SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= cesb0004
         (717 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_Q4JSC0 Cluster: Actin; n=13; Coelomata|Rep: Actin - Ano...   275   8e-73
UniRef50_O65314 Cluster: Actin; n=20; Eukaryota|Rep: Actin - Sch...   264   1e-69
UniRef50_P02581 Cluster: Actin-1; n=1852; Eukaryota|Rep: Actin-1...   254   2e-66
UniRef50_P14883 Cluster: Actin-2; n=75; Eukaryota|Rep: Actin-2 -...   235   1e-60
UniRef50_Q96483 Cluster: Actin-51; n=584; Eukaryota|Rep: Actin-5...   225   1e-57
UniRef50_Q7M3B0 Cluster: Actin beta; n=1; Sus scrofa domestica|R...   158   5e-47
UniRef50_UPI0000E466A7 Cluster: PREDICTED: similar to actin, alp...   188   1e-46
UniRef50_Q5AKW9 Cluster: Putative uncharacterized protein; n=1; ...   186   4e-46
UniRef50_UPI000049A548 Cluster: actin; n=1; Entamoeba histolytic...   178   1e-43
UniRef50_Q9BYD9 Cluster: Actin-related protein M1; n=12; Theria|...   175   1e-42
UniRef50_Q9XZB9 Cluster: Actin; n=1; Sterkiella nova|Rep: Actin ...   174   2e-42
UniRef50_P61163 Cluster: Alpha-centractin; n=356; root|Rep: Alph...   167   2e-40
UniRef50_UPI000059FC57 Cluster: PREDICTED: similar to cytoplasmi...   163   3e-39
UniRef50_Q7M3Y6 Cluster: Actin homolog fat, testicular; n=3; Deu...   162   9e-39
UniRef50_Q963K1 Cluster: Actin-3; n=1; Cercomonas sp. ATCC 50318...   161   1e-38
UniRef50_Q6BG22 Cluster: Actin, putative; n=2; Paramecium tetrau...   159   6e-38
UniRef50_A2ECQ8 Cluster: Actin family protein; n=1; Trichomonas ...   157   2e-37
UniRef50_UPI0000588EB0 Cluster: PREDICTED: similar to actin; n=1...   157   3e-37
UniRef50_UPI0000E23763 Cluster: PREDICTED: hypothetical protein ...   153   5e-36
UniRef50_UPI0001554F81 Cluster: PREDICTED: similar to actin; n=1...   152   7e-36
UniRef50_Q8TDY3 Cluster: Actin-related protein T2; n=26; Amniota...   149   5e-35
UniRef50_UPI000065DC3F Cluster: Homolog of Homo sapiens "Actin, ...   149   7e-35
UniRef50_A4QNT8 Cluster: Si:ch211-241j12.3 protein; n=3; Danio r...   148   2e-34
UniRef50_A2DKQ5 Cluster: Actin 58, putative; n=2; Trichomonas va...   147   2e-34
UniRef50_Q55DS6 Cluster: Putative uncharacterized protein; n=1; ...   144   1e-33
UniRef50_UPI0000F2D326 Cluster: PREDICTED: similar to actin; n=1...   144   3e-33
UniRef50_Q9Y614 Cluster: Actin-like protein 7B; n=12; Theria|Rep...   143   4e-33
UniRef50_A2DBN6 Cluster: Actin family protein; n=1; Trichomonas ...   142   8e-33
UniRef50_UPI0000F2D825 Cluster: PREDICTED: similar to actin; n=1...   140   2e-32
UniRef50_Q8LKR2 Cluster: Actin-related protein 4; n=7; core eudi...   140   2e-32
UniRef50_A5E2K2 Cluster: Actin; n=5; Saccharomycetales|Rep: Acti...   140   3e-32
UniRef50_Q4N681 Cluster: Actin, putative; n=3; Piroplasmida|Rep:...   139   5e-32
UniRef50_UPI0000499930 Cluster: actin; n=1; Entamoeba histolytic...   138   1e-31
UniRef50_UPI00006C1719 Cluster: PREDICTED: similar to actin, alp...   127   1e-31
UniRef50_UPI000065FC19 Cluster: Homolog of Homo sapiens "Actin, ...   135   9e-31
UniRef50_Q4CV94 Cluster: Actin 2, putative; n=2; Trypanosoma cru...   135   9e-31
UniRef50_O96019 Cluster: Actin-like protein 6A; n=63; Eumetazoa|...   135   1e-30
UniRef50_UPI00001E426E Cluster: PREDICTED: similar to actin-12; ...   134   2e-30
UniRef50_Q9Y615 Cluster: Actin-like protein 7A; n=11; Mammalia|R...   134   3e-30
UniRef50_UPI00005864C8 Cluster: PREDICTED: similar to Actin; n=4...   133   4e-30
UniRef50_UPI0000449751 Cluster: PREDICTED: similar to gamma-acti...   133   5e-30
UniRef50_Q6X960 Cluster: HSD21; n=13; Theria|Rep: HSD21 - Homo s...   132   1e-29
UniRef50_A4RW28 Cluster: Predicted protein; n=2; Ostreococcus|Re...   128   1e-28
UniRef50_Q6ZSQ4 Cluster: CDNA FLJ45296 fis, clone BRHIP3003340, ...   128   1e-28
UniRef50_A0E1S8 Cluster: Chromosome undetermined scaffold_73, wh...   128   1e-28
UniRef50_UPI0000D9A391 Cluster: PREDICTED: actin related protein...   127   2e-28
UniRef50_Q8IS27 Cluster: Actin-related protein 2; n=5; Oligohyme...   127   2e-28
UniRef50_A2EUM6 Cluster: Actin family protein; n=1; Trichomonas ...   127   3e-28
UniRef50_P61160 Cluster: Actin-related protein 2; n=96; Eukaryot...   126   4e-28
UniRef50_Q4SGD5 Cluster: Chromosome 17 SCAF14597, whole genome s...   126   7e-28
UniRef50_Q3M0X0 Cluster: Actin6-2; n=3; Paramecium tetraurelia|R...   125   1e-27
UniRef50_Q23FF9 Cluster: Actin family protein; n=2; Tetrahymena ...   125   1e-27
UniRef50_UPI0000F2DE11 Cluster: PREDICTED: similar to testis-spe...   123   4e-27
UniRef50_Q5CKL2 Cluster: BRG1/brm-associated factor 53A; n=2; Cr...   122   7e-27
UniRef50_UPI00005A3B5D Cluster: PREDICTED: similar to Actin-5C; ...   120   3e-26
UniRef50_Q9N4N4 Cluster: Putative uncharacterized protein; n=2; ...   120   3e-26
UniRef50_A2YUL5 Cluster: Putative uncharacterized protein; n=1; ...   120   4e-26
UniRef50_Q2GY63 Cluster: Putative uncharacterized protein; n=1; ...   120   4e-26
UniRef50_Q14BL3 Cluster: RIKEN cDNA 4921517D21 gene; n=7; Euther...   118   1e-25
UniRef50_Q10CH7 Cluster: Actin-related protein 7, putative, expr...   118   1e-25
UniRef50_Q22WQ4 Cluster: Actin family protein; n=1; Tetrahymena ...   118   1e-25
UniRef50_Q19R57 Cluster: Actin-like protein 1; n=2; Trypanosoma ...   118   1e-25
UniRef50_Q29173 Cluster: Cytoplasmic beta-actin; n=1; Sus scrofa...   117   3e-25
UniRef50_A2FH22 Cluster: Actin family protein; n=1; Trichomonas ...   116   4e-25
UniRef50_Q4DMP2 Cluster: Actin-related protein 2, putative; n=4;...   116   8e-25
UniRef50_Q09849 Cluster: Uncharacterized protein C23D3.09; n=1; ...   116   8e-25
UniRef50_Q8ILM5 Cluster: Actin, putative; n=1; Plasmodium falcip...   115   1e-24
UniRef50_A7RTR2 Cluster: Predicted protein; n=1; Nematostella ve...   114   2e-24
UniRef50_Q5KB93 Cluster: Actin binding protein, putative; n=3; F...   114   2e-24
UniRef50_Q54UQ7 Cluster: Actin-like protein 6A; n=1; Dictyosteli...   111   1e-23
UniRef50_UPI0000D56C2F Cluster: PREDICTED: similar to Actin-57B;...   111   2e-23
UniRef50_Q5KLG9 Cluster: 53 kDa brg1-associated factor b (Actin-...   111   2e-23
UniRef50_A5K109 Cluster: Actin, putative; n=4; Plasmodium|Rep: A...   111   2e-23
UniRef50_Q9SRK2 Cluster: Putative actin; n=1; Arabidopsis thalia...   110   3e-23
UniRef50_Q19R56 Cluster: Actin-like protein 3; n=4; Trypanosoma ...   110   3e-23
UniRef50_Q0VHZ5 Cluster: Actin deviating protein; n=7; Eukaryota...    99   8e-23
UniRef50_Q6BG23 Cluster: Actin, putative; n=1; Paramecium tetrau...   108   1e-22
UniRef50_A7AWQ4 Cluster: Actin, putative; n=1; Babesia bovis|Rep...   108   1e-22
UniRef50_Q4P2E8 Cluster: Actin-related protein 4; n=1; Ustilago ...   108   2e-22
UniRef50_UPI0000EC9F4D Cluster: HSD21.; n=2; Gallus gallus|Rep: ...   107   2e-22
UniRef50_Q6FRF2 Cluster: Similar to sp|P38696 Saccharomyces cere...   107   3e-22
UniRef50_Q6SQL6 Cluster: Actin; n=1; Pandalus platyceros|Rep: Ac...   106   6e-22
UniRef50_UPI00006CBDF1 Cluster: Actin family protein; n=1; Tetra...   104   3e-21
UniRef50_A2DNQ0 Cluster: Actin family protein; n=1; Trichomonas ...   103   3e-21
UniRef50_A2DEE0 Cluster: Actin family protein; n=1; Trichomonas ...   103   3e-21
UniRef50_UPI0000605B09 Cluster: PREDICTED: similar to actin alph...   102   8e-21
UniRef50_Q5JWF8 Cluster: Putative uncharacterized protein C20orf...   102   1e-20
UniRef50_Q24C02 Cluster: Actin family protein; n=3; Oligohymenop...   101   1e-20
UniRef50_Q8LKR0 Cluster: Actin-related protein 6; n=26; Magnolio...   101   2e-20
UniRef50_Q5DBE5 Cluster: SJCHGC08419 protein; n=1; Schistosoma j...   100   4e-20
UniRef50_Q6C061 Cluster: Actin-related protein 4; n=1; Yarrowia ...   100   4e-20
UniRef50_P80428 Cluster: Actin-related protein 4; n=4; Saccharom...    99   5e-20
UniRef50_Q4UF64 Cluster: Actin-related protein, putative; n=2; T...    99   9e-20
UniRef50_Q4QD95 Cluster: Actin-related protein 2, putative; n=3;...    99   9e-20
UniRef50_Q20329 Cluster: Putative uncharacterized protein; n=2; ...    99   9e-20
UniRef50_Q9GZN1 Cluster: Actin-related protein 6; n=26; Chordata...    98   2e-19
UniRef50_Q5CSX9 Cluster: Actin; n=2; Cryptosporidium|Rep: Actin ...    97   4e-19
UniRef50_Q54KZ7 Cluster: Putative uncharacterized protein; n=1; ...    97   4e-19
UniRef50_Q55DY5 Cluster: Putative uncharacterized protein; n=1; ...    97   5e-19
UniRef50_Q7SHR0 Cluster: Actin-related protein 4; n=16; Pezizomy...    96   7e-19
UniRef50_A3BPG0 Cluster: Putative uncharacterized protein; n=3; ...    96   9e-19
UniRef50_A4RLB1 Cluster: Putative uncharacterized protein; n=1; ...    95   1e-18
UniRef50_Q4N7N1 Cluster: Actin, putative; n=2; Theileria|Rep: Ac...    95   2e-18
UniRef50_Q9P7X7 Cluster: Actin-related protein 4; n=1; Schizosac...    95   2e-18
UniRef50_Q9LZY1 Cluster: Actin-like protein; n=4; core eudicotyl...    95   2e-18
UniRef50_Q3M0W2 Cluster: Actin 4-2; n=3; Paramecium tetraurelia|...    95   2e-18
UniRef50_A7TST0 Cluster: Putative uncharacterized protein; n=1; ...    95   2e-18
UniRef50_Q6CSB9 Cluster: Actin-related protein 4; n=1; Kluyverom...    95   2e-18
UniRef50_Q19R52 Cluster: ALP5; n=6; Trypanosomatidae|Rep: ALP5 -...    94   4e-18
UniRef50_A7RG28 Cluster: Predicted protein; n=1; Nematostella ve...    94   4e-18
UniRef50_UPI00004987CF Cluster: actin; n=2; Entamoeba histolytic...    93   8e-18
UniRef50_UPI0000E47BC7 Cluster: PREDICTED: similar to ubiquitin/...    92   1e-17
UniRef50_O96819 Cluster: Actin-related protein; n=5; Trypanosoma...    92   1e-17
UniRef50_Q0J646 Cluster: Os08g0369300 protein; n=2; Oryza sativa...    90   6e-17
UniRef50_Q6C982 Cluster: Actin-like protein ARP6; n=1; Yarrowia ...    89   8e-17
UniRef50_P45890 Cluster: Actin-like protein 13E; n=8; Eumetazoa|...    89   8e-17
UniRef50_Q9H568 Cluster: Actin-like protein 8; n=10; Eutheria|Re...    89   1e-16
UniRef50_Q0VHZ6 Cluster: Actin deviating protein; n=2; Bolivina ...    89   1e-16
UniRef50_Q0IFH2 Cluster: Actin; n=4; Endopterygota|Rep: Actin - ...    89   1e-16
UniRef50_Q38F20 Cluster: Actin-like protein 3, putative; n=1; Tr...    88   2e-16
UniRef50_UPI0000F2D272 Cluster: PREDICTED: similar to actin; n=1...    87   3e-16
UniRef50_Q4QG59 Cluster: Actin-like protein, putative; n=3; Leis...    87   4e-16
UniRef50_UPI0000F2D271 Cluster: PREDICTED: similar to actin-like...    87   5e-16
UniRef50_Q8IIQ4 Cluster: Actin, putative; n=7; Apicomplexa|Rep: ...    86   7e-16
UniRef50_Q6C0A9 Cluster: Yarrowia lipolytica chromosome F of str...    86   7e-16
UniRef50_Q9H9F9 Cluster: Actin-related protein 5; n=19; Euteleos...    86   7e-16
UniRef50_P61158 Cluster: Actin-related protein 3; n=107; Eukaryo...    86   7e-16
UniRef50_A0CQQ2 Cluster: Chromosome undetermined scaffold_24, wh...    86   9e-16
UniRef50_P32392 Cluster: Actin-related protein 3; n=27; Eukaryot...    86   9e-16
UniRef50_UPI0000E46266 Cluster: PREDICTED: similar to actin; n=1...    85   1e-15
UniRef50_Q5AXH1 Cluster: Actin-like protein arp6; n=5; Trichocom...    85   1e-15
UniRef50_Q7S6X6 Cluster: Actin-like protein arp-6; n=5; Pezizomy...    85   2e-15
UniRef50_Q7QTA6 Cluster: GLP_15_20269_21672; n=1; Giardia lambli...    84   3e-15
UniRef50_Q3M0Y1 Cluster: Actin7-2; n=2; Paramecium tetraurelia|R...    84   4e-15
UniRef50_A7AQU0 Cluster: Actin-related, putative; n=1; Babesia b...    84   4e-15
UniRef50_UPI0000498B53 Cluster: actin; n=1; Entamoeba histolytic...    83   5e-15
UniRef50_Q383R8 Cluster: Actin-like protein, putative; n=4; Tryp...    83   9e-15
UniRef50_Q18PR4 Cluster: Actin-related protein; n=1; Porphyra ye...    82   1e-14
