SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= cesb0009
         (585 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_UPI00015B42A6 Cluster: PREDICTED: similar to polyprotei...    75   1e-12
UniRef50_Q9XXW0 Cluster: Endonuclease and reverse transcriptase-...    75   1e-12
UniRef50_UPI0000D578AF Cluster: PREDICTED: similar to RNA-direct...    74   2e-12
UniRef50_Q95SX7 Cluster: Probable RNA-directed DNA polymerase fr...    71   2e-11
UniRef50_Q8I7P8 Cluster: ORF1; n=2; Drosophila melanogaster|Rep:...    67   3e-10
UniRef50_Q18LA9 Cluster: Pol protein; n=8; melanogaster subgroup...    62   9e-09
UniRef50_UPI0000D5792E Cluster: PREDICTED: similar to RNA-direct...    60   5e-08
UniRef50_Q961V7 Cluster: GH03753p; n=5; melanogaster subgroup|Re...    60   5e-08
UniRef50_A3FMR3 Cluster: Pol-like protein; n=2; Biomphalaria gla...    59   7e-08
UniRef50_Q9NBX4 Cluster: Probable RNA-directed DNA polymerase fr...    57   3e-07
UniRef50_Q86GH0 Cluster: Pol protein; n=1; Drosophila americana|...    56   6e-07
UniRef50_P21328 Cluster: RNA-directed DNA polymerase from mobile...    55   1e-06
UniRef50_UPI0000D578A9 Cluster: PREDICTED: similar to RNA-direct...    54   2e-06
UniRef50_Q6UJ39 Cluster: Pol protein; n=1; Drosophila virilis|Re...    53   4e-06
UniRef50_Q6J4U7 Cluster: Pol protein; n=9; cellular organisms|Re...    47   3e-04
UniRef50_UPI00015B43EC Cluster: PREDICTED: similar to pol-like p...    44   0.002
UniRef50_UPI00015B4771 Cluster: PREDICTED: similar to secreted p...    44   0.003
UniRef50_UPI0000D5790F Cluster: PREDICTED: similar to RNA-direct...    43   0.005
UniRef50_Q9TYX8 Cluster: Putative uncharacterized protein R11E3....    41   0.019
UniRef50_Q9GP60 Cluster: Pol protein; n=1; Drosophila melanogast...    40   0.057
UniRef50_A6GFD7 Cluster: Protein phosphatase/cyclic nucleotide-b...    38   0.13 
UniRef50_Q24363 Cluster: Putative ORF2; n=2; melanogaster subgro...    38   0.13 
UniRef50_Q7RX84 Cluster: Pre-mRNA-splicing factor cwc-22; n=18; ...    38   0.13 
UniRef50_Q1E629 Cluster: Putative uncharacterized protein; n=1; ...    36   0.53 
UniRef50_Q868Q4 Cluster: Reverse transcriptase; n=3; Bombyx mori...    36   0.70 
UniRef50_Q07995 Cluster: Reverse transcriptase homolog protein; ...    36   0.70 
UniRef50_Q86X51 Cluster: Similar to CG32656-PA; n=4; Catarrhini|...    36   0.70 
UniRef50_UPI0000D57951 Cluster: PREDICTED: similar to RNA-direct...    35   1.2  
UniRef50_A3VVD2 Cluster: Putative uncharacterized protein; n=1; ...    35   1.2  
UniRef50_A7ERU2 Cluster: Putative uncharacterized protein; n=12;...    35   1.2  
UniRef50_Q9U509 Cluster: Putative cuticle protein; n=1; Manduca ...    34   2.2  
UniRef50_Q4Q9P4 Cluster: Kinesin, putative; n=3; Leishmania|Rep:...    34   2.2  
UniRef50_Q7RZC6 Cluster: Putative uncharacterized protein NCU039...    34   2.2  
UniRef50_Q9N9Z1 Cluster: Endonuclease/reverse transcriptase; n=1...    34   2.8  
UniRef50_A4R467 Cluster: Putative uncharacterized protein; n=1; ...    34   2.8  
UniRef50_A4V8V3 Cluster: Putative 5'-terminal protein; n=1; Arth...    33   3.8  
UniRef50_Q6Z2C3 Cluster: Putative uncharacterized protein OJ1034...    33   3.8  
UniRef50_Q7RXY5 Cluster: Putative uncharacterized protein NCU004...    33   3.8  
UniRef50_Q0CM53 Cluster: Predicted protein; n=1; Aspergillus ter...    33   3.8  
UniRef50_UPI0000F2BA80 Cluster: PREDICTED: hypothetical protein;...    33   5.0  
UniRef50_O12982 Cluster: DsRNA adenosine deaminase; n=3; Xenopus...    33   5.0  
UniRef50_Q6A9X8 Cluster: ABC transporter, ATP-binding protein; n...    33   5.0  
UniRef50_Q7AJI7 Cluster: Riorf145 protein; n=1; Agrobacterium rh...    33   5.0  
UniRef50_A4TU85 Cluster: Beta-ketoacyl synthase; n=1; Magnetospi...    33   5.0  
UniRef50_Q10SE6 Cluster: Beta-carotene hydroxylase, putative, ex...    33   5.0  
UniRef50_A1CTN3 Cluster: Proline oxidase PrnD; n=11; cellular or...    33   5.0  
UniRef50_P08699 Cluster: Galectin-3; n=16; Tetrapoda|Rep: Galect...    33   5.0  
UniRef50_Q8NDC0 Cluster: Uncharacterized protein C14orf32; n=19;...    33   5.0  
UniRef50_UPI000023F43D Cluster: hypothetical protein FG09473.1; ...    33   6.6  
UniRef50_Q3UPZ6 Cluster: 0 day neonate lung cDNA, RIKEN full-len...    33   6.6  
UniRef50_Q2JEG5 Cluster: FAD linked oxidase-like; n=2; Actinomyc...    33   6.6  
UniRef50_Q11F75 Cluster: Phosphomethylpyrimidine kinase; n=3; Me...    33   6.6  
UniRef50_A5NRL6 Cluster: Putative uncharacterized protein precur...    33   6.6  
UniRef50_A3TY96 Cluster: Putative uncharacterized protein; n=1; ...    33   6.6  
UniRef50_A1U2Q5 Cluster: Glutathione S-transferase, N-terminal d...    33   6.6  
UniRef50_Q7XXJ3 Cluster: OSJNBa0094O15.9 protein; n=4; Oryza sat...    33   6.6  
UniRef50_Q0V5U2 Cluster: Putative uncharacterized protein; n=1; ...    33   6.6  
UniRef50_A7EIT2 Cluster: Putative uncharacterized protein; n=1; ...    33   6.6  
UniRef50_Q8TF61 Cluster: F-box only protein 41; n=21; Euteleosto...    33   6.6  
UniRef50_UPI0001555319 Cluster: PREDICTED: hypothetical protein,...    30   7.5  
UniRef50_UPI0000F2D0DE Cluster: PREDICTED: hypothetical protein;...    32   8.7  
UniRef50_UPI00005A40D0 Cluster: PREDICTED: hypothetical protein ...    32   8.7  
UniRef50_Q89C29 Cluster: Bll7969 protein; n=1; Bradyrhizobium ja...    32   8.7  
UniRef50_A7HU45 Cluster: Putative uncharacterized protein; n=1; ...    32   8.7  
UniRef50_Q69KE8 Cluster: Putative uncharacterized protein OSJNBb...    32   8.7  
UniRef50_A5BK64 Cluster: Putative uncharacterized protein; n=1; ...    32   8.7  
UniRef50_Q8NAA9 Cluster: CDNA FLJ35687 fis, clone SPLEN2019349; ...    32   8.7  
UniRef50_Q6P2D8 Cluster: X-ray radiation resistance-associated p...    32   8.7  

>UniRef50_UPI00015B42A6 Cluster: PREDICTED: similar to polyprotein;
            n=1; Nasonia vitripennis|Rep: PREDICTED: similar to
            polyprotein - Nasonia vitripennis
          Length = 1249

 Score = 74.9 bits (176), Expect = 1e-12
 Identities = 55/192 (28%), Positives = 85/192 (44%), Gaps = 4/192 (2%)
 Frame = +2

Query: 20   PPGPDFHPGDIRRVLNCDSRPALLVGDLNAKHVAWGSRLNSAVGRRLLEDADRGDYSVVG 199
            PP P      +  + N +  P +L GDLNAKH +WG   N+  G+ LL+   + +  +  
Sbjct: 452  PPNPKEKFSSLHSLFNTNI-PTILAGDLNAKHTSWGCIHNNPAGQSLLKKIMKHNICIEP 510

Query: 200  PDEPTHIPTAAQLQPDVLDVCVHKGLRCPLTIEALYDLGTPHLPILVTL--GMGLTRVAT 373
            P  PTH P  A   PD+LD+ + K +  P       DL + H P+LV +        + T
Sbjct: 511  PLVPTHFPGCATHDPDILDIFLTKNITLPSDPWTTEDLSSDHNPVLVKIPSSPDFLPITT 570

Query: 374  SPLRPKVDWELFKRRLVDLPAIQDPNTPE--GVDDAAVRLVDSIRGAIDQATTLVPSGGP 547
            S     +DW L  + +++    +  +      +D A   L   I  A  QATT       
Sbjct: 571  S----SIDW-LHLKYILETSNFKCSHIKSITELDKAVEELTKEINTATQQATTTTTVPQF 625

Query: 548  RGILPAHLKAII 583
            +  L   LK++I
Sbjct: 626  KTKLSPELKSLI 637


>UniRef50_Q9XXW0 Cluster: Endonuclease and reverse
           transcriptase-like protein; n=9; cellular organisms|Rep:
           Endonuclease and reverse transcriptase-like protein -
           Bombyx mori (Silk moth)
          Length = 960

 Score = 74.9 bits (176), Expect = 1e-12
 Identities = 53/178 (29%), Positives = 82/178 (46%), Gaps = 7/178 (3%)
 Frame = +2

