SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= cesb0006
         (852 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_Q8I2T5 Cluster: Putative uncharacterized protein PFI107...    38   0.32 
UniRef50_A4CID7 Cluster: Putative uncharacterized protein; n=2; ...    36   1.3  
UniRef50_Q54NS7 Cluster: Putative uncharacterized protein; n=1; ...    35   3.0  
UniRef50_Q8I3C5 Cluster: Putative uncharacterized protein PFI011...    34   5.2  

>UniRef50_Q8I2T5 Cluster: Putative uncharacterized protein PFI1070c;
           n=4; Plasmodium|Rep: Putative uncharacterized protein
           PFI1070c - Plasmodium falciparum (isolate 3D7)
          Length = 395

 Score = 37.9 bits (84), Expect = 0.32
 Identities = 12/38 (31%), Positives = 25/38 (65%)
 Frame = -1

Query: 249 HFNNVYQHLFIYLSNFLFLFYLINIVFFFFRYNNINSK 136
           H+ + + H  IY+  +++++ L   +FFF+RYN ++ K
Sbjct: 272 HYKSYHTHTHIYIYIYIYIYILYMRIFFFYRYNFVDKK 309


>UniRef50_A4CID7 Cluster: Putative uncharacterized protein; n=2;
           Flavobacteriales|Rep: Putative uncharacterized protein -
           Robiginitalea biformata HTCC2501
          Length = 382

 Score = 35.9 bits (79), Expect = 1.3
 Identities = 23/50 (46%), Positives = 31/50 (62%), Gaps = 1/50 (2%)
 Frame = -1

Query: 474 TPLFLVF-FFLNTIAVSIVANRKNKATDTAHEHRRLILRT*E*IVALGFF 328
           TP  LVF FFL  +  SIV   +NK  D A  HR++I+RT + ++ LG F
Sbjct: 64  TPTDLVFPFFLFIVGTSIVFAYRNKQPDAA-THRKIIVRTLK-LILLGIF 111


>UniRef50_Q54NS7 Cluster: Putative uncharacterized protein; n=1;
           Dictyostelium discoideum AX4|Rep: Putative
           uncharacterized protein - Dictyostelium discoideum AX4
          Length = 195

 Score = 34.7 bits (76), Expect = 3.0
 Identities = 13/21 (61%), Positives = 17/21 (80%)
 Frame = -1

Query: 222 FIYLSNFLFLFYLINIVFFFF 160
           FIY  NF+ LF ++NI+FFFF
Sbjct: 6   FIYYHNFILLFLVLNILFFFF 26


>UniRef50_Q8I3C5 Cluster: Putative uncharacterized protein PFI0110c;
           n=1; Plasmodium falciparum 3D7|Rep: Putative
           uncharacterized protein PFI0110c - Plasmodium falciparum
           (isolate 3D7)
          Length = 608

 Score = 33.9 bits (74), Expect = 5.2
 Identities = 14/38 (36%), Positives = 21/38 (55%)
 Frame = -1

Query: 246 FNNVYQHLFIYLSNFLFLFYLINIVFFFFRYNNINSKC 133
           +NN Y  LF+ L  F+    +I++ FFF     I +KC
Sbjct: 14  YNNKYIGLFLNLKGFVMYLLVISLYFFFLFLTEIQNKC 51


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 723,068,600
Number of Sequences: 1657284
Number of extensions: 13318349
Number of successful extensions: 31333
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 29176
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 31035
length of database: 575,637,011
effective HSP length: 100
effective length of database: 409,908,611
effective search space used: 75013275813
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).