; Apis mellifera|Rep: PREDICTED: similar
           to CG14801-PB, isoform B - Apis mellifera
          Length = 709

 Score = 33.9 bits (74), Expect = 6.0
 Identities = 27/102 (26%), Positives = 48/102 (47%), Gaps = 4/102 (3%)
 Frame = +1

Query: 271 VSDEPKVDTSKSKLS-ADAKEWYPANYTSQALPAYNTEPAPYRPSRPSVQGRLRQAQDQN 447
           +S   K   SKSK++ A      P+N TS A+P     P   +  R  +  R R+ + +N
Sbjct: 151 MSASTKAARSKSKITNAQQSHPSPSNMTSPAMPTSTMPPPSAKEDRTILSRRQRKNRTRN 210

Query: 448 PYNL---DDMSYSLEEAENMDLRENIANLITVMCEITFDPGK 564
           P +     D    ++E  + + R++     +V  ++TFD G+
Sbjct: 211 PRDQRREQDDEQRIQEEYDEEQRDSNG---SVAVQMTFDGGR 249


>UniRef50_A6WEX5 Cluster: Cell envelope-related transcriptional
           attenuator; n=1; Kineococcus radiotolerans SRS30216|Rep:
           Cell envelope-related transcriptional attenuator -
           Kineococcus radiotolerans SRS30216
          Length = 407

 Score = 33.9 bits (74), Expect = 6.0
 Identities = 22/72 (30%), Positives = 30/72 (41%)
 Frame = +1

Query: 205 PKGRGRGWQMNNQARELRRPKAVSDEPKVDTSKSKLSADAKEWYPANYTSQALPAYNTEP 384
           P  RG  W      R  RRP      P          A  +E   A++++ + PA    P
Sbjct: 11  PSQRGEQWHSTTYGRPARRPA----RPPA------AQAPGREQRLADFSAASAPARPATP 60

Query: 385 APYRPSRPSVQG 420
           AP RP+RP+  G
Sbjct: 61  APARPARPAAPG 72


>UniRef50_Q4XZ20 Cluster: Putative uncharacterized protein; n=1;
           Plasmodium chabaudi|Rep: Putative uncharacterized
           protein - Plasmodium chabaudi
          Length = 53

 Score = 33.9 bits (74), Expect = 6.0
 Identities = 13/28 (46%), Positives = 20/28 (71%)
 Frame = +1

Query: 34  NYYCIDFFVYVSILANEIHAYENKYIYQ 117
           NYYC +  +YV +L  +IH ++ KYIY+
Sbjct: 25  NYYCCNI-IYVILLFTQIHIFDIKYIYE 51


>UniRef50_Q172F5 Cluster: Putative uncharacterized protein; n=1;
           Aedes aegypti|Rep: Putative uncharacterized protein -
           Aedes aegypti (Yellowfever mosquito)
          Length = 591

 Score = 33.9 bits (74), Expect = 6.0
 Identities = 28/118 (23%), Positives = 47/118 (39%), Gaps = 6/118 (5%)
 Frame = +1

Query: 187 NGDISAPKGRGRGWQMNNQARELRRPKAVSDEPKVDTSKSKLSADA-KEWYPANYTSQAL 363
           NGDI  P     G ++  +   ++     S  PK   +   ++ADA K     N +++  
Sbjct: 246 NGDIGKPPAVVNGSKVEVKQTTIQNTVQNSAPPKPARTLLNITADASKSVADTNVSTRKE 305

Query: 364 PAYNTEPA-----PYRPSRPSVQGRLRQAQDQNPYNLDDMSYSLEEAENMDLRENIAN 522
           P     P      PY  SR  + G LR+   Q P  +D  +    + +N  L   + +
Sbjct: 306 PIKQHSPVKVDIKPYENSRMPLNGTLRKVSPQKPLTIDVTASQDNQLKNTILSPEVVS 363


>UniRef50_UPI000155367C Cluster: PREDICTED: similar to hCG1732289;
           n=2; Murinae|Rep: PREDICTED: similar to hCG1732289 - Mus
           musculus
          Length = 366