Query: 20  PPGPDFHPGDIRRVLNCDSRPALLVGDLNAKHVAWGSRLNSAVGRRLLEDADRGDYSVVG 199
           PP       DI  +L+  S   +L GDLN KH+ W S   +  GRRL    D   + ++ 
Sbjct: 119 PPEKIVLSSDIEALLSMGSS-VILAGDLNCKHIRWNSHTTTPNGRRLDALVDDLAFDIIA 177

Query: 200 PDEPTHIPTAAQLQPDVLDVCVHKGLRCPL-TIEALYDLGTPHLPILVTLGMGLTRVATS 376
           P  PTH P     +PD+LD+ + K +   L +IE + +L + H P+++ LG     V  +
Sbjct: 178 PLTPTHYPLNIAHRPDILDIALLKNVTLRLHSIEVVSELDSDHRPVVMKLGRSPDSVPVT 237

Query: 377 PLRPKVDWELFKRRLVD-----LPAIQDPN-TPEGVDDAAVRLVDSIRGAIDQATTLV 532
             R  VDW      L +     LP   D   +P+   +A   L   I   +D+++  V
Sbjct: 238 --RTVVDWHTLGISLAESDPPSLPFSPDSTPSPQDTAEAIDILTSHITSTLDRSSKQV 293


>UniRef50_UPI0000D578AF Cluster: PREDICTED: similar to RNA-directed
            DNA polymerase from mobile element jockey (Reverse
            transcriptase); n=7; Tribolium castaneum|Rep: PREDICTED:
            similar to RNA-directed DNA polymerase from mobile
            element jockey (Reverse transcriptase) - Tribolium
            castaneum
          Length = 1336

 Score = 74.1 bits (174), Expect = 2e-12
 Identities = 53/162 (32%), Positives = 77/162 (47%), Gaps = 5/162 (3%)
 Frame = +2

Query: 80   PALLVGDLNAKHVAWGSRLNSAVGRRLLEDADRG-DYSVVGPDEPTHIPTAAQLQPDVLD 256
            P +  GD NAKH+ WGSR ++  G  L    D+  D SV+ P EPT     +    D+LD
Sbjct: 613  PTIAAGDFNAKHINWGSRRSNRNGNFLNGFTDQNLDISVMAPVEPTFYRN-SDGAADILD 671

Query: 257  VCVHKGLRCPLTIEALYDLGTPHLPILVTLGMGLTRVATSPL---RPKVDWELFKRRLV- 424
            V + K +   + + A+ DL + H P+L+ +G      A  P+      VDW  F + LV 
Sbjct: 672  VAIVKNVVHQVRLTAINDLSSDHNPVLMQIG----NEANDPIVCRYTSVDWRKFTKHLVN 727

Query: 425  DLPAIQDPNTPEGVDDAAVRLVDSIRGAIDQATTLVPSGGPR 550
            +   I    + E +D+A       IR AI  AT    +  PR
Sbjct: 728  NFGTIPPIRSKEEIDEAVQTFETKIRDAIASATRERRTPAPR 769


>UniRef50_Q95SX7 Cluster: Probable RNA-directed DNA polymerase from
           transposon BS; n=7; melanogaster subgroup|Rep: Probable
           RNA-directed DNA polymerase from transposon BS -
           Drosophila melanogaster (Fruit fly)
          Length = 906

 Score = 71.3 bits (167), Expect = 2e-11
 Identities = 55/173 (31%), Positives = 79/173 (45%), Gaps = 4/173 (2%)
 Frame = +2

Query: 38  HPGDIRRVLNCDSRPALLVGDLNAKHVAWGSRLNSAVGRRLLEDADRGDYSVVGPDEPTH 217
           H  DI R   C  R  L+ GD NA+H  WG   NS  GR L E        ++    PT 
Sbjct: 121 HFTDIIRA--CGQR-YLVGGDWNARHWLWGDTCNSPRGRELAEALSVTGAKILATGSPTR 177

Query: 218 IPTAAQLQPDVLDVCVHKGLRCPL-TIEALYDLGTPHLPILVTLGMGLTRVATSP--LRP 388
            P      P  +D  V+ G+   L TI   +DL + HLP+++++    T V  SP  +  
Sbjct: 178 YPYVPSHTPSCIDFAVYHGIPDHLATITQSWDLDSDHLPLIISIETDSTHVNPSPRLVTK 237

Query: 389 KVDWELFKRRLVDLPAIQDP-NTPEGVDDAAVRLVDSIRGAIDQATTLVPSGG 544
             D   F R+L  L ++    N+ E ++ A   L +SI  A   +T+ VP  G
Sbjct: 238 HTDLLAFSRQLESLISLNTTLNSGEEIEMAVDNLTESIHRAAAVSTSPVPRIG 290


>UniRef50_Q8I7P8 Cluster: ORF1; n=2; Drosophila melanogaster|Rep:
           ORF1 - Drosophila melanogaster (Fruit fly)
          Length = 884

 Score = 66.9 bits (156), Expect = 3e-10
 Identities = 34/111 (30%), Positives = 58/111 (52%), Gaps = 1/111 (0%)
 Frame = +2

Query: 86  LLVGDLNAKHVAWGSRLNSAVGRRLLEDADRGDYSVVGPDEPTHIPTAAQLQPDVLDVCV 265
           L+ GD N++H AW     +  G+ L E +D G +S++ P +PT+IP   + +   LD+C+
Sbjct: 157 LICGDFNSRHRAWKCTRANGWGKILNELSDLGKFSILYPTQPTYIPHNHKAKASTLDLCL 216

Query: 266 HKGLRCPLTIEALYDLGTPHLPILVTLGMGLTR-VATSPLRPKVDWELFKR 415
                       + +L + HLP+++       R V T P+  + +W LFKR
Sbjct: 217 TNIPNQLANPAVMQELSSDHLPVVIKYSTNFMRNVKTYPILGRANWALFKR 267


>UniRef50_Q18LA9 Cluster: Pol protein; n=8; melanogaster
           subgroup|Rep: Pol protein - Drosophila melanogaster
           (Fruit fly)
          Length = 1103

 Score = 62.1 bits (144), Expect = 9e-09
 Identities = 44/154 (28%), Positives = 72/154 (46%), Gaps = 8/154 (5%)
 Frame = +2

Query: 86  LLVGDLNAKHVAWGSRLNSAVGRRLLED-ADRGDYSVVGPDEPTHIPTAAQLQPDVLDVC 262
           +L GD N KH  WG+ L+ A GR L +    R D  +V     TH P   + QP  LD  
Sbjct: 153 ILGGDWNCKHRLWGNYLSCARGRSLSQSILARKDLDIVATGHATHFPFDKKKQPSALDFA 212

Query: 263 VHKGLRC-PLTIEALYDLGTPHLPILVTL-----GMGLTRVATSPLRPKVDWELFKRRLV 424
           + KG     L   +  +L + HLPI + L          +   + ++ + D   FK+ L 
Sbjct: 213 ICKGFHTQKLKTYSTDELSSDHLPIQIVLDPDDSDWQHNKTNNAIIQKRTDLTKFKKNLE 272

Query: 425 DLPAIQ-DPNTPEGVDDAAVRLVDSIRGAIDQAT 523
           +   +  +  T + +DD    L+++I+ A ++AT
Sbjct: 273 NKILLNTEIRTGQDIDDCIDILINNIKSAANEAT 306


>UniRef50_UPI0000D5792E Cluster: PREDICTED: similar to RNA-directed
           DNA polymerase from mobile element jockey (Reverse
           transcriptase), partial; n=1; Tribolium castaneum|Rep:
           PREDICTED: similar to RNA-directed DNA polymerase from
           mobile element jockey (Reverse transcriptase), partial -
           Tribolium castaneum
          Length = 830

 Score = 59.7 bits (138), Expect = 5e-08
 Identities = 33/91 (36%), Positives = 50/91 (54%), Gaps = 1/91 (1%)
 Frame = +2

Query: 80  PALLVGDLNAKHVAWGSRLNSAVGRRLLEDADRG-DYSVVGPDEPTHIPTAAQLQPDVLD 256
           P +  GD NAKH+ WGSR ++  G  L    D+  D SV+ P EPT     +    D+LD
Sbjct: 256 PTIAAGDFNAKHINWGSRRSNRNGNILNGFTDQHLDISVMAPVEPTFYRN-SDGTADILD 314

Query: 257 VCVHKGLRCPLTIEALYDLGTPHLPILVTLG 349
           V + K +   + + A+ DL + H P+L+ +G
Sbjct: 315 VAIVKNVVHQVRLTAINDLSSDHNPVLMQIG 345


>UniRef50_Q961V7 Cluster: GH03753p; n=5; melanogaster subgroup|Rep:
           GH03753p - Drosophila melanogaster (Fruit fly)
          Length = 888

 Score = 59.7 bits (138), Expect = 5e-08
 Identities = 46/166 (27%), Positives = 79/166 (47%), Gaps = 9/166 (5%)
 Frame = +2

Query: 86  LLVGDLNAKHVAWGSRLNSAVGRRLLEDADRGDYSV--VGPDEPTHIPTAAQLQPDVLDV 259
           +  GD NAKH  WGSRL +  G++L     + +  +  V P +PT+ P   +  PD++D 
Sbjct: 132 IAAGDYNAKHTHWGSRLVTPKGKQLYNALTKPENKLDYVSPGKPTYWPADPRKIPDLIDF 191

Query: 260 CVHKGL-RCPLTIEALYDLGTPHLPILVTLGMGLTR--VATSPLRP---KVDWELFKRRL 421
            + K + R  +T EAL DL + H P+ + +   LTR  +   P R    + +W  +++ +
Sbjct: 192 AITKHVPRNMVTAEALADLSSDHSPVFLNM---LTRHHIVDPPYRLTNFRTNWPRYQKYV 248

Query: 422 VD-LPAIQDPNTPEGVDDAAVRLVDSIRGAIDQATTLVPSGGPRGI 556
              +      +T E +D +   L + +  A   +T  V    P  I
Sbjct: 249 CSHIELTTALSTKEDIDKSTETLENILVSAAKASTPPVTYAKPNYI 294