UniRef50_Q7SXV8 Cluster: ARP5 actin-related protein 5 homolog; n...    82   2e-14
UniRef50_Q6BXN0 Cluster: Actin-related protein 4; n=7; Saccharom...    81   2e-14
UniRef50_A5CAW6 Cluster: Putative uncharacterized protein; n=1; ...    79   1e-13
UniRef50_Q4Q187 Cluster: Actin-like protein, putative; n=3; Leis...    78   2e-13
UniRef50_Q4P303 Cluster: Putative uncharacterized protein; n=1; ...    77   3e-13
UniRef50_Q0J891 Cluster: Os08g0128300 protein; n=5; Oryza sativa...    77   4e-13
UniRef50_Q0V0G6 Cluster: Putative uncharacterized protein; n=1; ...    77   4e-13
UniRef50_O94241 Cluster: Actin-like protein arp6; n=1; Schizosac...    77   4e-13
UniRef50_Q19R70 Cluster: Actin-like protein 3; n=4; Leishmania|R...    77   6e-13
UniRef50_A7AS14 Cluster: Actin, putative; n=1; Babesia bovis|Rep...    77   6e-13
UniRef50_UPI0000449ED3 Cluster: PREDICTED: similar to RIKEN cDNA...    76   8e-13
UniRef50_Q09443 Cluster: Actin-like protein C08B11.6; n=2; Caeno...    75   1e-12
UniRef50_A2G7Z1 Cluster: Actin family protein; n=1; Trichomonas ...    75   2e-12
UniRef50_A2E0F7 Cluster: Actin family protein; n=1; Trichomonas ...    75   2e-12
UniRef50_Q9LHH0 Cluster: Actin-like protein; n=11; Magnoliophyta...    75   2e-12
UniRef50_Q8MVP6 Cluster: Avwa2 protein; n=1; Boltenia villosa|Re...    74   3e-12
UniRef50_Q4UGT7 Cluster: Actin-related protein, putative; n=2; T...    73   5e-12
UniRef50_A5E5Q2 Cluster: Putative uncharacterized protein; n=1; ...    73   7e-12
UniRef50_Q22XS7 Cluster: Actin family protein; n=1; Tetrahymena ...    72   1e-11
UniRef50_UPI0000E4A0BF Cluster: PREDICTED: similar to Actin-rela...    71   3e-11
UniRef50_Q9Y7X8 Cluster: Actin-like protein Arp5; n=1; Schizosac...    70   5e-11
UniRef50_Q9FKT0 Cluster: Actin-related protein 8; n=23; Magnolio...    70   5e-11
UniRef50_Q17GZ9 Cluster: Actin-related protein 5; n=4; Endoptery...    70   7e-11
UniRef50_A2D880 Cluster: Actin family protein; n=1; Trichomonas ...    69   9e-11
UniRef50_Q7RLT3 Cluster: Unnamed protein product; n=2; Plasmodiu...    69   1e-10
UniRef50_Q7QA11 Cluster: ENSANGP00000003921; n=1; Anopheles gamb...    69   1e-10
UniRef50_Q54E71 Cluster: Putative uncharacterized protein; n=1; ...    68   3e-10
UniRef50_Q5KAQ4 Cluster: Actin-like protein ARP6; n=1; Filobasid...    67   5e-10
UniRef50_Q9VEC3 Cluster: Actin-related protein 5; n=1; Drosophil...    67   5e-10
UniRef50_UPI0000498FDF Cluster: actin; n=1; Entamoeba histolytic...    66   6e-10
UniRef50_A5KAY0 Cluster: Actin-related protein, putative; n=1; P...    66   6e-10
UniRef50_A2FRF9 Cluster: Actin family protein; n=1; Trichomonas ...    66   6e-10
UniRef50_A4S172 Cluster: Predicted protein; n=3; Ostreococcus|Re...    66   1e-09
UniRef50_A5KC80 Cluster: Putative uncharacterized protein; n=1; ...    66   1e-09
UniRef50_A2F9B6 Cluster: Actin family protein; n=1; Trichomonas ...    66   1e-09
UniRef50_Q7RR61 Cluster: Actin-like 6; n=3; Plasmodium (Vinckeia...    65   1e-09
UniRef50_P53946 Cluster: Actin-related protein 5; n=7; Saccharom...    65   2e-09
UniRef50_Q8IBQ9 Cluster: Putative uncharacterized protein PF07_0...    64   2e-09
UniRef50_Q293V2 Cluster: Actin-related protein 5; n=2; Drosophil...    64   2e-09
UniRef50_Q8MVM8 Cluster: Notochord actin-like protein; n=1; Bolt...    63   8e-09
UniRef50_Q4UGE2 Cluster: Actin-related protein, putative; n=2; T...    62   1e-08
UniRef50_Q4QF49 Cluster: Actin-like protein, putative; n=2; Leis...    62   2e-08
UniRef50_Q6CJF4 Cluster: Actin-like protein ARP6; n=2; Saccharom...    62   2e-08
UniRef50_UPI0000498A93 Cluster: actin; n=1; Entamoeba histolytic...    60   5e-08
UniRef50_A5BLP0 Cluster: Putative uncharacterized protein; n=1; ...    60   7e-08
UniRef50_UPI0000E477BD Cluster: PREDICTED: similar to uncharacte...    59   9e-08
UniRef50_UPI00006CC3F4 Cluster: Actin family protein; n=1; Tetra...    59   9e-08
UniRef50_Q8I450 Cluster: Actin-related protein, putative; n=5; P...    58   2e-07
UniRef50_Q54JL1 Cluster: Putative uncharacterized protein; n=1; ...    58   3e-07
UniRef50_Q9NZ32 Cluster: Actin-related protein 10; n=40; Eumetaz...    58   3e-07
UniRef50_Q4WA13 Cluster: Chromatin remodeling complex subunit (A...    57   4e-07
UniRef50_Q12509 Cluster: Actin-like protein ARP6; n=4; Saccharom...    57   4e-07
UniRef50_UPI00015B5EE4 Cluster: PREDICTED: similar to Actin-rela...    56   7e-07
UniRef50_Q4Q2G7 Cluster: Actin-like protein, putative; n=3; Leis...    56   9e-07
UniRef50_Q5K9I3 Cluster: Protein-vacuolar targeting-related prot...    56   9e-07
UniRef50_Q6CF37 Cluster: Similar to sp|P53946 Saccharomyces cere...    56   1e-06
UniRef50_A4RYY1 Cluster: Predicted protein; n=2; Ostreococcus|Re...    55   2e-06
UniRef50_A2FYS8 Cluster: Actin family protein; n=1; Trichomonas ...    54   3e-06
UniRef50_A1C924 Cluster: Actin family protein; n=4; Eurotiomycet...    54   3e-06
UniRef50_Q5DCN1 Cluster: SJCHGC08895 protein; n=1; Schistosoma j...    54   4e-06
UniRef50_A6R1X8 Cluster: Putative uncharacterized protein; n=1; ...    54   4e-06
UniRef50_A7PBZ0 Cluster: Chromosome chr2 scaffold_11, whole geno...    53   6e-06
UniRef50_A5K6H6 Cluster: Actin-like protein, putative; n=2; Plas...    53   6e-06
UniRef50_Q3M0X1 Cluster: Actin-like protein 1-1; n=3; Paramecium...    53   8e-06
UniRef50_A3FQH9 Cluster: Actin-like protein, putative; n=2; Cryp...    53   8e-06
UniRef50_A2DKB8 Cluster: Actin family protein; n=1; Trichomonas ...    53   8e-06
UniRef50_A6RD01 Cluster: Putative uncharacterized protein; n=1; ...    52   1e-05
UniRef50_A3M088 Cluster: Vacuolar targeting, actin-related prote...    52   1e-05
UniRef50_Q5DA98 Cluster: SJCHGC09502 protein; n=1; Schistosoma j...    51   2e-05
UniRef50_A0BG81 Cluster: Chromosome undetermined scaffold_105, w...    51   2e-05
UniRef50_Q5CS19 Cluster: Actin-like protein; n=2; Cryptosporidiu...    50   8e-05
UniRef50_Q5AP59 Cluster: Actin-like protein ARP6; n=2; Saccharom...    49   1e-04
UniRef50_Q6GLD2 Cluster: Novel protein similar to actin-related ...    48   2e-04
UniRef50_Q4QF44 Cluster: Actin-related protein 3, putative; n=3;...    48   2e-04
UniRef50_A7AQB8 Cluster: Actin-related protein, putative; n=1; B...    48   2e-04
UniRef50_Q9GYR2 Cluster: Putative uncharacterized protein; n=2; ...    48   3e-04
UniRef50_Q8I345 Cluster: Actin-like protein, putative; n=3; Plas...    48   3e-04
UniRef50_Q54BW9 Cluster: Putative uncharacterized protein; n=1; ...    48   3e-04
UniRef50_Q4YVG6 Cluster: Actin, putative; n=7; Plasmodium|Rep: A...    48   3e-04
UniRef50_UPI0000D55EE2 Cluster: PREDICTED: similar to actin-rela...    47   5e-04
UniRef50_Q9H981 Cluster: Actin-related protein 8; n=33; Deuteros...    47   5e-04
UniRef50_Q6BML9 Cluster: Actin-like protein ARP6; n=3; Saccharom...    47   5e-04
UniRef50_Q4P820 Cluster: Putative uncharacterized protein; n=1; ...    45   0.002
UniRef50_Q9LSW2 Cluster: Actin-like protein; n=4; Magnoliophyta|...    45   0.002
UniRef50_Q4DEE4 Cluster: Actin-like protein, putative; n=4; Tryp...    45   0.002
UniRef50_Q9US07 Cluster: Probable actin-related protein 8; n=1; ...    44   0.003
UniRef50_UPI000155CE00 Cluster: PREDICTED: similar to aprataxin;...    44   0.005
UniRef50_Q54JY2 Cluster: Putative uncharacterized protein; n=1; ...    43   0.007
UniRef50_A7RKL9 Cluster: Predicted protein; n=1; Nematostella ve...    43   0.007
UniRef50_Q0IEG8 Cluster: Actin-related protein 8; n=5; Endoptery...    43   0.009
UniRef50_Q4QCJ2 Cluster: Actin-like protein, putative; n=4; Leis...    42   0.015
UniRef50_Q25665 Cluster: Actin; n=1; Procambarus clarkii|Rep: Ac...    42   0.015
UniRef50_Q8SS30 Cluster: ACTIN-LIKE 53kDa PROTEIN; n=1; Encephal...    42   0.015
UniRef50_A1C6E4 Cluster: Chromatin remodeling complex subunit (A...    42   0.015
UniRef50_Q75BT7 Cluster: ACR184Cp; n=1; Eremothecium gossypii|Re...    41   0.027
UniRef50_A3FQE6 Cluster: Putative uncharacterized protein; n=2; ...    41   0.035
UniRef50_Q7SBR8 Cluster: Putative uncharacterized protein NCU062...    41   0.035
UniRef50_A7NX50 Cluster: Chromosome chr5 scaffold_2, whole genom...    40   0.046
UniRef50_Q1DZC3 Cluster: Putative uncharacterized protein; n=2; ...    40   0.046
UniRef50_UPI0000499D03 Cluster: actin; n=1; Entamoeba histolytic...    40   0.081
UniRef50_A2DVJ3 Cluster: Actin family protein; n=1; Trichomonas ...    40   0.081
UniRef50_Q5KH55 Cluster: Putative uncharacterized protein; n=2; ...    39   0.11 
UniRef50_Q4P230 Cluster: Putative uncharacterized protein; n=1; ...    39   0.11 
UniRef50_A7QJ11 Cluster: Chromosome chr2 scaffold_105, whole gen...    39   0.14 
UniRef50_Q4UIK3 Cluster: Actin, putative; n=2; Theileria|Rep: Ac...    39   0.14 
UniRef50_Q2H0E9 Cluster: Putative uncharacterized protein; n=1; ...    38   0.25 
UniRef50_Q9VWE8 Cluster: CG12235-PA; n=4; Diptera|Rep: CG12235-P...    38   0.33 
UniRef50_Q7QU75 Cluster: GLP_226_21952_22986; n=1; Giardia lambl...    38   0.33 
UniRef50_A7EPN9 Cluster: Putative uncharacterized protein; n=1; ...    37   0.43 
UniRef50_Q5KMC1 Cluster: Nucleus protein, putative; n=1; Filobas...    37   0.57 
UniRef50_A7P2E9 Cluster: Chromosome chr1 scaffold_5, whole genom...    36   1.00 
UniRef50_Q7M3Y5 Cluster: Actin; n=1; Aplysia californica|Rep: Ac...    36   1.00 
UniRef50_Q22KT1 Cluster: Actin related protein; n=1; Tetrahymena...    36   1.00 
UniRef50_Q29G73 Cluster: Actin-related protein 8; n=3; Sophophor...    36   1.00 
UniRef50_A7S2B1 Cluster: Predicted protein; n=1; Nematostella ve...    36   1.3  
UniRef50_Q12386 Cluster: Actin-like protein ARP8; n=4; Saccharom...    36   1.3  
UniRef50_Q29CA1 Cluster: GA15955-PA; n=1; Drosophila pseudoobscu...    35   1.7  
UniRef50_Q6CA98 Cluster: Similar to sp|Q12386 Saccharomyces cere...    35   1.7  
UniRef50_A0TIM1 Cluster: Putative uncharacterized protein precur...    35   2.3  
UniRef50_Q6ZSJ8 Cluster: Uncharacterized protein C1orf122; n=4; ...    35   2.3  
UniRef50_A2VD47 Cluster: Zgc:158823 protein; n=3; Eukaryota|Rep:...    34   3.0  
UniRef50_A3GFF1 Cluster: Actin-related protein; n=4; Saccharomyc...    34   3.0  
UniRef50_A5KAJ7 Cluster: Actin-like protein, putative; n=6; Plas...    34   4.0  
UniRef50_A0BR70 Cluster: Chromosome undetermined scaffold_122, w...    34   4.0  
UniRef50_UPI000065CE2F Cluster: Homolog of Homo sapiens "Splice ...    33   5.3  
UniRef50_O86712 Cluster: Putative uncharacterized protein SCO653...    33   5.3  
UniRef50_Q08PG2 Cluster: Putative uncharacterized protein; n=2; ...    33   5.3  
UniRef50_UPI0000D57658 Cluster: PREDICTED: similar to pristanoyl...    33   7.0  
UniRef50_A6T949 Cluster: Glycerate kinase I; n=1; Klebsiella pne...    33   7.0  
UniRef50_A6DWM1 Cluster: Putative polyhydroxybutyrate depolymera...    33   7.0  
UniRef50_A0UCB5 Cluster: Putative uncharacterized protein; n=1; ...    33   7.0  
UniRef50_Q2I694 Cluster: Beta-actin; n=1; Eisenia fetida|Rep: Be...    33   7.0  
UniRef50_Q8UZE1 Cluster: LF3; n=1; Cercopithecine herpesvirus 15...    33   9.3  
UniRef50_Q8YUI3 Cluster: Alr2363 protein; n=3; Nostocaceae|Rep: ...    33   9.3  
UniRef50_Q2L1J0 Cluster: Putative filamentous surface protein pr...    33   9.3  
UniRef50_Q1DF22 Cluster: Putative membrane protein; n=2; Cystoba...    33   9.3  
UniRef50_A2ZDB1 Cluster: Putative uncharacterized protein; n=2; ...    33   9.3  
UniRef50_Q0UUL9 Cluster: Putative uncharacterized protein; n=1; ...    33   9.3  
UniRef50_A4RNX7 Cluster: Putative uncharacterized protein; n=1; ...    33   9.3  