 Score = 33.5 bits (73), Expect = 7.9
 Identities = 30/96 (31%), Positives = 43/96 (44%), Gaps = 1/96 (1%)
 Frame = +1

Query: 361 LPAYNTEPAPYRPSRPSVQGRLRQAQDQNPYNLDDMSYSLEEAENMDLRENIANLITVMC 540
           LP      A  RP+   +QGR   + +Q+   L+  + SL+  +N DLRE +  L+    
Sbjct: 61  LPPRGKATASSRPAPTQLQGRTLGSAEQSFLQLEQENQSLKR-QNQDLREQLGALL---- 115

Query: 541 EITFDPG-KFDTLCGPLVDSFASTLNDESYTRPLVD 645
                PG +F  LC       A   + ES T PL D
Sbjct: 116 ----GPGQQFLPLCSEHSSCTALAWSPESATWPLED 147


>UniRef50_Q6R796 Cluster: ORF117; n=1; Ostreid herpesvirus 1|Rep:
           ORF117 - Ostreid herpesvirus 1
          Length = 371

 Score = 33.5 bits (73), Expect = 7.9
 Identities = 24/101 (23%), Positives = 49/101 (48%), Gaps = 3/101 (2%)
 Frame = +1

Query: 232 MNNQARELRRPKAVSDEP-KVDTSKSKLSADAKEWYPANYTSQALPAYNTEPAPYRPSRP 408
           ++N  RE+       ++P + D  +    ++A+E  P    +Q   A NT P P    RP
Sbjct: 155 LDNIYREVEEADQRDNDPIESDIEEEMNESEAEEEEPVPEIAQ-FEALNTPPPPPTNRRP 213

Query: 409 SVQGRLRQAQDQNPYNLDDMSYSL--EEAENMDLRENIANL 525
            ++  + +A++   Y+ ++++  L  E A  + LR  + +L
Sbjct: 214 KIRRPMERARNTTRYDSEELTNMLMTEVATRVSLRGGVGDL 254


>UniRef50_Q9M1M3 Cluster: Putative uncharacterized protein
           T32A11_100; n=1; Arabidopsis thaliana|Rep: Putative
           uncharacterized protein T32A11_100 - Arabidopsis
           thaliana (Mouse-ear cress)
          Length = 889

 Score = 33.5 bits (73), Expect = 7.9
 Identities = 19/73 (26%), Positives = 36/73 (49%), Gaps = 1/73 (1%)
 Frame = +1

Query: 274 SDEPKVDTSKSKLSADAKEWYPANYTSQALPA-YNTEPAPYRPSRPSVQGRLRQAQDQNP 450
           S E  +   +  + ADA E  PA ++   LP  +N+E      +   V G+L+ + D+ P
Sbjct: 615 SVEKLLPLHQDHIIADASERVPATHSGLDLPKEHNSEELQTNANETDVYGKLQDSLDREP 674

Query: 451 YNLDDMSYSLEEA 489
            +  D+   +E++
Sbjct: 675 ASHSDIDLPIEQS 687


>UniRef50_A4RRC9 Cluster: Predicted protein; n=2; Ostreococcus|Rep:
           Predicted protein - Ostreococcus lucimarinus CCE9901
          Length = 313

 Score = 33.5 bits (73), Expect = 7.9
 Identities = 21/49 (42%), Positives = 26/49 (53%), Gaps = 4/49 (8%)
 Frame = +2

Query: 683 GTMELVCVQCTIQWRNL----RSLYSASACSSAVPLRKTRLSAAWKLQR 817
           G+M LV V+C  +WRNL    RS Y    C     L +TR  AA  L+R
Sbjct: 62  GSMALVHVECLNEWRNLSRNPRSFYGCDQCGYQYNLERTR--AARYLER 108


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 977,519,209
Number of Sequences: 1657284
Number of extensions: 21374534
Number of successful extensions: 62879
Number of sequences better than 10.0: 35
Number of HSP's better than 10.0 without gapping: 59721
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 62830
length of database: 575,637,011
effective HSP length: 101
effective length of database: 408,251,327
effective search space used: 86141029997
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).