>UniRef50_A3FMR3 Cluster: Pol-like protein; n=2; Biomphalaria
           glabrata|Rep: Pol-like protein - Biomphalaria glabrata
           (Bloodfluke planorb)
          Length = 1222

 Score = 59.3 bits (137), Expect = 7e-08
 Identities = 44/136 (32%), Positives = 63/136 (46%), Gaps = 3/136 (2%)
 Frame = +2

Query: 20  PPGPDFHPGDIRRVLNCDSRPALLVGDLNAKHVAWGSRLNSAVGRRLLEDADRGDYSVVG 199
           PPG   +  D+  +L    RP L++GD NA +  WGS      GR L +   + D  ++ 
Sbjct: 105 PPGAPLNRTDMEDLLKQLPRPYLILGDFNAHNTMWGSNNTDTRGRMLEDIFLQHDLCILN 164

Query: 200 PDEPTHI-PTAAQLQPDVLDVCVHKGLRCPLTIEALYDL-GTPHLPILVTLGM-GLTRVA 370
              PT++ P         L VCV  GL          DL G+ H PI++T  +  L R  
Sbjct: 165 DASPTYLHPGTGSFTCIDLTVCV-PGLLDDFKWSVSNDLRGSDHFPIIITNNLPSLGRPQ 223

Query: 371 TSPLRPKVDWELFKRR 418
              L+ K DWE F++R
Sbjct: 224 RWKLK-KADWEQFQKR 238


>UniRef50_Q9NBX4 Cluster: Probable RNA-directed DNA polymerase from
           transposon X-element; n=1; Drosophila melanogaster|Rep:
           Probable RNA-directed DNA polymerase from transposon
           X-element - Drosophila melanogaster (Fruit fly)
          Length = 908

 Score = 57.2 bits (132), Expect = 3e-07
 Identities = 44/172 (25%), Positives = 75/172 (43%), Gaps = 4/172 (2%)
 Frame = +2

Query: 20  PPGPDFHPGDIRRVLNCDSRPALLVGDLNAKHVAWGSRLNSAVGRRLLEDADRGDYSVVG 199
           PP   +   + + +L       ++ GD NA H  WG+  ++  G  L       +   + 
Sbjct: 111 PPRFAWTTDEFKDILEEFQTKFIVAGDWNASHWLWGAGRSNQRGIALANLVLNSEVDSLA 170

Query: 200 PDEPTHIPTAAQLQPDVLDVCVHKG-LRCPLTIEALYDLGTPHLPILVTLGMGLTRVATS 376
              PT  P   +  P  +D  + KG L     I A+ +L + HLP+++TL  G       
Sbjct: 171 TGGPTRYPYGCRGSPGYIDFALTKGVLGIHANISAVVELSSDHLPLVITLDAGAISYPKM 230

Query: 377 P--LRPKVDWELFKRRLVD-LPAIQDPNTPEGVDDAAVRLVDSIRGAIDQAT 523
              +  + + E+F+ +L   LP     N+ + VDDA   L ++I+ A   AT
Sbjct: 231 ERLITRRTNLEVFQSQLESTLPLNTAINSGQDVDDAIELLTNNIKSAARLAT 282


>UniRef50_Q86GH0 Cluster: Pol protein; n=1; Drosophila
           americana|Rep: Pol protein - Drosophila americana (Fruit
           fly)
          Length = 1517

 Score = 56.0 bits (129), Expect = 6e-07
 Identities = 47/153 (30%), Positives = 70/153 (45%), Gaps = 7/153 (4%)
 Frame = +2

Query: 86  LLVGDLNAKHVAWGSRLNSAVGRRLLEDA-DRGDYSVVGPDEPTHIPTAAQLQPDVLDVC 262
           ++ GD NAK   WG+  +   GR LL        Y+++     TH P A   QP  +D  
Sbjct: 210 IICGDWNAKSTWWGNMRHCQRGRELLRTIHSNKKYNILATGGTTHYPYARGNQPSAIDFA 269

Query: 263 VHKGL-RCPLTIEALYDLGTPHLPILVTLGMG--LTR--VATSPLRPKVDWELFKRRL-V 424
           ++ G+    L   ++ DL + HLPIL+ L +G  L R  V    L    + + FKR L  
Sbjct: 270 IYGGIGDRRLRTYSINDLNSDHLPILIDLAIGQALNRNNVKNKILPRNANIKKFKRILNQ 329

Query: 425 DLPAIQDPNTPEGVDDAAVRLVDSIRGAIDQAT 523
           +L    + N+   ++DA   L   I  A   AT
Sbjct: 330 NLRLNIEINSGTDIEDAIDILYRKIENAASAAT 362


>UniRef50_P21328 Cluster: RNA-directed DNA polymerase from mobile
           element jockey; n=4; Drosophiliti|Rep: RNA-directed DNA
           polymerase from mobile element jockey - Drosophila
           melanogaster (Fruit fly)
          Length = 916

 Score = 55.2 bits (127), Expect = 1e-06
 Identities = 34/110 (30%), Positives = 47/110 (42%), Gaps = 1/110 (0%)
 Frame = +2

Query: 20  PPGPDFHPGDIRRVLNCDSRPALLVGDLNAKHVAWGSRLNSAVGRRLLEDADRGDYSVVG 199
           PP   +   D + +        +  GD NAKH  WG+  +   G+ L E    G Y V+ 
Sbjct: 112 PPAERWIVDDFKSMFAALGNKFIAGGDYNAKHAWWGNPRSCPRGKMLQEVIAHGQYQVLA 171

Query: 200 PDEPTHIPTAAQLQPDVLDVCVHKGLRC-PLTIEALYDLGTPHLPILVTL 346
             EPT       L P  LD  +  G     L ++ L +L + HLPIL  L
Sbjct: 172 TGEPTFYSYNPLLTPSALDFFITCGYGMGRLDVQTLQELSSDHLPILAVL 221


>UniRef50_UPI0000D578A9 Cluster: PREDICTED: similar to RNA-directed
           DNA polymerase from mobile element jockey (Reverse
           transcriptase); n=1; Tribolium castaneum|Rep: PREDICTED:
           similar to RNA-directed DNA polymerase from mobile
           element jockey (Reverse transcriptase) - Tribolium
           castaneum
          Length = 894

 Score = 54.0 bits (124), Expect = 2e-06
 Identities = 31/89 (34%), Positives = 48/89 (53%), Gaps = 1/89 (1%)
 Frame = +2

Query: 86  LLVGDLNAKHVAWGSRLNSAVGRRLLEDADRG-DYSVVGPDEPTHIPTAAQLQPDVLDVC 262
           +  GD NAKH+ W SR ++  G  L    D+  D SV+ P EPT    +     D+LDV 
Sbjct: 428 IAAGDFNAKHINWESRRSNRNGNILNGFTDQHLDISVLAPVEPTFYRNSDGAA-DILDVA 486

Query: 263 VHKGLRCPLTIEALYDLGTPHLPILVTLG 349
           + K +   + + A+ DL + H P+L+ +G
Sbjct: 487 IVKNVVHQVRLSAINDLSSDHNPVLMQIG 515


>UniRef50_Q6UJ39 Cluster: Pol protein; n=1; Drosophila virilis|Rep:
           Pol protein - Drosophila virilis (Fruit fly)
          Length = 891

 Score = 53.2 bits (122), Expect = 4e-06
 Identities = 33/89 (37%), Positives = 47/89 (52%), Gaps = 2/89 (2%)
 Frame = +2

Query: 86  LLVGDLNAKHVAWGSRLNSAVGRRLLED-ADRGDYSVVGPDEPTHIPTAAQLQPDVLDVC 262
           L+ GD NAKH  WG+      G  L     D   Y+V+   EPTH P+ +  +P VLD  
Sbjct: 133 LIGGDWNAKHRLWGNMRRCPRGSILANILMDSNKYNVLTTAEPTHFPSNSN-RPSVLDFG 191

Query: 263 VHKGLRC-PLTIEALYDLGTPHLPILVTL 346
           ++ G+    L I  + +L + HLP+LV L
Sbjct: 192 IYAGISSHRLAISRVTELHSDHLPLLVQL 220


>UniRef50_Q6J4U7 Cluster: Pol protein; n=9; cellular organisms|Rep:
           Pol protein - Drosophila melanogaster (Fruit fly)
          Length = 1092

 Score = 47.2 bits (107), Expect = 3e-04
 Identities = 46/183 (25%), Positives = 77/183 (42%), Gaps = 15/183 (8%)
 Frame = +2

Query: 20  PPGPDFHPGDIRRVLNCDSRPA------LLVGDLNAKHVAWGSRLNSAVGRRLLEDADRG 181
           PP   + P     VLN   +        +L GD NAKH  WG  + +      L DA + 
Sbjct: 133 PPSLSWSPHHFTDVLNFAEKTMGGQTKLILCGDWNAKHRQWGC-IRACQRGAALYDAIQA 191

Query: 182 D--YSVVGPDEPTHIPTAAQLQPDVLDVCVHKGL-RCPLTIEALYDLGTPHLPILVTLGM 352
           D    +V     TH P   +  P  +D  + K L R    I +   L + HLPIL+ + +
Sbjct: 192 DSMAEIVATGSATHFPHDTRKSPSAIDFSICKRLGRYEKRISSSAHLSSDHLPILLEINL 251

Query: 353 GLTRVA-----TSPLRPKVDWELFKRRLVDLPAIQ-DPNTPEGVDDAAVRLVDSIRGAID 514
            +  ++      + L+   + ELFK  L     +  +    E ++DA    + +I+ +  
Sbjct: 252 DIKTISLQKQNNNILKKTTNIELFKNVLERKILLNTEIRVAEDINDAINIFIKNIKDSAA 311

Query: 515 QAT 523
           ++T
Sbjct: 312 EST 314


>UniRef50_UPI00015B43EC Cluster: PREDICTED: similar to pol-like
           protein; n=1; Nasonia vitripennis|Rep: PREDICTED:
           similar to pol-like protein - Nasonia vitripennis
          Length = 1119