>UniRef50_Q4JSC0 Cluster: Actin; n=13; Coelomata|Rep: Actin -
           Anopheles gambiae (African malaria mosquito)
          Length = 376

 Score =  275 bits (674), Expect = 8e-73
 Identities = 127/139 (91%), Positives = 132/139 (94%)
 Frame = -3

Query: 703 EKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYAN 524
           EKSYELPDGQVITIGNERFR PEALFQPSFLGME+ GIHET YNSIM+CDVDIRKDLYAN
Sbjct: 238 EKSYELPDGQVITIGNERFRAPEALFQPSFLGMESTGIHETVYNSIMRCDVDIRKDLYAN 297

Query: 523 TVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMW 344
           +VLSGGTTMYPGIADRMQKEIT+LAPST+KIKIIAPPERKYSVWIGGSILASLSTFQ MW
Sbjct: 298 SVLSGGTTMYPGIADRMQKEITSLAPSTIKIKIIAPPERKYSVWIGGSILASLSTFQTMW 357

Query: 343 ISKQEYDESGPSIVHRKCF 287
           ISK EYDE GP IVHRKCF
Sbjct: 358 ISKHEYDEGGPGIVHRKCF 376


>UniRef50_O65314 Cluster: Actin; n=20; Eukaryota|Rep: Actin -
           Scherffelia dubia
          Length = 378

 Score =  264 bits (648), Expect = 1e-69
 Identities = 118/139 (84%), Positives = 129/139 (92%)
 Frame = -3

Query: 703 EKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYAN 524
           EK+YELPDGQ IT+GNERFRCPE LFQP  LG E+ G+HETT+NSIMKCDVDIRKDLY N
Sbjct: 240 EKNYELPDGQQITVGNERFRCPEVLFQPGLLGQESVGVHETTFNSIMKCDVDIRKDLYNN 299

Query: 523 TVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMW 344
            VLSGGTTM+PGIADRM KEITA+APS+MKIK++APPERKYSVWIGGSILASLSTFQQMW
Sbjct: 300 IVLSGGTTMFPGIADRMSKEITAVAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQMW 359

Query: 343 ISKQEYDESGPSIVHRKCF 287
           I+K EYDESGPSIVHRKCF
Sbjct: 360 IAKAEYDESGPSIVHRKCF 378


>UniRef50_P02581 Cluster: Actin-1; n=1852; Eukaryota|Rep: Actin-1 -
           Glycine max (Soybean)
          Length = 377

 Score =  254 bits (622), Expect = 2e-66
 Identities = 116/140 (82%), Positives = 126/140 (90%)
 Frame = -3

Query: 706 LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYA 527
           +EKSYELPDGQVITIG ERF CP  L+QPS +GMEA GIHETTYNSIMKCDVDIRKDLY 
Sbjct: 238 VEKSYELPDGQVITIGAERFGCPGVLYQPSMVGMEASGIHETTYNSIMKCDVDIRKDLYG 297

Query: 526 NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 347
           N VLSGGTTM+P IADRM KEI+ALAPS+MKIK++AP ERK+ VWIGGSILASLSTFQQM
Sbjct: 298 NIVLSGGTTMFPSIADRMSKEISALAPSSMKIKVVAPSERKFGVWIGGSILASLSTFQQM 357

Query: 346 WISKQEYDESGPSIVHRKCF 287
           WI K EYDESGPSIVH+KCF
Sbjct: 358 WIXKAEYDESGPSIVHKKCF 377


>UniRef50_P14883 Cluster: Actin-2; n=75; Eukaryota|Rep: Actin-2 -
           Plasmodium falciparum
          Length = 376

 Score =  235 bits (574), Expect = 1e-60
 Identities = 103/140 (73%), Positives = 123/140 (87%)
 Frame = -3

Query: 706 LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYA 527
           +E+ YELPDG +IT+G+ERFRCPEALF P+ +G E  G+H T Y SIMKCD+DIRK+LY 
Sbjct: 237 IEEIYELPDGNLITVGSERFRCPEALFNPTLIGRECPGLHITAYQSIMKCDIDIRKELYN 296

Query: 526 NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 347
           N VLSGGTTMY  I +R+ KE+T LAPS+MKIK+IAPPERKYSVWIGGSIL+SLSTFQQM
Sbjct: 297 NIVLSGGTTMYNNIGERLTKEMTNLAPSSMKIKVIAPPERKYSVWIGGSILSSLSTFQQM 356

Query: 346 WISKQEYDESGPSIVHRKCF 287
           WI+K+EY++SGPSIVHRKCF
Sbjct: 357 WITKEEYEDSGPSIVHRKCF 376


>UniRef50_Q96483 Cluster: Actin-51; n=584; Eukaryota|Rep: Actin-51 -
           Solanum lycopersicum (Tomato) (Lycopersicon esculentum)
          Length = 336

 Score =  225 bits (549), Expect = 1e-57
 Identities = 103/119 (86%), Positives = 111/119 (93%)
 Frame = -3

Query: 706 LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYA 527
           +EK+YELPDGQVITIG ERF CPE LFQPS +GMEA GIHETTYNSIMKCDVDIRKDLY 
Sbjct: 218 IEKNYELPDGQVITIGAERFGCPEVLFQPSMIGMEAAGIHETTYNSIMKCDVDIRKDLYG 277

Query: 526 NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQ 350
           N VLSGG+TM+PGIADRM KEITALAPS+MKIK++APPERKYSVWIGGSILASLSTFQQ
Sbjct: 278 NIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQ 336


>UniRef50_Q7M3B0 Cluster: Actin beta; n=1; Sus scrofa domestica|Rep:
           Actin beta - Sus scrofa domestica (domestic pig)
          Length = 195

 Score =  158 bits (383), Expect(2) = 5e-47
 Identities = 79/83 (95%), Positives = 80/83 (96%)
 Frame = -3

Query: 541 KDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLS 362
           +DLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKI  IAPPERK SVWIGGSILASLS
Sbjct: 116 EDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKI--IAPPERK-SVWIGGSILASLS 172

Query: 361 TFQQMWISKQEYDESGPSIVHRK 293
           TFQQMWISKQEYDESGPSIVHRK
Sbjct: 173 TFQQMWISKQEYDESGPSIVHRK 195



 Score = 53.2 bits (122), Expect(2) = 5e-47
 Identities = 23/30 (76%), Positives = 26/30 (86%)
 Frame = -3

Query: 700 KSYELPDGQVITIGNERFRCPEALFQPSFL 611
           +SYELPDGQVITIGNERFRCPE L+  + L
Sbjct: 95  ESYELPDGQVITIGNERFRCPEDLYANTVL 124


>UniRef50_UPI0000E466A7 Cluster: PREDICTED: similar to actin, alpha
           1, skeletal muscle; n=1; Strongylocentrotus
           purpuratus|Rep: PREDICTED: similar to actin, alpha 1,
           skeletal muscle - Strongylocentrotus purpuratus
          Length = 258

 Score =  188 bits (458), Expect = 1e-46
 Identities = 80/139 (57%), Positives = 106/139 (76%)
 Frame = -3

Query: 706 LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYA 527
           L K+Y LPD   IT+GNE FR PE LFQPS    +   +H+  Y++IMKCD+D+R  LY 
Sbjct: 118 LTKTYTLPDLHDITLGNEIFRVPEILFQPSLADRDHASVHKLVYDAIMKCDIDLRVHLYC 177

Query: 526 NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 347
           N  L GG+TM+PG  +R+QKE++A+ P   K+++ APPERKY+VWIGGSILASLS F++ 
Sbjct: 178 NVFLVGGSTMFPGFQERLQKELSAMFPQKAKVRVNAPPERKYTVWIGGSILASLSNFKES 237

Query: 346 WISKQEYDESGPSIVHRKC 290
           WI+K+EYDE GPS+VH+KC
Sbjct: 238 WITKKEYDEHGPSVVHKKC 256


>UniRef50_Q5AKW9 Cluster: Putative uncharacterized protein; n=1;
           Candida albicans|Rep: Putative uncharacterized protein -
           Candida albicans (Yeast)
          Length = 123

 Score =  186 bits (454), Expect = 4e-46
 Identities = 89/123 (72%), Positives = 100/123 (81%)
 Frame = +3

Query: 306 MEGPDSSYSCFEIHICWKVEREARIDPPIHTEYFLSGGAMILIFIVDGARAVISFCIRSA 485
           M+GPDSSYSCFEIHICWKV+ EA+I+PPI TEYFLSGGA+IL FI DGA+AVISFCIRSA
Sbjct: 1   MDGPDSSYSCFEIHICWKVDNEAKIEPPIQTEYFLSGGAIILTFIEDGAKAVISFCIRSA 60

Query: 486 IPGYMVVPPDNTVLAYKSLRMSTSHFMMELYVVSWMPQASIPKNEGWKRASGQRNLSFPI 665
           IPG MVVPPD T+L Y S   S SHFMMEL VV  +P AS PK+ G  +ASG  NLS PI
Sbjct: 61  IPGNMVVPPDITMLPYNSFLTSMSHFMMELKVVWSIPAASKPKSAGSNKASGASNLSLPI 120

Query: 666 VMT 674
           V+T
Sbjct: 121 VIT 123


>UniRef50_UPI000049A548 Cluster: actin; n=1; Entamoeba histolytica
           HM-1:IMSS|Rep: actin - Entamoeba histolytica HM-1:IMSS
          Length = 365

 Score =  178 bits (433), Expect = 1e-43
 Identities = 76/138 (55%), Positives = 104/138 (75%)
 Frame = -3

Query: 706 LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYA 527
           L+K YELPDGQ+I+IG+ERF+C E LF+P+ +G E  GIHE TYNSIM+CD D+RKD+Y 
Sbjct: 225 LDKKYELPDGQIISIGSERFKCSEVLFEPNIIGKETSGIHEITYNSIMQCDCDLRKDMYN 284

Query: 526 NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 347
           N VL GG++M+PG+  R  KEIT L+P T++I +    +RKY  WIGG + ASLS+F++ 
Sbjct: 285 NIVLCGGSSMFPGMKQRFIKEITVLSPPTIQINVDCNRKRKYGAWIGGKMFASLSSFEER 344

Query: 346 WISKQEYDESGPSIVHRK 293
           ++ K EYDE G S ++ K
Sbjct: 345 YMKKAEYDEFGASYINSK 362


>UniRef50_Q9BYD9 Cluster: Actin-related protein M1; n=12;
           Theria|Rep: Actin-related protein M1 - Homo sapiens
           (Human)
          Length = 372

 Score =  175 bits (425), Expect = 1e-42
 Identities = 74/140 (52%), Positives = 105/140 (75%)
 Frame = -3

Query: 706 LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYA 527
           LEK Y+LPDG+VI + ++ F CPEALF P  + +EA GI +  ++SIMKCD  +R   ++
Sbjct: 233 LEKVYQLPDGKVIQLHDQLFSCPEALFSPCHMNLEAPGIDKICFSSIMKCDTGLRNSFFS 292

Query: 526 NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 347
           N +L+GG+T +PG+  R+ K+I  +AP+   +++IAPPERK SVW+GGSILASLS FQ M
Sbjct: 293 NIILAGGSTSFPGLDKRLVKDIAKVAPANTAVQVIAPPERKISVWMGGSILASLSAFQDM 352

Query: 346 WISKQEYDESGPSIVHRKCF 287
           WI+  E+ E GP+IVH++CF
Sbjct: 353 WITAAEFKEVGPNIVHQRCF 372


>UniRef50_Q9XZB9 Cluster: Actin; n=1; Sterkiella nova|Rep: Actin -
           Oxytricha nova
          Length = 374

 Score =  174 bits (424), Expect = 2e-42
 Identities = 78/141 (55%), Positives = 100/141 (70%)
 Frame = -3

Query: 715 GPPLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKD 536
           G   EKSYELPDG+++++G+ RF+CPE LFQP   G E   I   TYNSI KC+ D+R D
Sbjct: 232 GSTYEKSYELPDGKIVSVGDARFKCPEYLFQPQINGKEMDSIQTITYNSIEKCEADLRND 291

Query: 535 LYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTF 356
           LY N VLSGG++M+ G ++R+QKEI  LAP   ++K+IA P+ K S W GG   ASLSTF
Sbjct: 292 LYQNIVLSGGSSMFEGFSERLQKEIETLAPKGTEVKVIATPDGKLSAWRGGQAFASLSTF 351

Query: 355 QQMWISKQEYDESGPSIVHRK 293
             + I+K+EYDE G  IVHRK
Sbjct: 352 SDVCITKEEYDEFGQEIVHRK 372


>UniRef50_P61163 Cluster: Alpha-centractin; n=356; root|Rep:
           Alpha-centractin - Homo sapiens (Human)
          Length = 376

 Score =  167 bits (407), Expect = 2e-40
 Identities = 75/136 (55%), Positives = 97/136 (71%)
 Frame = -3

Query: 694 YELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYANTVL 515
           Y LPDG  I IG  RFR PE LF+P  +G E+ GIHE    +I K D+D+R+ L++N VL
Sbjct: 241 YYLPDGSTIEIGPSRFRAPELLFRPDLIGEESEGIHEVLVFAIQKSDMDLRRTLFSNIVL 300

Query: 514 SGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISK 335
           SGG+T++ G  DR+  E+  LAP  +KI+I AP ER YS WIGGSILASL TF++MW+SK
Sbjct: 301 SGGSTLFKGFGDRLLSEVKKLAPKDVKIRISAPQERLYSTWIGGSILASLDTFKKMWVSK 360

Query: 334 QEYDESGPSIVHRKCF 287
           +EY+E G   +HRK F
Sbjct: 361 KEYEEDGARSIHRKTF 376


>UniRef50_UPI000059FC57 Cluster: PREDICTED: similar to cytoplasmic
           beta-actin; n=1; Canis lupus familiaris|Rep: PREDICTED:
           similar to cytoplasmic beta-actin - Canis familiaris
          Length = 221

 Score =  163 bits (397), Expect = 3e-39
 Identities = 78/96 (81%), Positives = 87/96 (90%)
 Frame = -3

Query: 634 ALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITA 455
           +L + SF G+E+CGIHETT+NSI+KCDV I +DLYANTVLSGGTTMYPGIAD MQK ITA
Sbjct: 78  SLEKTSFPGVESCGIHETTFNSIVKCDVAIWEDLYANTVLSGGTTMYPGIADGMQKGITA 137

Query: 454 LAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 347
           LAPSTMKIKIIAPP+RKYS WIGGS LASLSTFQQ+
Sbjct: 138 LAPSTMKIKIIAPPKRKYSAWIGGSRLASLSTFQQL 173


>UniRef50_Q7M3Y6 Cluster: Actin homolog fat, testicular; n=3;
           Deuterostomia|Rep: Actin homolog fat, testicular -
           Pisaster ochraceus (Sea star)
          Length = 155

 Score =  162 bits (393), Expect = 9e-39
 Identities = 79/100 (79%), Positives = 85/100 (85%)
 Frame = -3

Query: 655 ERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADR 476
           E +  P A+ +   LG    G+HET YNSIMKCDVDIRKDLYAN VLSGG+TMYPGIADR
Sbjct: 60  EGYALPHAILRLILLG----GLHETCYNSIMKCDVDIRKDLYANVVLSGGSTMYPGIADR 115

Query: 475 MQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTF 356
           MQK+IT LAPSTMKIKIIAPPERKYSVWIGGSILASLSTF
Sbjct: 116 MQKDITGLAPSTMKIKIIAPPERKYSVWIGGSILASLSTF 155


>UniRef50_Q963K1 Cluster: Actin-3; n=1; Cercomonas sp. ATCC
           50318|Rep: Actin-3 - Cercomonas sp. ATCC 50318
          Length = 266

 Score =  161 bits (392), Expect = 1e-38
 Identities = 74/133 (55%), Positives = 94/133 (70%), Gaps = 2/133 (1%)
 Frame = -3

Query: 703 EKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYAN 524
           EK Y LPDG  +TIG+ER+ C E LFQPS LG E  G+H+  Y+SIMKCD+D+R++LY  
Sbjct: 134 EKKYTLPDGTALTIGDERYLCGETLFQPSLLGRECGGVHQYIYDSIMKCDMDMRRELYGA 193

Query: 523 TVLSGGTTMYPGIADRMQKEITALAPSTMK--IKIIAPPERKYSVWIGGSILASLSTFQQ 350
            VLSGG TM+ G   R+ + +  LAP  ++  +KI+A   R   VW GGSILA LSTFQQ
Sbjct: 194 IVLSGGNTMFDGFVARLDRGLRLLAPMLIRSHVKIVAGDARHMMVWHGGSILAELSTFQQ 253

Query: 349 MWISKQEYDESGP 311
            WI+KQ+YDE GP
Sbjct: 254 QWITKQDYDEMGP 266


>UniRef50_Q6BG22 Cluster: Actin, putative; n=2; Paramecium
           tetraurelia|Rep: Actin, putative - Paramecium
           tetraurelia
          Length = 370

 Score =  159 bits (386), Expect = 6e-38
 Identities = 70/137 (51%), Positives = 95/137 (69%)
 Frame = -3

Query: 697 SYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYANTV 518
           SY LPDG  I+I  ++++CPE LF P+  G E  GIHE TY SI   D DI++ LY N V
Sbjct: 234 SYILPDGNKISIKEQKYKCPEILFNPAKAGYELPGIHEITYQSIFTSDRDIQQQLYNNIV 293

Query: 517 LSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWIS 338
           ++GGTT++PG+ +R+ KEI  L  S  + ++I PP R  S WIGGSIL++L++F+  WI+
Sbjct: 294 ITGGTTLFPGLQERLLKEIENLVQSPTQTRVIVPPNRLNSTWIGGSILSTLTSFKPFWIT 353

Query: 337 KQEYDESGPSIVHRKCF 287
           K EY+E GP I H KCF
Sbjct: 354 KHEYEEFGPKIAHIKCF 370


>UniRef50_A2ECQ8 Cluster: Actin family protein; n=1; Trichomonas
           vaginalis G3|Rep: Actin family protein - Trichomonas
           vaginalis G3
          Length = 371

 Score =  157 bits (382), Expect = 2e-37
 Identities = 72/142 (50%), Positives = 99/142 (69%), Gaps = 1/142 (0%)
 Frame = -3

Query: 712 PPLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDL 533
           P   +   LP G+   +G ERF C E LF+P+    EA GIH+  ++SIMKCD+DIR+DL
Sbjct: 228 PETFEQLRLPSGKYYQVGKERFICSEVLFEPTIANKEAEGIHQIMFDSIMKCDIDIRQDL 287