 Score = 44.4 bits (100), Expect = 0.002
 Identities = 17/49 (34%), Positives = 29/49 (59%)
 Frame = +2

Query: 74  SRPALLVGDLNAKHVAWGSRLNSAVGRRLLEDADRGDYSVVGPDEPTHI 220
           S+  +L GD NA H  WGS      G+ ++E+ D+G++ ++    PTH+
Sbjct: 119 SKHFILAGDFNAHHSVWGSSKECCNGKVIVENLDQGNFILLNNQSPTHV 167


>UniRef50_UPI00015B4771 Cluster: PREDICTED: similar to secreted
           protein; n=1; Nasonia vitripennis|Rep: PREDICTED:
           similar to secreted protein - Nasonia vitripennis
          Length = 1163

 Score = 44.0 bits (99), Expect = 0.003
 Identities = 36/130 (27%), Positives = 59/130 (45%), Gaps = 6/130 (4%)
 Frame = +2

Query: 80  PALLVGDLNAKHVAWGSRLNSAVGRRLLEDADRGDYSVVGPDE-PTHIPTAAQLQPDVLD 256
           P L+ GD NA+H  WGS + + +GR L    +   +  +  D+  T I +     PD+  
Sbjct: 304 PLLISGDFNAQHNMWGSEIENGLGRTLRSALESSPHFYILNDKLATRIHSKTSC-PDI-- 360

Query: 257 VCVHKGLRCPLTIEALYD-LGTPHLPILVTLGMGLTRVATSPLR---PKVDWELFKRRL- 421
                 L   + ++   D +G+ H PI  T+  G   ++    R    ++DWE F   + 
Sbjct: 361 SLTSPDLYTCINLKMGEDSMGSDHFPICHTIEAGEIFLSQDLFRMSLTRIDWEAFADEVD 420

Query: 422 VDLPAIQDPN 451
           V  PAI+  N
Sbjct: 421 VRTPAIESVN 430


>UniRef50_UPI0000D5790F Cluster: PREDICTED: similar to RNA-directed
           DNA polymerase from mobile element jockey (Reverse
           transcriptase); n=1; Tribolium castaneum|Rep: PREDICTED:
           similar to RNA-directed DNA polymerase from mobile
           element jockey (Reverse transcriptase) - Tribolium
           castaneum
          Length = 932

 Score = 43.2 bits (97), Expect = 0.005
 Identities = 21/54 (38%), Positives = 30/54 (55%), Gaps = 1/54 (1%)
 Frame = +2

Query: 62  LNCDSRPALLVGDLNAKHVAWGSRLNSAVGRRLLEDADRGDYSVVGP-DEPTHI 220
           LN      ++VGD NAK  AWGS+     GR L++   + DY++    DEPT +
Sbjct: 66  LNSSGEECIIVGDFNAKSPAWGSKKEDERGRILMDWIAQRDYTIQNTGDEPTFV 119


>UniRef50_Q9TYX8 Cluster: Putative uncharacterized protein R11E3.3;
           n=1; Caenorhabditis elegans|Rep: Putative
           uncharacterized protein R11E3.3 - Caenorhabditis elegans
          Length = 931

 Score = 41.1 bits (92), Expect = 0.019
 Identities = 33/127 (25%), Positives = 52/127 (40%), Gaps = 5/127 (3%)
 Frame = +2

Query: 47  DIRRVLNCDSRPALLVGDLNAKHVAWGSR-LNSAVGRRLLEDAD-RGDYSVVGPDEPTHI 220
           D   +    S+ +++ GD+NA H AW S       GR L E  D   D  +      T  
Sbjct: 23  DFSNIFQTKSK-SIISGDVNAHHSAWHSEGSEDTRGRELAELIDLHPDLIIQNEQVHTRA 81

Query: 221 PTAAQLQPDVLDVCVHKGLRCPLTIEALYDLGTPHLPILVTLGMGLTRVATSPL---RPK 391
            T +   PD+         +C  +   LY LG+ H+P+ + +    T      L     K
Sbjct: 82  DTYSISSPDITICTADLATKCHWS--TLYKLGSDHIPMKLKINQAATPKRPKRLVANFKK 139

Query: 392 VDWELFK 412
            +W+LF+
Sbjct: 140 ANWQLFR 146


>UniRef50_Q9GP60 Cluster: Pol protein; n=1; Drosophila
           melanogaster|Rep: Pol protein - Drosophila melanogaster
           (Fruit fly)
          Length = 1227

 Score = 39.5 bits (88), Expect = 0.057
 Identities = 35/135 (25%), Positives = 56/135 (41%), Gaps = 3/135 (2%)
 Frame = +2

Query: 20  PPGPDFHPGDIRRVLNCDSRPALLVGDLNAKHVAWGSRLNSAVGRRLLEDADRGDYSVVG 199
           PP   F   DI  +L   +   +L+GDLN+    WGS   +  G+++          V+ 
Sbjct: 109 PPSQIFSSSDISEILQNLNGSTILLGDLNSWSPLWGSPRTNTRGKKIETVILENSLIVLN 168

Query: 200 PDEPTHIPTAAQL-QPDVLDVCVHKGLRCPLTI-EALYDLGTPHLPILVTLGMGLTRVAT 373
              PTH+ T       D+  +       C  +I + L+  G+ H PI + +        T
Sbjct: 169 DGSPTHLSTHNTFTHIDISLISPQIAHMCSWSISDNLH--GSDHFPITIHINTPTRPDNT 226

Query: 374 SPL-RPKVDWELFKR 415
            PL + K D   +KR
Sbjct: 227 LPLPKYKTDQANWKR 241


>UniRef50_A6GFD7 Cluster: Protein phosphatase/cyclic
           nucleotide-binding domain protein; n=1; Plesiocystis
           pacifica SIR-1|Rep: Protein phosphatase/cyclic
           nucleotide-binding domain protein - Plesiocystis
           pacifica SIR-1
          Length = 256

 Score = 38.3 bits (85), Expect = 0.13
 Identities = 29/81 (35%), Positives = 37/81 (45%), Gaps = 3/81 (3%)
 Frame = +2

Query: 311 LGTPHLPILVTL-GMGLTRVATSPLRPKVD--WELFKRRLVDLPAIQDPNTPEGVDDAAV 481
           L  P L + V   G+G         R  VD  WE FKR    L  + D +T     +AA 
Sbjct: 23  LADPDLGLFVVCDGVGGRARGEIASREAVDFIWEWFKREEKSLAELLDADTKSSSSEAAG 82

Query: 482 RLVDSIRGAIDQATTLVPSGG 544
           +L   +RGAI  AT +V S G
Sbjct: 83  KLCQVMRGAIQNATYMVHSLG 103


>UniRef50_Q24363 Cluster: Putative ORF2; n=2; melanogaster
           subgroup|Rep: Putative ORF2 - Drosophila melanogaster
           (Fruit fly)
          Length = 1219

 Score = 38.3 bits (85), Expect = 0.13
 Identities = 28/100 (28%), Positives = 39/100 (39%), Gaps = 1/100 (1%)
 Frame = +2

Query: 50  IRRVLNCDSRPALLVGDLNAKHVAWGSRLNSAVGRRLLEDADRGDYSVVGPDEPTHIPTA 229
           +    N    P+L+ GD N  H  WGS   +  G+      D     ++    PTH  T 
Sbjct: 115 LHNTFNIQQTPSLITGDFNGWHHPWGSPTTNKRGKITHRFIDNMHLILLNDKSPTHFSTH 174

Query: 230 AQLQPDVLDVCVHKGLRCPLTIEALYDL-GTPHLPILVTL 346
                  L +C    L      + L DL G+ H PI+ TL
Sbjct: 175 NTYTHIDLTLC-SPILAPHAKWKILNDLHGSDHFPIITTL 213


>UniRef50_Q7RX84 Cluster: Pre-mRNA-splicing factor cwc-22; n=18;
           Dikarya|Rep: Pre-mRNA-splicing factor cwc-22 -
           Neurospora crassa
          Length = 1010

 Score = 38.3 bits (85), Expect = 0.13
 Identities = 26/71 (36%), Positives = 36/71 (50%), Gaps = 1/71 (1%)
 Frame = +3

Query: 357 SPGLR-PRPYDRRSTGSSLRDA*STFPQFRTPTPLRGSTTRQSALSTPSGERSTRRRLLC 533
           SPG R P P  RR    S RD   + P+ R+PTP   S +R+S  S PS  + +  R + 
Sbjct: 55  SPGERTPSPSPRRDRSLSPRDQPHSHPRSRSPTPRSQSPSRRSVRS-PSPRQGSPARRVD 113

Query: 534 PAAGPEVYSRP 566
            ++ P   S P
Sbjct: 114 RSSSPRARSPP 124


>UniRef50_Q1E629 Cluster: Putative uncharacterized protein; n=1;
           Coccidioides immitis|Rep: Putative uncharacterized
           protein - Coccidioides immitis
          Length = 481

 Score = 36.3 bits (80), Expect = 0.53
 Identities = 23/72 (31%), Positives = 35/72 (48%)
 Frame = +2

Query: 8   PRI*PPGPDFHPGDIRRVLNCDSRPALLVGDLNAKHVAWGSRLNSAVGRRLLEDADRGDY 187
           P    P P++H    RRV++  +R  + V      H A+ S+ N    +RLL      D 
Sbjct: 9   PETAEPSPEYHSSLSRRVVSPGTRMVIFVDYAEDDHAAFASQKN-LEAKRLLS----ADI 63

Query: 188 SVVGPDEPTHIP 223
           +V+GP E T +P
Sbjct: 64  AVLGPPENTRMP 75


>UniRef50_Q868Q4 Cluster: Reverse transcriptase; n=3; Bombyx
           mori|Rep: Reverse transcriptase - Bombyx mori (Silk
           moth)
          Length = 1076