Query: 532 YANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLS-TF 356
           Y +  LSGGTTM  GIA+R++KE+ ALAP +MKI +IAPP+R+ +VWIGGS+L +    F
Sbjct: 288 YKSIFLSGGTTMITGIAERIEKEVIALAPPSMKIVVIAPPQRRDAVWIGGSVLGTHEFFF 347

Query: 355 QQMWISKQEYDESGPSIVHRKC 290
            +M ++K EY E G +I+  KC
Sbjct: 348 DEMMVTKAEYREEGENIISLKC 369


>UniRef50_UPI0000588EB0 Cluster: PREDICTED: similar to actin; n=1;
           Strongylocentrotus purpuratus|Rep: PREDICTED: similar to
           actin - Strongylocentrotus purpuratus
          Length = 386

 Score =  157 bits (381), Expect = 3e-37
 Identities = 73/140 (52%), Positives = 97/140 (69%), Gaps = 3/140 (2%)
 Frame = -3

Query: 703 EKSYELPDGQVITIGN-ERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYA 527
           + +YELP G+ IT+   ER+  PEALF PS +  +  GIHE  YNSI     D+R+DL  
Sbjct: 245 QNTYELPSGETITVDPAERYGIPEALFNPSIIKKDFFGIHEMAYNSISGLQTDVREDLLR 304

Query: 526 NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLST--FQ 353
              L GG+T++PG  +RM++E+TALAP +MK+ I+A P+RKYSVWIGGSI AS +    +
Sbjct: 305 LVYLVGGSTLFPGFKERMKRELTALAPPSMKVSIVATPDRKYSVWIGGSIFASRNPDYIE 364

Query: 352 QMWISKQEYDESGPSIVHRK 293
             WI KQEY+E GP +VHRK
Sbjct: 365 THWIKKQEYEEIGPDVVHRK 384


>UniRef50_UPI0000E23763 Cluster: PREDICTED: hypothetical protein
           isoform 1; n=1; Pan troglodytes|Rep: PREDICTED:
           hypothetical protein isoform 1 - Pan troglodytes
          Length = 105

 Score =  153 bits (370), Expect = 5e-36
 Identities = 74/103 (71%), Positives = 82/103 (79%)
 Frame = +3

Query: 384 PPIHTEYFLSGGAMILIFIVDGARAVISFCIRSAIPGYMVVPPDNTVLAYKSLRMSTSHF 563
           PP HTEY   GGA ILIFIV GARA ISFCI  A+PGYMVVPPD+TVL Y+SL MSTS F
Sbjct: 3   PPTHTEYLRLGGATILIFIVLGARAAISFCILWAMPGYMVVPPDSTVLVYRSLWMSTSDF 62

Query: 564 MMELYVVSWMPQASIPKNEGWKRASGQRNLSFPIVMT*PSGSS 692
           M+EL VVSWMPQ S+P+ +GWK  SGQRN S  +VMT PSGSS
Sbjct: 63  MIELKVVSWMPQDSMPRKQGWKSTSGQRNRSLLMVMTWPSGSS 105


>UniRef50_UPI0001554F81 Cluster: PREDICTED: similar to actin; n=1;
           Ornithorhynchus anatinus|Rep: PREDICTED: similar to
           actin - Ornithorhynchus anatinus
          Length = 376

 Score =  152 bits (369), Expect = 7e-36
 Identities = 63/140 (45%), Positives = 99/140 (70%), Gaps = 1/140 (0%)
 Frame = -3

Query: 709 PLEKSYELPDGQVITIGNE-RFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDL 533
           P  K+Y+LPDG  I++  E RF CPEALF+P  LG  +CG+H + + ++  CD  +   L
Sbjct: 235 PSIKTYKLPDGNAISVPEEDRFGCPEALFRPFLLGQGSCGLHHSLFEAVALCDAHLHNSL 294

Query: 532 YANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQ 353
           +++ VLSGG T + G  +RM+KE+TALAP T +++++  P   +S W+GGS+LA+LSTFQ
Sbjct: 295 FSHLVLSGGNTRFCGFLERMKKEMTALAPPTARVQLVNAPGGCFSTWMGGSMLAALSTFQ 354

Query: 352 QMWISKQEYDESGPSIVHRK 293
            MW+++++YDE G  ++ +K
Sbjct: 355 NMWVTREDYDEMGSLMIQKK 374


>UniRef50_Q8TDY3 Cluster: Actin-related protein T2; n=26;
           Amniota|Rep: Actin-related protein T2 - Homo sapiens
           (Human)
          Length = 377

 Score =  149 bits (362), Expect = 5e-35
 Identities = 66/138 (47%), Positives = 95/138 (68%)
 Frame = -3

Query: 700 KSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYANT 521
           + Y+LPDG +I++G+   + PEALF P  LG ++ G+     +SI KCD DI+K L+   
Sbjct: 240 REYKLPDGNIISLGDPLHQAPEALFVPQQLGSQSPGLSNMVSSSITKCDTDIQKILFGEI 299

Query: 520 VLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWI 341
           VLSGGTT++ G+ DR+ KE+  LA     IKI APP+R +S WIG SI+ SLS+F+QMW+
Sbjct: 300 VLSGGTTLFHGLDDRLLKELEQLASKDTPIKITAPPDRWFSTWIGASIVTSLSSFKQMWV 359

Query: 340 SKQEYDESGPSIVHRKCF 287
           +  ++ E G S+V R+CF
Sbjct: 360 TAADFKEFGTSVVQRRCF 377


>UniRef50_UPI000065DC3F Cluster: Homolog of Homo sapiens "Actin,
           beta; n=2; Takifugu rubripes|Rep: Homolog of Homo
           sapiens "Actin, beta - Takifugu rubripes
          Length = 99

 Score =  149 bits (361), Expect = 7e-35
 Identities = 74/99 (74%), Positives = 79/99 (79%), Gaps = 5/99 (5%)
 Frame = +3

Query: 306 MEGPDSSYSCFEIHICWKVEREARIDPPIHTEYFLSGGAMIL-----IFIVDGARAVISF 470
           M GPDSSYSC  IHICWKVEREAR++PPIHTEYFLSGGAMI             + VISF
Sbjct: 1   MLGPDSSYSCLLIHICWKVEREARMEPPIHTEYFLSGGAMIYREENKTQSYINTKEVISF 60

Query: 471 CIRSAIPGYMVVPPDNTVLAYKSLRMSTSHFMMELYVVS 587
           C+RSAIPGYMVVPPD TVLAY+SLRMSTSHFMM L VVS
Sbjct: 61  CMRSAIPGYMVVPPDRTVLAYRSLRMSTSHFMMLLKVVS 99


>UniRef50_A4QNT8 Cluster: Si:ch211-241j12.3 protein; n=3; Danio
           rerio|Rep: Si:ch211-241j12.3 protein - Danio rerio
           (Zebrafish) (Brachydanio rerio)
          Length = 389

 Score =  148 bits (358), Expect = 2e-34
 Identities = 63/141 (44%), Positives = 94/141 (66%), Gaps = 2/141 (1%)
 Frame = -3

Query: 703 EKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYAN 524
           E  Y LPDG  + + ++RFR PE LF+P  +G +  G+HE+ + SI++ D+D+R+    N
Sbjct: 249 EIQYTLPDGHTVPLASQRFRAPEILFRPELIGRDHYGLHESVFRSILQSDLDLRRSFVGN 308

Query: 523 TVLSGGTTMYPGIADRMQKEITALAPSTMK--IKIIAPPERKYSVWIGGSILASLSTFQQ 350
            +LSGG T+  G+A+R+Q E+ A+ P  +   +++ +PP+R +SVW GG+ LASL   Q 
Sbjct: 309 ILLSGGNTLLSGLAERLQLEVRAMVPLDLSACVRVSSPPDRDFSVWSGGAALASLPEQQS 368

Query: 349 MWISKQEYDESGPSIVHRKCF 287
            WIS  EY+E GP IV RKCF
Sbjct: 369 AWISAAEYEEFGPQIVFRKCF 389


>UniRef50_A2DKQ5 Cluster: Actin 58, putative; n=2; Trichomonas
           vaginalis G3|Rep: Actin 58, putative - Trichomonas
           vaginalis G3
          Length = 373

 Score =  147 bits (357), Expect = 2e-34
 Identities = 63/139 (45%), Positives = 96/139 (69%)
 Frame = -3

Query: 703 EKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYAN 524
           ++S  LP+G  +   +E FR  E LFQPS  G++A G+    Y ++ +CD D+RK++Y N
Sbjct: 234 QQSVNLPNGDPLLYTSEGFRTAEILFQPSLAGVQADGVQLQIYTALERCDTDVRKEMYGN 293

Query: 523 TVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMW 344
            VL+GGT+M+ G+ +R++KE+ A+A  +M +K++A PER+ +VWIGGS+L SL  F  M 
Sbjct: 294 IVLAGGTSMFKGLPERVEKEVIAMATPSMTVKVVATPERRNAVWIGGSVLGSLEAFPAMM 353

Query: 343 ISKQEYDESGPSIVHRKCF 287
           I++ EY E G  IVHRK +
Sbjct: 354 INRAEYKEEGIQIVHRKYY 372


>UniRef50_Q55DS6 Cluster: Putative uncharacterized protein; n=1;
           Dictyostelium discoideum AX4|Rep: Putative
           uncharacterized protein - Dictyostelium discoideum AX4
          Length = 392

 Score =  144 bits (350), Expect = 1e-33
 Identities = 68/139 (48%), Positives = 96/139 (69%), Gaps = 3/139 (2%)
 Frame = -3

Query: 700 KSYELPDGQVITIGNERFRCPEALFQPSFLGMEAC---GIHETTYNSIMKCDVDIRKDLY 530
           K YEL DG+VI++ NE F+  E LFQPS +G E+    GIHE  YNS +KCDV  R  L 
Sbjct: 247 KEYELVDGRVISLTNELFQSTEPLFQPSLVGCESSSVGGIHEHIYNSFLKCDVQERIQLQ 306

Query: 529 ANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQ 350
            + V++GG+T++ G ++R+  E++ L+PS++K  I   P+R+   WIGGSI +SLSTF+ 
Sbjct: 307 NSIVITGGSTLFKGFSERLSNELSNLSPSSLKFNIFEIPDRRNLSWIGGSIFSSLSTFRH 366

Query: 349 MWISKQEYDESGPSIVHRK 293
            WIS ++YDE GP IV+ K
Sbjct: 367 HWISLEDYDEYGPQIVNSK 385


>UniRef50_UPI0000F2D326 Cluster: PREDICTED: similar to actin; n=1;
           Monodelphis domestica|Rep: PREDICTED: similar to actin -
           Monodelphis domestica
          Length = 378

 Score =  144 bits (348), Expect = 3e-33
 Identities = 67/137 (48%), Positives = 92/137 (67%)
 Frame = -3

Query: 697 SYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYANTV 518
           +Y LPDGQ + IG+E F+ PE LFQPS  G  A GIH     S++K     +KDL  N +
Sbjct: 242 NYILPDGQTMQIGDELFQVPECLFQPSKAGSSAPGIHTLVTESVLKSSHHFQKDLLNNLI 301

Query: 517 LSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWIS 338
           LSGG+T+ PG+  R+ +EI +L   ++K+ I+AP +R  SVWIG S++ SLSTFQQMW+S
Sbjct: 302 LSGGSTLCPGMKRRLWREIQSLMKGSLKVNIMAPSDRLLSVWIGASVITSLSTFQQMWMS 361

Query: 337 KQEYDESGPSIVHRKCF 287
             +Y+E GPS   + CF
Sbjct: 362 SSDYNELGPS-AKQNCF 377


>UniRef50_Q9Y614 Cluster: Actin-like protein 7B; n=12; Theria|Rep:
           Actin-like protein 7B - Homo sapiens (Human)
          Length = 415

 Score =  143 bits (346), Expect = 4e-33
 Identities = 68/140 (48%), Positives = 90/140 (64%), Gaps = 1/140 (0%)
 Frame = -3

Query: 706 LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKC-DVDIRKDLY 530
           L   YELPDG++ITIG ERFRC E LFQPS  G    G+ E T   + +C D   ++++ 
Sbjct: 277 LRVDYELPDGKLITIGQERFRCSEMLFQPSLAGSTQPGLPELTAACLGRCQDTGFKEEMA 336

Query: 529 ANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQ 350
           AN +L GG TM  G  +R Q+E++ L P      + A PERK SVW GGSILASL  FQQ
Sbjct: 337 ANVLLCGGCTMLDGFPERFQRELSLLCPGDSPA-VAAAPERKTSVWTGGSILASLQAFQQ 395