 Score = 35.9 bits (79), Expect = 0.70
 Identities = 17/30 (56%), Positives = 18/30 (60%)
 Frame = +2

Query: 77  RPALLVGDLNAKHVAWGSRLNSAVGRRLLE 166
           R  +L GD NAK VAWGS    A GR L E
Sbjct: 120 RSVILAGDFNAKSVAWGSPFTDARGRLLEE 149


>UniRef50_Q07995 Cluster: Reverse transcriptase homolog protein;
           n=80; Culicimorpha|Rep: Reverse transcriptase homolog
           protein - Chironomus thummi
          Length = 883

 Score = 35.9 bits (79), Expect = 0.70
 Identities = 20/71 (28%), Positives = 32/71 (45%)
 Frame = +2

Query: 47  DIRRVLNCDSRPALLVGDLNAKHVAWGSRLNSAVGRRLLEDADRGDYSVVGPDEPTHIPT 226
           DI ++ N       + GD NAKH  W   + +  G  L E +  G++ +  PD PT+ P 
Sbjct: 130 DINKITNLRGN-YYICGDFNAKHREWNCNVANKSGNILQEMS--GEFVIYFPDSPTYYPE 186

Query: 227 AAQLQPDVLDV 259
                   +D+
Sbjct: 187 DRNKSVSTIDL 197


>UniRef50_Q86X51 Cluster: Similar to CG32656-PA; n=4;
           Catarrhini|Rep: Similar to CG32656-PA - Homo sapiens
           (Human)
          Length = 503

 Score = 35.9 bits (79), Expect = 0.70
 Identities = 19/40 (47%), Positives = 22/40 (55%)
 Frame = -2

Query: 140 SSVGSPTRRASR*GPRPAELGGCRNSGPVLCPRGENQAPG 21
           +SV  P RR     P PA  G  R+S PV  PRG + APG
Sbjct: 272 ASVPGPARRGCDSAPGPARRG--RDSAPVSAPRGRDSAPG 309


>UniRef50_UPI0000D57951 Cluster: PREDICTED: similar to RNA-directed
           DNA polymerase from mobile element jockey (Reverse
           transcriptase); n=2; Tribolium castaneum|Rep: PREDICTED:
           similar to RNA-directed DNA polymerase from mobile
           element jockey (Reverse transcriptase) - Tribolium
           castaneum
          Length = 971

 Score = 35.1 bits (77), Expect = 1.2
 Identities = 35/154 (22%), Positives = 60/154 (38%), Gaps = 7/154 (4%)
 Frame = +2

Query: 83  ALLVGDLNAKHVAWGSRLNSAVGRRLLEDADRGDYSVVGPDEPTHI-PTAAQLQPDVLDV 259
           A+++GD NA+H  +G  L +  G  L++         +    PTHI         D + V
Sbjct: 133 AIILGDFNARHTDFGDTLTNRNGHILIDAISNLPLYRIPNSSPTHINHWEGYSIVDHILV 192

Query: 260 CVHKGLRCPLTIEALYDLGTPHLPILVTLGMGLTRVATSPL-----RPKVDWELFKRRL- 421
                 R   +      + + HLP++  L +   R  T            DWE F+  L 
Sbjct: 193 TDSLSNRASDSANIGTTITSDHLPLVFDLSVSKPRTPTPEYIIIRDSKNTDWEKFRIILE 252

Query: 422 VDLPAIQDPNTPEGVDDAAVRLVDSIRGAIDQAT 523
            ++  +    TPE ++     + + I+ A  Q T
Sbjct: 253 KEIVPLDPTTTPEEIERQVFYISELIQDAYLQCT 286


>UniRef50_A3VVD2 Cluster: Putative uncharacterized protein; n=1;
           Parvularcula bermudensis HTCC2503|Rep: Putative
           uncharacterized protein - Parvularcula bermudensis
           HTCC2503
          Length = 563

 Score = 35.1 bits (77), Expect = 1.2
 Identities = 28/102 (27%), Positives = 43/102 (42%)
 Frame = +2

Query: 101 LNAKHVAWGSRLNSAVGRRLLEDADRGDYSVVGPDEPTHIPTAAQLQPDVLDVCVHKGLR 280
           L  KH+ W     S  GR  L+   +G   +V  +   H      L  D  D     G+ 
Sbjct: 258 LGDKHLFW-----SETGRTFLQYGVKGRRLIVMGEPYGHSAEVLGLLRDFRDFADRNGMS 312

Query: 281 CPLTIEALYDLGTPHLPILVTLGMGLTRVATSPLRPKVDWEL 406
                 A Y +G   LP+L+ LG+ + ++  + L P VD+ L
Sbjct: 313 L-----AFYSVGRDLLPMLIELGLIIQKMGETALMPLVDFSL 349


>UniRef50_A7ERU2 Cluster: Putative uncharacterized protein; n=12;
           Sclerotinia sclerotiorum 1980|Rep: Putative
           uncharacterized protein - Sclerotinia sclerotiorum 1980
          Length = 1660

 Score = 35.1 bits (77), Expect = 1.2
 Identities = 35/121 (28%), Positives = 51/121 (42%), Gaps = 9/121 (7%)
 Frame = +2

Query: 86  LLVGDLNAKHVAWGSRLNSAVGRRLLEDADRGDYSVVGPDEP--THIPTAAQLQPDVLDV 259
           +LVGD N+ H  W    N +    LL +    D++++  +EP  +         P VLD+
Sbjct: 497 ILVGDFNSHHPWWDPFSNKSSNADLLTEWFE-DHNLILFNEPGTSTFYRTNMTNPSVLDL 555

Query: 260 CVHKGLRCPLTI--EALYDLGTPHLPILVTLGMGLTRVA--TSPLR---PKVDWELFKRR 418
            +      P     + L DLG+ HL IL  +   L+R      P R      DWE F   
Sbjct: 556 TLATDSVSPYITDWQVLPDLGSDHLSILFEVKGTLSRTTNIAQPARFNTKLADWEKFANT 615

Query: 419 L 421
           L
Sbjct: 616 L 616


>UniRef50_Q9U509 Cluster: Putative cuticle protein; n=1; Manduca
           sexta|Rep: Putative cuticle protein - Manduca sexta
           (Tobacco hawkmoth) (Tobacco hornworm)
          Length = 158

 Score = 34.3 bits (75), Expect = 2.2
 Identities = 15/26 (57%), Positives = 17/26 (65%), Gaps = 1/26 (3%)
 Frame = +1

Query: 313 GYPPSPYPGHTG-NGAHPGCDLAPTT 387
           GYP S YPG  G  GAHPGC L  ++
Sbjct: 60  GYPGSHYPGPAGPPGAHPGCPLCDSS 85


>UniRef50_Q4Q9P4 Cluster: Kinesin, putative; n=3; Leishmania|Rep:
           Kinesin, putative - Leishmania major
          Length = 1062

 Score = 34.3 bits (75), Expect = 2.2
 Identities = 29/81 (35%), Positives = 38/81 (46%)
 Frame = -2

Query: 257 HPTRRAGVARRSECAWVRRGRPQSSRPYRHLLTAACPLLSSVGSPTRRASR*GPRPAELG 78
           HP+R    A      +  RG   SS   R  +T+  P  S+  SPTRRA R  PR    G
Sbjct: 582 HPSRVMAAA----APYSARGSTTSSLQ-RGSVTSGAP--SASVSPTRRAGR--PRCGGGG 632

Query: 77  GCRNSGPVLCPRGENQAPGVI 15
              +SGP  CP G + + G +
Sbjct: 633 TAASSGPRRCPVGNSNSTGAL 653


>UniRef50_Q7RZC6 Cluster: Putative uncharacterized protein
           NCU03928.1; n=2; Neurospora crassa|Rep: Putative
           uncharacterized protein NCU03928.1 - Neurospora crassa
          Length = 1100

 Score = 34.3 bits (75), Expect = 2.2
 Identities = 22/57 (38%), Positives = 29/57 (50%)
 Frame = +3

Query: 372 PRPYDRRSTGSSLRDA*STFPQFRTPTPLRGSTTRQSALSTPSGERSTRRRLLCPAA 542
           PRP  R +TG S  DA S+   F+   P+R +T      S PS + S + R L  AA
Sbjct: 352 PRPLGRAATGLSNYDAASSQSNFQPRPPIRTATGISHVSSVPSQQPSFQPRPLTRAA 408


>UniRef50_Q9N9Z1 Cluster: Endonuclease/reverse transcriptase; n=1;
           Drosophila melanogaster|Rep: Endonuclease/reverse
           transcriptase - Drosophila melanogaster (Fruit fly)
          Length = 989

 Score = 33.9 bits (74), Expect = 2.8
 Identities = 13/30 (43%), Positives = 21/30 (70%)
 Frame = +2

Query: 77  RPALLVGDLNAKHVAWGSRLNSAVGRRLLE 166
           RP ++ GDLNA    WGSR+++  GR +++
Sbjct: 118 RPTVIGGDLNAWATEWGSRISNTRGRAVID 147


>UniRef50_A4R467 Cluster: Putative uncharacterized protein; n=1;
           Magnaporthe grisea|Rep: Putative uncharacterized protein
           - Magnaporthe grisea (Rice blast fungus) (Pyricularia
           grisea)
          Length = 354

 Score = 33.9 bits (74), Expect = 2.8
 Identities = 24/70 (34%), Positives = 35/70 (50%)
 Frame = -3

Query: 226 GRNVRGFVGADHRVVAPIGIF*QPPAHC*VQSGAPRDVLRVEVPDQQSWAAVAIQDPSYV 47
           G  +  F G  ++     G+F +  A+  V S     + R+EVP   SWA VAI D  Y+
Sbjct: 272 GDRIYTFGGEGNQAEGSNGVFSETEAYH-VVSDTWEKLQRMEVPRHGSWA-VAIGDGVYL 329

Query: 46  PGVKIRPRGS 17
           PG  +R  G+
Sbjct: 330 PGGGVRQGGA 339


>UniRef50_A4V8V3 Cluster: Putative 5'-terminal protein; n=1;
           Arthrobacter nitroguajacolicus|Rep: Putative 5'-terminal
           protein - Arthrobacter nitroguajacolicus
          Length = 207