Query: 349 MWISKQEYDESGPSIVHRKC 290
           +W+SK+E++E G   ++ KC
Sbjct: 396 LWVSKEEFEERGSVAIYSKC 415


>UniRef50_A2DBN6 Cluster: Actin family protein; n=1; Trichomonas
           vaginalis G3|Rep: Actin family protein - Trichomonas
           vaginalis G3
          Length = 373

 Score =  142 bits (344), Expect = 8e-33
 Identities = 59/136 (43%), Positives = 90/136 (66%)
 Frame = -3

Query: 694 YELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYANTVL 515
           + LPDG+ I +G +RF CPE  F+P   G+ +  + ++ ++ I K D D+R  +Y+N +L
Sbjct: 238 FTLPDGKQIVLGTQRFFCPELFFKPKSYGISSSSLTQSIFDVINKVDKDLRPLMYSNILL 297

Query: 514 SGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISK 335
           SGG++M+P   +R+   +  L P    + + +P  RK S WIGGS+L SL+TF QMWI+K
Sbjct: 298 SGGSSMFPHFGERISNNLRGLLPPETNVLVQSPANRKNSAWIGGSVLVSLATFSQMWITK 357

Query: 334 QEYDESGPSIVHRKCF 287
           +EYDE GP +V+ KCF
Sbjct: 358 EEYDEVGPEVVNLKCF 373


>UniRef50_UPI0000F2D825 Cluster: PREDICTED: similar to actin; n=1;
           Monodelphis domestica|Rep: PREDICTED: similar to actin -
           Monodelphis domestica
          Length = 416

 Score =  140 bits (340), Expect = 2e-32
 Identities = 62/138 (44%), Positives = 88/138 (63%)
 Frame = -3

Query: 700 KSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYANT 521
           +++ LPDG++I++  ER+R PEA FQPS L     G+H++ +  IM CD  +RK    NT
Sbjct: 279 ETFTLPDGRIISVKEERYRVPEAFFQPSLLNFTCPGLHKSIHELIMNCDPVLRKIFKMNT 338

Query: 520 VLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWI 341
           +L GG+  +PG+  RM KE+ A       IK+I P E  +S W GGSIL  L++FQ MWI
Sbjct: 339 ILCGGSMAFPGMERRMVKELQAQEHQLTNIKVIVPSECWFSSWCGGSILTGLNSFQHMWI 398

Query: 340 SKQEYDESGPSIVHRKCF 287
              EY + G +I+HR+CF
Sbjct: 399 YDYEYQDIGATIIHRRCF 416


>UniRef50_Q8LKR2 Cluster: Actin-related protein 4; n=7; core
           eudicotyledons|Rep: Actin-related protein 4 -
           Arabidopsis thaliana (Mouse-ear cress)
          Length = 442

 Score =  140 bits (340), Expect = 2e-32
 Identities = 69/151 (45%), Positives = 100/151 (66%), Gaps = 15/151 (9%)
 Frame = -3

Query: 697 SYELPDGQVITIGNERFRCPEALFQPSFL----GMEAC--------GIHETTYNSIMKCD 554
           SYELPDGQ + IG +RF+ P+ +F PS +    GME          G+      SI KCD
Sbjct: 291 SYELPDGQTLEIGADRFKVPDVMFNPSIVQTIPGMEKYAEMIPSVRGLPHMVMESINKCD 350

Query: 553 VDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAP---PERKYSVWIGG 383
           VDIR++LY++ +L+GGT+    + +R++K++   +P + ++K++A     ER++SVWIGG
Sbjct: 351 VDIRRELYSSILLAGGTSSMQQLKERLEKDLIEESPHSARVKVLASGNTTERRFSVWIGG 410

Query: 382 SILASLSTFQQMWISKQEYDESGPSIVHRKC 290
           SILASL +FQQMW SK EY+E G S + RKC
Sbjct: 411 SILASLGSFQQMWFSKSEYEEHGASYIQRKC 441


>UniRef50_A5E2K2 Cluster: Actin; n=5; Saccharomycetales|Rep: Actin -
           Lodderomyces elongisporus (Yeast) (Saccharomyces
           elongisporus)
          Length = 417

 Score =  140 bits (339), Expect = 3e-32
 Identities = 76/159 (47%), Positives = 96/159 (60%), Gaps = 20/159 (12%)
 Frame = -3

Query: 706 LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYA 527
           L  +Y+LPDG  + +G ERFR PE LF P  +G E  G+H+    +I K D+D+R  LY 
Sbjct: 259 LFSTYKLPDGHEVHLGVERFRAPEILFNPQLIGTEYSGLHDLVSRAIAKNDLDLRPILYQ 318

Query: 526 NTVLSGGTTMYPGIADRMQKEITAL-------------------APST-MKIKIIAPPER 407
           N +LSGG T+     DR+ KE+  L                   A ST MKIKI APPER
Sbjct: 319 NILLSGGNTLIKNFGDRLLKELKDLQDQNKDALASIWNKSITDDAYSTKMKIKIFAPPER 378

Query: 406 KYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKC 290
           KYS WIGGSILA LSTF++MW+S +EY +  P I+ RKC
Sbjct: 379 KYSTWIGGSILAGLSTFKKMWVSSEEYKDD-PDIIFRKC 416


>UniRef50_Q4N681 Cluster: Actin, putative; n=3; Piroplasmida|Rep:
           Actin, putative - Theileria parva
          Length = 380

 Score =  139 bits (337), Expect = 5e-32
 Identities = 54/139 (38%), Positives = 96/139 (69%), Gaps = 1/139 (0%)
 Frame = -3

Query: 700 KSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYANT 521
           K+++LPDG  +++  E   CPE LF+P         + E  Y+S+  C+ ++ + +++N 
Sbjct: 242 KTFKLPDGTTVSLSRECITCPEILFKPELSYRRCPNLPEICYHSVRMCEPELHRTMFSNI 301

Query: 520 VLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPP-ERKYSVWIGGSILASLSTFQQMW 344
           +L+GG++M+ G  +R ++EI+AL    + +K+++   +R  S WIG SI+A+L +FQQMW
Sbjct: 302 LLTGGSSMFDGFLERCEREISALVNKNVPVKVLSSSHQRDLSAWIGASIVANLQSFQQMW 361

Query: 343 ISKQEYDESGPSIVHRKCF 287
           ++K+EYDE+GP+++HRKCF
Sbjct: 362 VTKEEYDEAGPTVIHRKCF 380


>UniRef50_UPI0000499930 Cluster: actin; n=1; Entamoeba histolytica
           HM-1:IMSS|Rep: actin - Entamoeba histolytica HM-1:IMSS
          Length = 372

 Score =  138 bits (335), Expect = 1e-31
 Identities = 64/144 (44%), Positives = 95/144 (65%), Gaps = 3/144 (2%)
 Frame = -3

Query: 712 PPLEKSYELPDGQVITIGNERFRCPEALFQPS-FLGME--ACGIHETTYNSIMKCDVDIR 542
           P L ++Y LPDG   +I  ERF CPE LF+P  F+  +  A G+    Y+ +MKCD+D+R
Sbjct: 224 PDLLRTYTLPDGTEFSIEEERFLCPEILFRPELFISDDVLAKGLDVACYDCVMKCDIDVR 283

Query: 541 KDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLS 362
           + L+ N + +GG T+YPG A+R+   +  L   ++++ I AP +R+YS WIGGSI AS+S
Sbjct: 284 RCLFNNILCAGGNTLYPGFAERLASGVQKLCNDSIEVGIEAPADRQYSSWIGGSIFASIS 343

Query: 361 TFQQMWISKQEYDESGPSIVHRKC 290
            F Q+ I+  EYDE G  I+++KC
Sbjct: 344 EFNQLAINSFEYDEFGAQIINKKC 367


>UniRef50_UPI00006C1719 Cluster: PREDICTED: similar to actin, alpha
           2, smooth muscle, aorta; n=3; Homo/Pan/Gorilla
           group|Rep: PREDICTED: similar to actin, alpha 2, smooth
           muscle, aorta - Homo sapiens
          Length = 183

 Score =  127 bits (306), Expect(2) = 1e-31
 Identities = 62/82 (75%), Positives = 67/82 (81%)
 Frame = -3

Query: 532 YANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQ 353
           +A  +LS GTT+Y  I  RMQ EIT LAPSTMKI II  PE KY VWIGGSILASLSTFQ
Sbjct: 103 WAKMMLSCGTTVYLDITGRMQ-EITTLAPSTMKITIIESPEHKYMVWIGGSILASLSTFQ 161

Query: 352 QMWISKQEYDESGPSIVHRKCF 287
           QMWISKQEY+ES PSI+HRKCF
Sbjct: 162 QMWISKQEYEESAPSIIHRKCF 183



 Score = 32.7 bits (71), Expect(2) = 1e-31
 Identities = 15/18 (83%), Positives = 16/18 (88%)
 Frame = -3

Query: 706 LEKSYELPDGQVITIGNE 653
           LEKSYE PDGQVITI +E
Sbjct: 85  LEKSYEPPDGQVITICSE 102


>UniRef50_UPI000065FC19 Cluster: Homolog of Homo sapiens "Actin,
           cytoplasmic 2; n=1; Takifugu rubripes|Rep: Homolog of
           Homo sapiens "Actin, cytoplasmic 2 - Takifugu rubripes
          Length = 396

 Score =  135 bits (327), Expect = 9e-31
 Identities = 60/122 (49%), Positives = 82/122 (67%), Gaps = 2/122 (1%)
 Frame = -3

Query: 646 RCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQK 467
           R PE LF+P  +G + CGIHE+   SI+  D+D+R+ L  N VLSGG T+  G  +R+Q 
Sbjct: 275 RAPEILFKPELIGRDHCGIHESLLKSILSSDIDLRRSLLQNIVLSGGNTLLSGFPERLQA 334

Query: 466 EITALAPSTMK--IKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRK 293
           EI  L P  M   + +I+P +R +SVW GG++LA+L +F   WIS +EY+E GP IVHRK
Sbjct: 335 EIQGLLPPDMGECVHVISPVDRDFSVWSGGAMLANLQSFNLAWISLEEYEEHGPHIVHRK 394

Query: 292 CF 287
           CF
Sbjct: 395 CF 396


>UniRef50_Q4CV94 Cluster: Actin 2, putative; n=2; Trypanosoma
           cruzi|Rep: Actin 2, putative - Trypanosoma cruzi
          Length = 392

 Score =  135 bits (327), Expect = 9e-31
 Identities = 59/140 (42%), Positives = 90/140 (64%), Gaps = 2/140 (1%)
 Frame = -3

Query: 703 EKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYAN 524
           ++ + LPDG+VI +G  RF CPE LF P+       GI     N +  C +D+R+ L  +
Sbjct: 245 KEPFTLPDGEVIHVGRARFCCPEILFNPALAEKPYDGIQHAVINCVNSCPIDLRRQLLGS 304

Query: 523 TVLSGGTTMYPGIADRMQKEITALA--PSTMKIKIIAPPERKYSVWIGGSILASLSTFQQ 350
            VLSGG TM+ G+  R+Q E+ ALA   +   ++++A  ERK+SVWIG +ILASL++F  
Sbjct: 305 IVLSGGNTMFKGMQQRLQSELAALANKRAAEDVRVVAASERKFSVWIGAAILASLTSFAS 364

Query: 349 MWISKQEYDESGPSIVHRKC 290
            WI++ EY E G +++H++C
Sbjct: 365 EWITRTEYAEQGAAVLHKRC 384


>UniRef50_O96019 Cluster: Actin-like protein 6A; n=63;
           Eumetazoa|Rep: Actin-like protein 6A - Homo sapiens
           (Human)
          Length = 429

 Score =  135 bits (326), Expect = 1e-30
 Identities = 65/142 (45%), Positives = 87/142 (61%), Gaps = 7/142 (4%)
 Frame = -3

Query: 694 YELPDGQVITIGNERFRCPEALFQPSFL----GMEACGIHETTYNSIMKCDVDIRKDLYA 527
           YE P+G     G ER + PE LF PS +    G    G+      S+  CD+DIR  LY 
Sbjct: 287 YEFPNGYNCDFGAERLKIPEGLFDPSNVKGLSGNTMLGVSHVVTTSVGMCDIDIRPGLYG 346

Query: 526 NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIA---PPERKYSVWIGGSILASLSTF 356
           + +++GG T+     DR+ +E++   P +M++K+IA     ER++S WIGGSILASL TF
Sbjct: 347 SVIVAGGNTLIQSFTDRLNRELSQKTPPSMRLKLIANNTTVERRFSSWIGGSILASLGTF 406