 Score = 33.5 bits (73), Expect = 3.8
 Identities = 14/24 (58%), Positives = 18/24 (75%)
 Frame = -2

Query: 248 RRAGVARRSECAWVRRGRPQSSRP 177
           RRAGV+ R+   WV+RG P+S RP
Sbjct: 39  RRAGVSERTVRRWVQRGLPKSRRP 62


>UniRef50_Q6Z2C3 Cluster: Putative uncharacterized protein
           OJ1034_C08.13-2; n=4; Oryza sativa|Rep: Putative
           uncharacterized protein OJ1034_C08.13-2 - Oryza sativa
           subsp. japonica (Rice)
          Length = 298

 Score = 33.5 bits (73), Expect = 3.8
 Identities = 21/59 (35%), Positives = 28/59 (47%)
 Frame = +3

Query: 369 RPRPYDRRSTGSSLRDA*STFPQFRTPTPLRGSTTRQSALSTPSGERSTRRRLLCPAAG 545
           RPRP +R    + L  A          TPL  + T  S  S+ SG+ S+R+R   P AG
Sbjct: 173 RPRPVERAHVKTVLAAAKEAMEASSPETPLDYAATTGSGASS-SGDESSRKRKAAPGAG 230


>UniRef50_Q7RXY5 Cluster: Putative uncharacterized protein NCU00459.1;
            n=3; Sordariomycetes|Rep: Putative uncharacterized
            protein NCU00459.1 - Neurospora crassa
          Length = 3054

 Score = 33.5 bits (73), Expect = 3.8
 Identities = 25/77 (32%), Positives = 36/77 (46%)
 Frame = -1

Query: 309  SYSASIVKGHRSPL*THTSNTSGWSCAAVGMCVGSSGPTTE*SPLSASSNSRLPTAEFSR 130
            S S+SI    RSPL   T+ T+G S +A      +SGP      ++  +   LP      
Sbjct: 2826 SRSSSIASSQRSPLVPQTTATAGTSSSAQST---ASGPPAVGFTMTPPT-PILPPGMDGN 2881

Query: 129  EPHATCFALRSPTSRAG 79
            +PH   F+L  P + AG
Sbjct: 2882 QPHRGAFSLLRPATSAG 2898


>UniRef50_Q0CM53 Cluster: Predicted protein; n=1; Aspergillus
           terreus NIH2624|Rep: Predicted protein - Aspergillus
           terreus (strain NIH 2624)
          Length = 924

 Score = 33.5 bits (73), Expect = 3.8
 Identities = 30/108 (27%), Positives = 44/108 (40%), Gaps = 5/108 (4%)
 Frame = -1

Query: 369 ATRVSPIPSVTRIGRWGVPRSYSASIVKGHRSPL*THTSNTSGWSCAAVGMCVGSSGP-- 196
           A+ V+P+ S ++ G   VP++Y      G    L +    TS    A+        GP  
Sbjct: 535 ASPVTPVKSTSQSGEGSVPKNYPTPNTAGSPESLRSFPPRTSSRDQASQRTMQSGPGPAI 594

Query: 195 -TTE*SPLSASSNSRLPTAEFSREPHATCFAL-RSPTSRAGR-LSQFR 61
            +   S  S   NS +     S+EP      L R P S++ R L  FR
Sbjct: 595 VSAHVSDQSEKQNSNVAPQNLSKEPTTQAEQLARLPDSKSTRMLDSFR 642


>UniRef50_UPI0000F2BA80 Cluster: PREDICTED: hypothetical protein;
           n=1; Monodelphis domestica|Rep: PREDICTED: hypothetical
           protein - Monodelphis domestica
          Length = 521

 Score = 33.1 bits (72), Expect = 5.0
 Identities = 14/26 (53%), Positives = 16/26 (61%)
 Frame = +3

Query: 297 RHCTTWVPPISLSWSHWEWGSPGLRP 374
           R  T   PP++LS S W WG PGL P
Sbjct: 77  RSWTAPPPPLTLSVSAWLWGRPGLTP 102


>UniRef50_O12982 Cluster: DsRNA adenosine deaminase; n=3;
           Xenopus|Rep: DsRNA adenosine deaminase - Xenopus laevis
           (African clawed frog)
          Length = 1270

 Score = 33.1 bits (72), Expect = 5.0
 Identities = 21/46 (45%), Positives = 25/46 (54%)
 Frame = -2

Query: 161 TAACPLLSSVGSPTRRASR*GPRPAELGGCRNSGPVLCPRGENQAP 24
           T  CPLL +  +PTR + R GP PA     RN GP   PR  N+ P
Sbjct: 80  TQQCPLLQAPPAPTRFSHR-GP-PAS-PRFRNQGPSASPRFSNRGP 122


>UniRef50_Q6A9X8 Cluster: ABC transporter, ATP-binding protein; n=7;
           Actinomycetales|Rep: ABC transporter, ATP-binding
           protein - Propionibacterium acnes
          Length = 601

 Score = 33.1 bits (72), Expect = 5.0
 Identities = 17/46 (36%), Positives = 27/46 (58%)
 Frame = -2

Query: 260 THPTRRAGVARRSECAWVRRGRPQSSRPYRHLLTAACPLLSSVGSP 123
           ++  +R  +AR+ E AW+RRG P  S   R+ + AA  L++ V  P
Sbjct: 224 SNEAKRQNLARK-ELAWLRRGAPARSSKPRYRVEAANALIADVPEP 268


>UniRef50_Q7AJI7 Cluster: Riorf145 protein; n=1; Agrobacterium
           rhizogenes|Rep: Riorf145 protein - Agrobacterium
           rhizogenes
          Length = 100

 Score = 33.1 bits (72), Expect = 5.0
 Identities = 19/49 (38%), Positives = 26/49 (53%), Gaps = 1/49 (2%)
 Frame = -2

Query: 308 RTVPQ*LRGTVAPYERTHPTRRAGV-ARRSECAWVRRGRPQSSRPYRHL 165
           R +P  +   VA Y  T    R    +R+S   W+RR R  +SRPYR+L
Sbjct: 27  RNLPSDVLAKVATYVPTTGCGRNRTRSRKSRANWLRRSRSFTSRPYRNL 75


>UniRef50_A4TU85 Cluster: Beta-ketoacyl synthase; n=1;
           Magnetospirillum gryphiswaldense|Rep: Beta-ketoacyl
           synthase - Magnetospirillum gryphiswaldense
          Length = 613

 Score = 33.1 bits (72), Expect = 5.0
 Identities = 22/71 (30%), Positives = 27/71 (38%)
 Frame = +3

Query: 354 GSPGLRPRPYDRRSTGSSLRDA*STFPQFRTPTPLRGSTTRQSALSTPSGERSTRRRLLC 533
           G+PG  P P   + T   LR    +F     PTP+ G+        TP        R LC
Sbjct: 528 GTPGRAPGPLTGKGTPLPLRAGIQSFRVSAAPTPIGGARGNGGGNPTPK-RPPPPARALC 586

Query: 534 PAAGPEVYSRP 566
            A GP     P
Sbjct: 587 GAWGPHFRRTP 597


>UniRef50_Q10SE6 Cluster: Beta-carotene hydroxylase, putative,
           expressed; n=1; Oryza sativa (japonica
           cultivar-group)|Rep: Beta-carotene hydroxylase,
           putative, expressed - Oryza sativa subsp. japonica
           (Rice)
          Length = 262

 Score = 33.1 bits (72), Expect = 5.0
 Identities = 22/51 (43%), Positives = 26/51 (50%), Gaps = 1/51 (1%)
 Frame = +3

Query: 360 PGLRPRPYDRRSTGS-SLRDA*STFPQFRTPTPLRGSTTRQSALSTPSGER 509
           P  RPRP  RR T   ++RD     P+   P PL G   RQ AL  P+G R
Sbjct: 183 PRPRPRPLLRRGTRDHAVRDGVHVRPRRPGPPPLPGGAHRQRAL-LPAGRR 232


>UniRef50_A1CTN3 Cluster: Proline oxidase PrnD; n=11; cellular
           organisms|Rep: Proline oxidase PrnD - Aspergillus
           clavatus
          Length = 480

 Score = 33.1 bits (72), Expect = 5.0
 Identities = 20/48 (41%), Positives = 26/48 (54%)
 Frame = -3

Query: 319 GTQVVQCLNS*GAP*PLMNAHIQHVGLELRGGRNVRGFVGADHRVVAP 176
           GTQ +  L    AP P M++ IQ V  +L   RNVR  V A+ + V P
Sbjct: 200 GTQALSILQQQAAPSPFMDSAIQKV-CDLAISRNVRLLVDAEEQAVQP 246


>UniRef50_P08699 Cluster: Galectin-3; n=16; Tetrapoda|Rep:
           Galectin-3 - Rattus norvegicus (Rat)
          Length = 262

 Score = 33.1 bits (72), Expect = 5.0
 Identities = 18/37 (48%), Positives = 20/37 (54%), Gaps = 5/37 (13%)
 Frame = +1

Query: 271 GATVPLNY*GTVRPG-----YPPSPYPGHTGNGAHPG 366
           GA+ P  Y G   PG      PPS YPG TG  A+PG
Sbjct: 37  GASYPGAYPGQAPPGGYPGQAPPSAYPGPTGPSAYPG 73


>UniRef50_Q8NDC0 Cluster: Uncharacterized protein C14orf32; n=19;
           Amniota|Rep: Uncharacterized protein C14orf32 - Homo
           sapiens (Human)
          Length = 245

 Score = 33.1 bits (72), Expect = 5.0
 Identities = 24/56 (42%), Positives = 29/56 (51%), Gaps = 2/56 (3%)
 Frame = +1