Query: 355 QQMWISKQEYDESGPSIVHRKC 290
           QQMWISKQEY+E G   V RKC
Sbjct: 407 QQMWISKQEYEEGGKQCVERKC 428


>UniRef50_UPI00001E426E Cluster: PREDICTED: similar to actin-12;
           n=11; Eutheria|Rep: PREDICTED: similar to actin-12 - Mus
           musculus
          Length = 372

 Score =  134 bits (324), Expect = 2e-30
 Identities = 63/142 (44%), Positives = 84/142 (59%)
 Frame = -3

Query: 712 PPLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDL 533
           P  +K + LPDG+ I +G E F C E LF  S L     GIH  T  SIM C+   ++ L
Sbjct: 231 PSFQKKFTLPDGKEINLGQEAFMCSEVLFDTSLLERANPGIHMLTLESIMSCEKSHQRTL 290

Query: 532 YANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQ 353
           +   VL+GGT+   G+  RMQKE+  +      +K+ A P  KYS WIG SIL+SL  F+
Sbjct: 291 FNYIVLTGGTSACTGLRFRMQKEMAKVVSPDFCVKVTASPYAKYSAWIGASILSSLPLFK 350

Query: 352 QMWISKQEYDESGPSIVHRKCF 287
            MWI+  EY E GPS++ R+CF
Sbjct: 351 DMWITNHEYLEIGPSVIFRRCF 372


>UniRef50_Q9Y615 Cluster: Actin-like protein 7A; n=11; Mammalia|Rep:
           Actin-like protein 7A - Homo sapiens (Human)
          Length = 435

 Score =  134 bits (323), Expect = 3e-30
 Identities = 59/137 (43%), Positives = 91/137 (66%), Gaps = 1/137 (0%)
 Frame = -3

Query: 694 YELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYANTVL 515
           Y LPDG+ I +  ERF C E  F+PS +     G+H  T + + KCD+ +++DL  N +L
Sbjct: 301 YVLPDGKEIQLCQERFLCSEMFFKPSLIKSMQLGLHTQTVSCLNKCDIALKRDLMGNILL 360

Query: 514 SGGTTMYPGIADRMQKEITALAPS-TMKIKIIAPPERKYSVWIGGSILASLSTFQQMWIS 338
            GG+TM  G  +R+QKE++++ P+ T ++ ++  PER  +VW GGSILASL  FQ +W+ 
Sbjct: 361 CGGSTMLSGFPNRLQKELSSMCPNDTPQVNVL--PERDSAVWTGGSILASLQGFQPLWVH 418

Query: 337 KQEYDESGPSIVHRKCF 287
           + EY+E GP  ++R+CF
Sbjct: 419 RFEYEEHGPFFLYRRCF 435


>UniRef50_UPI00005864C8 Cluster: PREDICTED: similar to Actin; n=4;
           Strongylocentrotus purpuratus|Rep: PREDICTED: similar to
           Actin - Strongylocentrotus purpuratus
          Length = 383

 Score =  133 bits (322), Expect = 4e-30
 Identities = 62/137 (45%), Positives = 89/137 (64%), Gaps = 6/137 (4%)
 Frame = -3

Query: 694 YELPDGQVITIGNERFRCPEALFQPSFLGME------ACGIHETTYNSIMKCDVDIRKDL 533
           Y+LPDGQ I +G E F+C EA+F+P+ L  E        GI    Y  + +C+VD R+ L
Sbjct: 238 YQLPDGQEIILGQELFQCMEAMFKPALLRDEDTKLNYGSGIANIAYCGLQRCNVDTRRTL 297

Query: 532 YANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQ 353
           Y N V++GG +M+ G   R+++E+ +       +K+I PPER+ SVW+GGSILASLS ++
Sbjct: 298 YENVVVTGGNSMHRGFGGRLKQELVSRGVPQETLKVICPPERRKSVWLGGSILASLSAYK 357

Query: 352 QMWISKQEYDESGPSIV 302
            MWI+K+ Y E GP IV
Sbjct: 358 GMWITKKAYQEHGPMIV 374


>UniRef50_UPI0000449751 Cluster: PREDICTED: similar to gamma-actin;
           n=3; Amniota|Rep: PREDICTED: similar to gamma-actin -
           Gallus gallus
          Length = 377

 Score =  133 bits (321), Expect = 5e-30
 Identities = 57/136 (41%), Positives = 88/136 (64%)
 Frame = -3

Query: 694 YELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYANTVL 515
           Y LPDG+ +  G++ FR PEALF P+ + ++  G+      S  KC   IR D+  N VL
Sbjct: 242 YMLPDGRTVKAGDQLFRAPEALFAPAEVQIQGAGVVGMILQSAAKCSTHIRTDVLRNVVL 301

Query: 514 SGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISK 335
            GG+T++ G  +R+ KE+ A  PS   +KII+P  R +SVWIG S+LA+ ++ + MW+S+
Sbjct: 302 VGGSTLFRGFKERLLKELQAEVPSATPVKIISPKNRMHSVWIGASLLANSTSLRNMWVSR 361

Query: 334 QEYDESGPSIVHRKCF 287
           ++Y E GP+++ RK F
Sbjct: 362 EDYSEVGPTVLQRKSF 377


>UniRef50_Q6X960 Cluster: HSD21; n=13; Theria|Rep: HSD21 - Homo
           sapiens (Human)
          Length = 416

 Score =  132 bits (318), Expect = 1e-29
 Identities = 56/140 (40%), Positives = 89/140 (63%), Gaps = 1/140 (0%)
 Frame = -3

Query: 703 EKSYELPDGQVITIGNERFRCPEALFQPSFL-GMEACGIHETTYNSIMKCDVDIRKDLYA 527
           +++ +LPDG+ +T+G E F+CPE LF P  + G+   G+      S+ K  +++R DL  
Sbjct: 277 KRTLKLPDGRTVTLGKELFQCPELLFNPPEVPGLSPVGLSTMAKQSLRKLSLEMRADLAQ 336

Query: 526 NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 347
           N +L GG++++ G   R + E+    P+   + + A P R +SVWIGGSILASL  FQ  
Sbjct: 337 NVLLCGGSSLFTGFEGRFRAELLRALPAETHVVVAAQPTRNFSVWIGGSILASLRAFQSC 396

Query: 346 WISKQEYDESGPSIVHRKCF 287
           W+ +++Y+E GP IV+RKC+
Sbjct: 397 WVLREQYEEQGPYIVYRKCY 416


>UniRef50_A4RW28 Cluster: Predicted protein; n=2; Ostreococcus|Rep:
           Predicted protein - Ostreococcus lucimarinus CCE9901
          Length = 425

 Score =  128 bits (310), Expect = 1e-28
 Identities = 66/151 (43%), Positives = 93/151 (61%), Gaps = 15/151 (9%)
 Frame = -3

Query: 697 SYELPDGQVITIGNERFRCPEALFQPSFL-----GMEACG-------IHETTYNSIMKCD 554
           +YELPDG  I +G ERF+ PE  FQP  L      +   G       I E     I   D
Sbjct: 274 TYELPDGNTIEVGVERFQIPELFFQPEILRELNVDVPELGELKSLKSIQELVLECINNAD 333

Query: 553 VDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPP---ERKYSVWIGG 383
           VD+RKDL+ + VL GG++M+  + +R++  +   AP  +K K++A     ER+++ WIGG
Sbjct: 334 VDVRKDLWGSLVLCGGSSMFANMRERLEAALFDHAPQNVKTKVVASMNSVERRFATWIGG 393

Query: 382 SILASLSTFQQMWISKQEYDESGPSIVHRKC 290
           SILASL +FQQ+W+SKQEY+E G ++V RKC
Sbjct: 394 SILASLGSFQQLWMSKQEYEEHGANLVQRKC 424


>UniRef50_Q6ZSQ4 Cluster: CDNA FLJ45296 fis, clone BRHIP3003340,
           moderately similar to Actin, alpha skeletal muscle 2;
           n=1; Homo sapiens|Rep: CDNA FLJ45296 fis, clone
           BRHIP3003340, moderately similar to Actin, alpha
           skeletal muscle 2 - Homo sapiens (Human)
          Length = 214

 Score =  128 bits (310), Expect = 1e-28
 Identities = 59/65 (90%), Positives = 62/65 (95%)
 Frame = -3

Query: 619 SFLGMEACGIHETTYNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPST 440
           SF GME+ GIHETTYNSIMKCD+DIRKDLYAN VLSGGTTMYPGIADRMQKEITALAPST
Sbjct: 121 SFPGMESAGIHETTYNSIMKCDIDIRKDLYANNVLSGGTTMYPGIADRMQKEITALAPST 180

Query: 439 MKIKI 425
           MKIK+
Sbjct: 181 MKIKV 185


>UniRef50_A0E1S8 Cluster: Chromosome undetermined scaffold_73, whole
           genome shotgun sequence; n=1; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_73,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 383

 Score =  128 bits (309), Expect = 1e-28
 Identities = 67/143 (46%), Positives = 87/143 (60%), Gaps = 7/143 (4%)
 Frame = -3

Query: 703 EKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYAN 524
           +  YELPDG  ITI NE+FRC E LF+P +  +E  GIHE  YNS+ KCD  ++  LY N
Sbjct: 239 DTKYELPDGDFITIKNEKFRCSELLFKP-YQEVEV-GIHELVYNSLKKCDPSLQLYLYLN 296

Query: 523 TVLSGGTTMYPGIADRMQKEITALAPSTMKIK-------IIAPPERKYSVWIGGSILASL 365
            +LSGG T+  G   R+QKE+ ++ P ++K K       I    E  +  W GG ILASL
Sbjct: 297 IILSGGNTLLKGFRQRLQKELKSMPPESIKPKSLLRYFDIEDTSEHNFISWKGGEILASL 356

Query: 364 STFQQMWISKQEYDESGPSIVHR 296
            +F      ++EYDE GPSIVHR
Sbjct: 357 DSFLFTCFERKEYDEQGPSIVHR 379


>UniRef50_UPI0000D9A391 Cluster: PREDICTED: actin related protein M1
           isoform 1; n=1; Macaca mulatta|Rep: PREDICTED: actin
           related protein M1 isoform 1 - Macaca mulatta
          Length = 319

 Score =  127 bits (307), Expect = 2e-28
 Identities = 52/96 (54%), Positives = 74/96 (77%)
 Frame = -3

Query: 574 NSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSV 395
           +SIMKCD  +R   ++N +L+GG+T +PG+  R+ K+I  +AP+   +++IAPPERK SV
Sbjct: 224 SSIMKCDTGLRNSFFSNIILAGGSTSFPGLDKRLVKDIAKMAPANTAVQVIAPPERKISV 283

Query: 394 WIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 287
           W+GGSILASLS FQ MWI+  E+ E GP+IVH++CF
Sbjct: 284 WMGGSILASLSAFQDMWITAAEFKEVGPNIVHQRCF 319


>UniRef50_Q8IS27 Cluster: Actin-related protein 2; n=5;
           Oligohymenophorea|Rep: Actin-related protein 2 -
           Tetrahymena thermophila
          Length = 393

 Score =  127 bits (307), Expect = 2e-28
 Identities = 60/143 (41%), Positives = 89/143 (62%), Gaps = 12/143 (8%)
 Frame = -3

Query: 706 LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYA 527
           LE+ Y+LPD   I +G ERF   E +F P+F G    G+    +++I  CDVD+RKD+Y 
Sbjct: 236 LEREYQLPDKSYIKLGRERFEAAELIFNPAFDGHAFNGVSHLVFDAIQACDVDLRKDMYR 295

Query: 526 NTVLSGGTTMYPGIADRMQKEITAL-----------APSTMKIKIIAPPERKYSVWIGGS 380
           N ++SGGTTM+PG   R+Q ++  L             + +KIK+I PP RKY+V+IGG 
Sbjct: 296 NILISGGTTMFPGFPTRLQNDVIRLYKTNILKERSYKDAKIKIKVIDPPMRKYNVFIGGG 355

Query: 379 ILA-SLSTFQQMWISKQEYDESG 314
           +LA ++    + W+SKQ+Y+E G
Sbjct: 356 VLAKNMQNIDKYWVSKQDYEELG 378


>UniRef50_A2EUM6 Cluster: Actin family protein; n=1; Trichomonas
           vaginalis G3|Rep: Actin family protein - Trichomonas
           vaginalis G3
          Length = 360

 Score =  127 bits (306), Expect = 3e-28
 Identities = 62/136 (45%), Positives = 85/136 (62%)
 Frame = -3

Query: 694 YELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYANTVL 515
           YELP G  +TIG+ERF  PE LF PS   ++A GI +    SI +CD  ++ DL  N V+
Sbjct: 226 YELPSGTRLTIGDERFLGPEVLFDPSLNSIDALGISKALEVSIGRCDEFLKTDLLQNVVI 285