Query: 271 GATVPLNY*GTVRPGY--PPSPYPGHTGNGAHPGCDLAPTTEGRLGAL*ETPSRPS 432
           GA  P+ + GTV PG   PP+PYP  TG+   PG  L PT         + PS PS
Sbjct: 184 GAAPPVPW-GTVPPGAWGPPAPYPAPTGSYPTPG--LYPTPSNPF----QVPSGPS 232


>UniRef50_UPI000023F43D Cluster: hypothetical protein FG09473.1;
           n=1; Gibberella zeae PH-1|Rep: hypothetical protein
           FG09473.1 - Gibberella zeae PH-1
          Length = 436

 Score = 32.7 bits (71), Expect = 6.6
 Identities = 20/48 (41%), Positives = 28/48 (58%), Gaps = 1/48 (2%)
 Frame = +2

Query: 398 WELFKRRLVD-LPAIQDPNTPEGVDDAAVRLVDSIRGAIDQATTLVPS 538
           W+ FK  L+  L  +Q   TPE   DAAVR + S   +I+Q  +L+PS
Sbjct: 282 WDEFKPTLLGMLDKLQGEPTPEQ-SDAAVRRLQSAIASIEQERSLIPS 328


>UniRef50_Q3UPZ6 Cluster: 0 day neonate lung cDNA, RIKEN full-length
           enriched library, clone:E030037K01 product:hypothetical
           Arginine-rich region profile containing protein, full
           insert sequence; n=2; Mus musculus|Rep: 0 day neonate
           lung cDNA, RIKEN full-length enriched library,
           clone:E030037K01 product:hypothetical Arginine-rich
           region profile containing protein, full insert sequence
           - Mus musculus (Mouse)
          Length = 348

 Score = 32.7 bits (71), Expect = 6.6
 Identities = 19/57 (33%), Positives = 29/57 (50%)
 Frame = -1

Query: 453 VLGS*IAGRSTRRLLKSSQSTFGRRGEVATRVSPIPSVTRIGRWGVPRSYSASIVKG 283
           VL    A  S +RL + S+     RG+ + +    PS  R GRWGVP +   + ++G
Sbjct: 251 VLPGCFAAPSRQRLARRSRRRRRGRGDFSGQRPSPPSAPRGGRWGVPPALCDAALRG 307


>UniRef50_Q2JEG5 Cluster: FAD linked oxidase-like; n=2;
           Actinomycetales|Rep: FAD linked oxidase-like - Frankia
           sp. (strain CcI3)
          Length = 545

 Score = 32.7 bits (71), Expect = 6.6
 Identities = 16/41 (39%), Positives = 20/41 (48%)
 Frame = -1

Query: 435 AGRSTRRLLKSSQSTFGRRGEVATRVSPIPSVTRIGRWGVP 313
           AG   R LL  S+  FG   +V  RV P+P+      W VP
Sbjct: 263 AGPDLRELLLGSEGAFGVITQVVVRVRPLPARRGYEAWSVP 303


>UniRef50_Q11F75 Cluster: Phosphomethylpyrimidine kinase; n=3;
           Mesorhizobium|Rep: Phosphomethylpyrimidine kinase -
           Mesorhizobium sp. (strain BNC1)
          Length = 256

 Score = 32.7 bits (71), Expect = 6.6
 Identities = 35/138 (25%), Positives = 55/138 (39%), Gaps = 2/138 (1%)
 Frame = +2

Query: 134 LNSAVGRRLLEDADRGDYSVVGPDEPTHIPTA--AQLQPDVLDVCVHKGLRCPLTIEALY 307
           +N+A+    +        + V P  P+ +     A L+ + +D      L     +EA+ 
Sbjct: 33  VNAALAITAVTAQTHSRVAAVEPMSPSLVSAQMEAALEAEPIDAIKIGMLGTSDIVEAVS 92

Query: 308 DLGTPHLPILVTLGMGLTRVATSPLRPKVDWELFKRRLVDLPAIQDPNTPEGVDDAAVRL 487
            +   HLPI V L   L   +   L  +    + KR L+ L  +  PN  E    AA   
Sbjct: 93  TVLRRHLPIPVVLDPVLASSSGGRLMEEAGIAVLKRELLPLCRLVTPNWLELAILAATVT 152

Query: 488 VDSIRGAIDQATTLVPSG 541
             S   A+DQ   L+ SG
Sbjct: 153 AGSEEEALDQGNLLLASG 170


>UniRef50_A5NRL6 Cluster: Putative uncharacterized protein
           precursor; n=1; Methylobacterium sp. 4-46|Rep: Putative
           uncharacterized protein precursor - Methylobacterium sp.
           4-46
          Length = 212

 Score = 32.7 bits (71), Expect = 6.6
 Identities = 35/117 (29%), Positives = 49/117 (41%), Gaps = 2/117 (1%)
 Frame = +2

Query: 80  PALLVGDLNAKHVAWGSRLNSAVGRRLLEDADRGDYSVVGPD--EPTHIPTAAQLQPDVL 253
           PA+ V    ++ +  G  +  A   R   D  RG+YSV+  +  +P ++P A    PD+ 
Sbjct: 29  PAVTVAVEQSRRLTTGRPVLLATATRDPRDLLRGEYSVLSYEIGQPANLPAA----PDLA 84

Query: 254 DVCVHKGLRCPLTIEALYDLGTPHLPILVTLGMGLTRVATSPLRPKVDWELFKRRLV 424
             C  +G  CPL        GT     LV    GL+R A     P  D  L  R  V
Sbjct: 85  ASCPAQG-ACPLA------AGTTVYVTLVPGEDGLSRAAAVAAAPPADGALALRGTV 134


>UniRef50_A3TY96 Cluster: Putative uncharacterized protein; n=1;
           Oceanicola batsensis HTCC2597|Rep: Putative
           uncharacterized protein - Oceanicola batsensis HTCC2597
          Length = 645

 Score = 32.7 bits (71), Expect = 6.6
 Identities = 28/75 (37%), Positives = 33/75 (44%)
 Frame = -2

Query: 248 RRAGVARRSECAWVRRGRPQSSRPYRHLLTAACPLLSSVGSPTRRASR*GPRPAELGGCR 69
           RRAG  RR   A  R G  ++ R  R         LS +G P RR SR   RP   G   
Sbjct: 512 RRAGTGRRDRHAGGRAGVFRTGRKGRRTRG-----LSRLGHPARRGSRRPARPRARGEPP 566

Query: 68  NSGPVLCPRGENQAP 24
           +SG    P   +QAP
Sbjct: 567 SSGRRGGPGDADQAP 581


>UniRef50_A1U2Q5 Cluster: Glutathione S-transferase, N-terminal
           domain; n=2; Gammaproteobacteria|Rep: Glutathione
           S-transferase, N-terminal domain - Marinobacter
           aquaeolei (strain ATCC 700491 / DSM 11845 /
           VT8)(Marinobacter hydrocarbonoclasticus (strain DSM
           11845))
          Length = 284

 Score = 32.7 bits (71), Expect = 6.6
 Identities = 22/63 (34%), Positives = 32/63 (50%), Gaps = 4/63 (6%)
 Frame = +2

Query: 302 LYDLGTPHLPILVTLGMGLTRVATSPLRP----KVDWELFKRRLVDLPAIQDPNTPEGVD 469
           LY+LG  H      +G    R+   P RP    K D    +  LV +P ++DPNT EG+ 
Sbjct: 214 LYNLGKEHW---TEVGPARQRIKPGPYRPIPGGKRDAFFQQYGLVQVPYLEDPNTGEGLF 270

Query: 470 DAA 478
           ++A
Sbjct: 271 ESA 273


>UniRef50_Q7XXJ3 Cluster: OSJNBa0094O15.9 protein; n=4; Oryza sativa
           (japonica cultivar-group)|Rep: OSJNBa0094O15.9 protein -
           Oryza sativa subsp. japonica (Rice)
          Length = 599

 Score = 32.7 bits (71), Expect = 6.6
 Identities = 27/81 (33%), Positives = 35/81 (43%), Gaps = 1/81 (1%)
 Frame = +2

Query: 218 IPTAAQLQPDVLDVCVHKGLRCPLTIEALYDLGTPHLPILVTLGMGLTRVATSPLRPKVD 397
           +P    L P V+      G   P T   L+  G P +PI    G   ++ AT+P   K  
Sbjct: 265 LPNGGGLSPPVI------GYNAPKTSTLLH--GMPRVPIAPIAGKKRSKSATAPSAAKKK 316

Query: 398 WELFKRRLVDLPAI-QDPNTP 457
            +  K    DLPAI QDP  P
Sbjct: 317 PKKQKATTYDLPAIDQDPPRP 337


>UniRef50_Q0V5U2 Cluster: Putative uncharacterized protein; n=1;
           Phaeosphaeria nodorum|Rep: Putative uncharacterized
           protein - Phaeosphaeria nodorum (Septoria nodorum)
          Length = 407

 Score = 32.7 bits (71), Expect = 6.6
 Identities = 36/121 (29%), Positives = 41/121 (33%), Gaps = 2/121 (1%)
 Frame = +1

Query: 37  SPRGHKTGPELRQPPSSAGRGPQREARRVGLPTELSSGQ--AAVXXXXXXXXXXXXXXXT 210
           SP   +  P   QP S AG+ P   A     PT  + GQ  AA                 
Sbjct: 230 SPPAGQPSPPAGQPSSPAGQ-PSASAPP-SQPTPPAGGQSSAAAPPSAPSPPPSNPGGVF 287

Query: 211 HAHSDRRATPARRVGCVRS*GATVPLNY*GTVRPGYPPSPYPGHTGNGAHPGCDLAPTTE 390
              +    TPA     V   GA  P      V  G P  P P  TG G+ PG   AP   
Sbjct: 288 APGASAAPTPATSTTLVTVTGAPTPAKPTVPVGTGTPAQPTPPSTGGGSAPG-GSAPAAP 346

Query: 391 G 393
           G
Sbjct: 347 G 347


>UniRef50_A7EIT2 Cluster: Putative uncharacterized protein; n=1;
            Sclerotinia sclerotiorum 1980|Rep: Putative
            uncharacterized protein - Sclerotinia sclerotiorum 1980
          Length = 1133

 Score = 32.7 bits (71), Expect = 6.6
 Identities = 21/65 (32%), Positives = 27/65 (41%)
 Frame = +3

Query: 363  GLRPRPYDRRSTGSSLRDA*STFPQFRTPTPLRGSTTRQSALSTPSGERSTRRRLLCPAA 542
            G+ P P DRR T  +      T P    P   RG++   S +  P       RRL   A 
Sbjct: 832  GVSPNPMDRRGTSPNPMSRRGTSPN---PMARRGTSPNPSVMRKPVSPAPEPRRLSGIAF 888

Query: 543  GPEVY 557
            GP+ Y
Sbjct: 889  GPDSY 893


>UniRef50_Q8TF61 Cluster: F-box only protein 41; n=21;
           Euteleostomi|Rep: F-box only protein 41 - Homo sapiens
           (Human)
          Length = 875

 Score = 32.7 bits (71), Expect = 6.6
 Identities = 24/71 (33%), Positives = 32/71 (45%)
 Frame = -2

Query: 266 ERTHPTRRAGVARRSECAWVRRGRPQSSRPYRHLLTAACPLLSSVGSPTRRASR*GPRPA 87
           ERT P R +G+ R++   W R       RP RH        +S VGS T  +   GP  A
Sbjct: 452 ERTQPPRSSGLRRQAIQNWQR-------RPRRHSTEGEEGDVSDVGSRTTESEAEGPLDA 504

Query: 86  ELGGCRNSGPV 54
              G   +GP+
Sbjct: 505 PRPGPAMAGPL 515


>UniRef50_UPI0001555319 Cluster: PREDICTED: hypothetical protein,
           partial; n=1; Ornithorhynchus anatinus|Rep: PREDICTED:
           hypothetical protein, partial - Ornithorhynchus anatinus
          Length = 316

 Score = 30.3 bits (65), Expect(2) = 7.5
 Identities = 29/81 (35%), Positives = 33/81 (40%), Gaps = 1/81 (1%)
 Frame = -2

Query: 266 ERTHPTRRAGV-ARRSECAWVRRGRPQSSRPYRHLLTAACPLLSSVGSPTRRASR*GPRP 90
           ER  P R +GV + R   A VR G  + SR  R     A P  S      R AS      
Sbjct: 65  ERYRPDRHSGVFSERLRRAGVRSGALRRSRRKRRPPGEAGPRRSRRPRGRRDAS------ 118

Query: 89  AELGGCRNSGPVLCPRGENQA 27
           +  GG    GP  CPRG   A
Sbjct: 119 SPPGGGPRGGPARCPRGARAA 139



 Score = 21.0 bits (42), Expect(2) = 7.5
 Identities = 10/22 (45%), Positives = 12/22 (54%)
 Frame = -2

Query: 428 GRLGVS*RAPSRPSVVGARSQP 363
           GR+GV  R  SRP     R +P
Sbjct: 48  GRIGVGRRPSSRPPAFLERYRP 69


>UniRef50_UPI0000F2D0DE Cluster: PREDICTED: hypothetical protein;
           n=1; Monodelphis domestica|Rep: PREDICTED: hypothetical
           protein - Monodelphis domestica
          Length = 235

 Score = 32.3 bits (70), Expect = 8.7
 Identities = 16/50 (32%), Positives = 24/50 (48%)
 Frame = -2

Query: 218 CAWVRRGRPQSSRPYRHLLTAACPLLSSVGSPTRRASR*GPRPAELGGCR 69
           CAW  R  P+++R    L T  CP  +    P + A    P+PA+ G  +
Sbjct: 101 CAWTPRPPPRATRGQPGLGTHHCPSAALGADPKKTAKGGPPKPADPGASK 150


>UniRef50_UPI00005A40D0 Cluster: PREDICTED: hypothetical protein
           XP_843730; n=1; Canis lupus familiaris|Rep: PREDICTED:
           hypothetical protein XP_843730 - Canis familiaris
          Length = 685

 Score = 32.3 bits (70), Expect = 8.7
 Identities = 23/67 (34%), Positives = 32/67 (47%), Gaps = 10/67 (14%)
 Frame = -2

Query: 254 PTRRAGVAR-RSECAWVRRGRPQSSRPYRHLLTAACPLL---------SSVGSPTRRASR 105
           P RR G++R +S C W+R   PQ   P+R L     P           + + +PT  A+ 
Sbjct: 314 PRRRVGLSRLQSSCPWLRAAEPQ-PLPWRALPFKTLPCCDGKTYTDPETRISAPTSPAAV 372

Query: 104 *GPRPAE 84
            GP PAE
Sbjct: 373 NGPDPAE 379


>UniRef50_Q89C29 Cluster: Bll7969 protein; n=1; Bradyrhizobium
           japonicum|Rep: Bll7969 protein - Bradyrhizobium
           japonicum
          Length = 295

 Score = 32.3 bits (70), Expect = 8.7
 Identities = 22/71 (30%), Positives = 35/71 (49%), Gaps = 1/71 (1%)
 Frame = +2

Query: 290 TIEALYDLGTPHLPILVTLGMGLTRVATSPLRPKVDWELFKRRLVDLPAIQDPN-TPEGV 466
           TIEA+   G    P  + +G G   ++ S    +    L  R ++ LP   D + TPEG+
Sbjct: 63  TIEAMLKAGVA--PARIGIGGGFPAISDSIALTRAVLGLGLRHVLLLPPYFDRSVTPEGI 120

Query: 467 DDAAVRLVDSI 499
           +DA   +VD +
Sbjct: 121 EDAFAAIVDGV 131


>UniRef50_A7HU45 Cluster: Putative uncharacterized protein; n=1;
           Parvibaculum lavamentivorans DS-1|Rep: Putative
           uncharacterized protein - Parvibaculum lavamentivorans
           DS-1
          Length = 91

 Score = 32.3 bits (70), Expect = 8.7
 Identities = 16/33 (48%), Positives = 20/33 (60%)
 Frame = -2

Query: 254 PTRRAGVARRSECAWVRRGRPQSSRPYRHLLTA 156
           PTR A  AR +  + +RR R  S + YRHLL A
Sbjct: 56  PTREAERARNALASHLRRARWMSEKGYRHLLNA 88


>UniRef50_Q69KE8 Cluster: Putative uncharacterized protein
           OSJNBb0031F23.33; n=1; Oryza sativa (japonica
           cultivar-group)|Rep: Putative uncharacterized protein
           OSJNBb0031F23.33 - Oryza sativa subsp. japonica (Rice)
          Length = 366

 Score = 32.3 bits (70), Expect = 8.7
 Identities = 21/72 (29%), Positives = 29/72 (40%), Gaps = 2/72 (2%)
 Frame = +3

Query: 339 SHWEWGSPGLRPRPYDRRSTGSS--LRDA*STFPQFRTPTPLRGSTTRQSALSTPSGERS 512
           S W W  P   PRP  + S+ ++  +R +     Q+ +P  L GS           G   
Sbjct: 263 STWPWPPPSPPPRPSSQSSSSTTNLIRPSLEAAGQYPSPFSLLGSA--DGTRERERGRER 320

Query: 513 TRRRLLCPAAGP 548
             RRL CP   P
Sbjct: 321 DDRRLQCPQRRP 332


>UniRef50_A5BK64 Cluster: Putative uncharacterized protein; n=1;
           Vitis vinifera|Rep: Putative uncharacterized protein -
           Vitis vinifera (Grape)
          Length = 358

 Score = 32.3 bits (70), Expect = 8.7
 Identities = 20/58 (34%), Positives = 25/58 (43%)
 Frame = -2

Query: 290 LRGTVAPYERTHPTRRAGVARRSECAWVRRGRPQSSRPYRHLLTAACPLLSSVGSPTR 117
           LRG  AP      T + G  RR  C W+ R   + S    H+L  +   L   G PTR
Sbjct: 126 LRGE-APLCVAADTLKPGKERRGNCCWIFRTETEISATLIHMLVVSQMRLHRRGEPTR 182


>UniRef50_Q8NAA9 Cluster: CDNA FLJ35687 fis, clone SPLEN2019349;
           n=1; Homo sapiens|Rep: CDNA FLJ35687 fis, clone
           SPLEN2019349 - Homo sapiens (Human)
          Length = 177

 Score = 32.3 bits (70), Expect = 8.7
 Identities = 20/55 (36%), Positives = 23/55 (41%)
 Frame = -2

Query: 257 HPTRRAGVARRSECAWVRRGRPQSSRPYRHLLTAACPLLSSVGSPTRRASR*GPR 93
           H   R   A  + C  V    P+   PY   L AACPLL  +G    R  R  PR
Sbjct: 14  HLCTRLTTASLAHCCSVSPAGPRPRLPYPSELGAACPLLLCLGLSPLRQCRTPPR 68


>UniRef50_Q6P2D8 Cluster: X-ray radiation resistance-associated
           protein 1; n=10; Eutheria|Rep: X-ray radiation
           resistance-associated protein 1 - Homo sapiens (Human)
          Length = 598

 Score = 32.3 bits (70), Expect = 8.7
 Identities = 21/57 (36%), Positives = 31/57 (54%), Gaps = 5/57 (8%)
 Frame = +2

Query: 287 LTIEALYDLGT-PHLPILVTLGMGLT----RVATSPLRPKVDWELFKRRLVDLPAIQ 442
           LT+EA+ DLG  PHL +L+  G GLT     +A +     V     KR ++  PA++
Sbjct: 175 LTVEAICDLGILPHLRVLLLTGNGLTSLPPNLAVAEQEASVTSLTSKRYILRFPALE 231


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 707,846,663
Number of Sequences: 1657284
Number of extensions: 17030857
Number of successful extensions: 61790
Number of sequences better than 10.0: 68
Number of HSP's better than 10.0 without gapping: 56397
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 61638
length of database: 575,637,011
effective HSP length: 96
effective length of database: 416,537,747
effective search space used: 40820699206
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).