Query: 514 SGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISK 335
           SGG+TM+PGIADR+Q+++T        + IIA PERK+  W+GGSI A+   F+Q  I K
Sbjct: 286 SGGSTMFPGIADRIQEDLTGSLKKA--VNIIAAPERKHGAWVGGSIFATTPVFEQFQIKK 343

Query: 334 QEYDESGPSIVHRKCF 287
            E++     I  +K F
Sbjct: 344 AEWETQKEFIFRQKSF 359


>UniRef50_P61160 Cluster: Actin-related protein 2; n=96;
           Eukaryota|Rep: Actin-related protein 2 - Homo sapiens
           (Human)
          Length = 394

 Score =  126 bits (305), Expect = 4e-28
 Identities = 60/149 (40%), Positives = 91/149 (61%), Gaps = 12/149 (8%)
 Frame = -3

Query: 706 LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYA 527
           L +SY LPDG++I +G ERF  PEALFQP  + +E  G+ E  +N+I   D+D R + Y 
Sbjct: 240 LVESYTLPDGRIIKVGGERFEAPEALFQPHLINVEGVGVAELLFNTIQAADIDTRSEFYK 299

Query: 526 NTVLSGGTTMYPGIADRMQKEITAL-----------APSTMKIKIIAPPERKYSVWIGGS 380
           + VLSGG+TMYPG+  R+++E+  L             S  KI+I  PP RK+ V++GG+
Sbjct: 300 HIVLSGGSTMYPGLPSRLERELKQLYLERVLKGDVEKLSKFKIRIEDPPRRKHMVFLGGA 359

Query: 379 ILAS-LSTFQQMWISKQEYDESGPSIVHR 296
           +LA  +      W+++QEY E G  ++ +
Sbjct: 360 VLADIMKDKDNFWMTRQEYQEKGVRVLEK 388


>UniRef50_Q4SGD5 Cluster: Chromosome 17 SCAF14597, whole genome
           shotgun sequence; n=1; Tetraodon nigroviridis|Rep:
           Chromosome 17 SCAF14597, whole genome shotgun sequence -
           Tetraodon nigroviridis (Green puffer)
          Length = 425

 Score =  126 bits (303), Expect = 7e-28
 Identities = 60/149 (40%), Positives = 91/149 (61%), Gaps = 12/149 (8%)
 Frame = -3

Query: 706 LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYA 527
           L +SY LPDG+VI +G ERF  PEALFQP  + +E  G+ E  +N+I   D+D R + Y 
Sbjct: 271 LVESYTLPDGRVIKVGGERFEAPEALFQPHLINVEGVGVAELLFNTIQAADIDTRPEFYK 330

Query: 526 NTVLSGGTTMYPGIADRMQKEITAL-----------APSTMKIKIIAPPERKYSVWIGGS 380
           + VLSGG+TMYPG+  R+++E+  L             S  KI+I  PP RK+ V++GG+
Sbjct: 331 HIVLSGGSTMYPGLPSRLERELKQLYLERVLKGDVDKLSKFKIRIEDPPRRKHMVFLGGA 390

Query: 379 ILAS-LSTFQQMWISKQEYDESGPSIVHR 296
           +LA  +      W++++EY E G  ++ +
Sbjct: 391 VLADIMKDKDNFWLTREEYQEKGVRVLEK 419


>UniRef50_Q3M0X0 Cluster: Actin6-2; n=3; Paramecium tetraurelia|Rep:
           Actin6-2 - Paramecium tetraurelia
          Length = 394

 Score =  125 bits (302), Expect = 1e-27
 Identities = 62/146 (42%), Positives = 93/146 (63%), Gaps = 7/146 (4%)
 Frame = -3

Query: 703 EKSYELPDGQVITIGNE-RFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYA 527
           E+SYELPD QVI I  + R+ C EALF  + +   +  + +   NSI +CD ++R++L A
Sbjct: 249 ERSYELPDEQVIQITPQIRYHCSEALFNSAIINKNSSSLPQMIVNSIQRCDKELRQELLA 308

Query: 526 NTVLSGGTTMYPGIADRMQKEITALAPS---TMKIKIIAPPERKYSVWIGGSILASLSTF 356
           N VL GGT+M+ G+  R+Q +I  + P      +   +A  +RKYS WIGGS+L SL TF
Sbjct: 309 NMVLGGGTSMFQGLISRLQDDICQIYPGGAMRSEFNFVADFQRKYSAWIGGSMLGSLKTF 368

Query: 355 QQMWISKQEYDESGP---SIVHRKCF 287
           Q + I+KQEY+E+     S++H++ F
Sbjct: 369 QSLAINKQEYEENPEGKMSLIHKRTF 394


>UniRef50_Q23FF9 Cluster: Actin family protein; n=2; Tetrahymena
           thermophila|Rep: Actin family protein - Tetrahymena
           thermophila SB210
          Length = 426

 Score =  125 bits (301), Expect = 1e-27
 Identities = 61/146 (41%), Positives = 95/146 (65%), Gaps = 7/146 (4%)
 Frame = -3

Query: 703 EKSYELPDGQVITIGN-ERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYA 527
           EKSYELPDG ++ I N +R++  E +F PS +G ++  I E   +++ +CDV+ +++LY 
Sbjct: 281 EKSYELPDGSILEINNSQRYKPTEIIFNPSIIGDDSMSIPEMMIDTLHRCDVEFQEELYR 340

Query: 526 NTVLSGGTTMYPGIADRMQKEITALAPSTMK---IKIIAPPERKYSVWIGGSILASLSTF 356
           N VL GG++++ G   R++KE+     +T+    I  +    R+YS WIGGS+L SLSTF
Sbjct: 341 NIVLCGGSSLFKGFLPRIEKELLNEVTNTINRKDINFVQNTHRRYSAWIGGSMLGSLSTF 400

Query: 355 QQMWISKQEYD---ESGPSIVHRKCF 287
           Q + I+K EY+   ES  SI+H+K F
Sbjct: 401 QNLAITKNEYEENPESKMSIIHKKTF 426


>UniRef50_UPI0000F2DE11 Cluster: PREDICTED: similar to
           testis-specific actin-related protein 3; n=1;
           Monodelphis domestica|Rep: PREDICTED: similar to
           testis-specific actin-related protein 3 - Monodelphis
           domestica
          Length = 939

 Score =  123 bits (297), Expect = 4e-27
 Identities = 55/136 (40%), Positives = 87/136 (63%)
 Frame = -3

Query: 694 YELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYANTVL 515
           + LPD  ++++G ERFRCPEALF+P  LG+    + E    SI + +  ++  L AN VL
Sbjct: 328 FVLPDKHILSLGAERFRCPEALFKPDVLGLNQPSLPELAQISISQLEPHLQDQLLANVVL 387

Query: 514 SGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISK 335
            GGTT+  G ++R+Q+E+ + A       +++ P R  + W+GGSI+ASL +FQ +W+S+
Sbjct: 388 EGGTTLLNGFSERVQQELGSTA------NVLSLPHRAMAAWLGGSIMASLDSFQTLWLSR 441

Query: 334 QEYDESGPSIVHRKCF 287
            EY E GP  ++ +CF
Sbjct: 442 GEYQEEGPWAIYNRCF 457


>UniRef50_Q5CKL2 Cluster: BRG1/brm-associated factor 53A; n=2;
           Cryptosporidium|Rep: BRG1/brm-associated factor 53A -
           Cryptosporidium hominis
          Length = 423

 Score =  122 bits (295), Expect = 7e-27
 Identities = 67/152 (44%), Positives = 91/152 (59%), Gaps = 16/152 (10%)
 Frame = -3

Query: 697 SYELPDGQVITIGNERFRCPEALFQPSFLGMEA----------CGIHETTYNSIMKCDVD 548
           +YELPDG +I       R PE L  P  +  ++           G+     N+I+ CD+D
Sbjct: 270 TYELPDGTLIDSEPIGIRVPECLLNPEMIINDSEFPPVNTNGFPGLCSAISNTIIACDID 329

Query: 547 IRKDLYANTVLSGGTTMYPGIADRMQKEITA---LAPSTMKIKIIAPP---ERKYSVWIG 386
           IRKDL    +L+GGT++ PG+ADR+ K +     L+    K+KII+P    ER++S WIG
Sbjct: 330 IRKDLIGAVILTGGTSIIPGLADRVSKSLAEDDKLSGGGPKLKIISPNSTVERRFSSWIG 389

Query: 385 GSILASLSTFQQMWISKQEYDESGPSIVHRKC 290
           GSILASL +FQQMW SK+EY E G  +V RKC
Sbjct: 390 GSILASLGSFQQMWFSKEEYTEHGAKLVERKC 421


>UniRef50_UPI00005A3B5D Cluster: PREDICTED: similar to Actin-5C; n=3;
            Laurasiatheria|Rep: PREDICTED: similar to Actin-5C -
            Canis familiaris
          Length = 1248

 Score =  120 bits (290), Expect = 3e-26
 Identities = 56/133 (42%), Positives = 87/133 (65%)
 Frame = -3

Query: 694  YELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYANTVL 515
            + LPD QVIT+G+ERF CPEALFQPS LG+   G+ +    SI + +   ++ L AN VL
Sbjct: 1119 FVLPDKQVITLGSERFCCPEALFQPSLLGLNQPGLPQLALLSISRLEAKQQEQLLANVVL 1178

Query: 514  SGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISK 335
             GG+T+  G  +R+++E   L P   +  ++  P R  + W+GGSI+AS  +FQ +W+S+
Sbjct: 1179 DGGSTLINGFPERLRQE---LGP---QATVLGSPHRAVAAWLGGSIMASRDSFQSLWLSR 1232

Query: 334  QEYDESGPSIVHR 296
            +EY+E GP  +++
Sbjct: 1233 REYEEEGPWAIYK 1245


>UniRef50_Q9N4N4 Cluster: Putative uncharacterized protein; n=2;
           Caenorhabditis|Rep: Putative uncharacterized protein -
           Caenorhabditis elegans
          Length = 436

 Score =  120 bits (290), Expect = 3e-26
 Identities = 60/143 (41%), Positives = 81/143 (56%), Gaps = 8/143 (5%)
 Frame = -3

Query: 694 YELPDGQVITIGNERFRCPEALFQPSFLGMEA-----CGIHETTYNSIMKCDVDIRKDLY 530
           Y  P+G     G ER + PE LF   +L  E        + +    S    D+DIR  L+
Sbjct: 293 YAFPNGYTKEFGAERIKLPECLFDLGYLKAEGKKDGLMTVAQMAAASANLADIDIRPTLF 352

Query: 529 ANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPP---ERKYSVWIGGSILASLST 359
           +N  ++GG ++  G  +R+   +    P T+K+++ A P   ERKY  WIGGSIL SL T
Sbjct: 353 SNVTVTGGNSLILGFTERLNYALATKCPPTIKLRVFAAPTQAERKYGAWIGGSILGSLGT 412

Query: 358 FQQMWISKQEYDESGPSIVHRKC 290
           FQQMW+SK EYDESG SIV +KC
Sbjct: 413 FQQMWVSKAEYDESGKSIVEKKC 435


>UniRef50_A2YUL5 Cluster: Putative uncharacterized protein; n=1;
           Oryza sativa (indica cultivar-group)|Rep: Putative
           uncharacterized protein - Oryza sativa subsp. indica
           (Rice)
          Length = 367

 Score =  120 bits (289), Expect = 4e-26
 Identities = 62/151 (41%), Positives = 94/151 (62%), Gaps = 12/151 (7%)
 Frame = -3

Query: 706 LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYA 527
           L KSY LPDG+VI +G ERF+ PEALF P  + +E  G+ +  +  I + D+D R  LY 
Sbjct: 215 LVKSYTLPDGRVIKVGTERFQAPEALFTPELIDVEGDGMADMAFRCIQEMDIDNRMTLYQ 274

Query: 526 NTVLSGGTTMYPGIADRMQKEI------TALAPS-----TMKIKIIAPPERKYSVWIGGS 380
           + VLSGG+TMYPG+  R++KE+        L  +      ++++I  PP RK+ V++GG+
Sbjct: 275 HIVLSGGSTMYPGLPSRLEKEMLDRYLDVVLKGNKDGLKKLRLRIEDPPRRKHMVYLGGA 334

Query: 379 ILAS-LSTFQQMWISKQEYDESGPSIVHRKC 290
           +LA  +    + WI++QEY E G + + RKC
Sbjct: 335 VLAGIMKDAPEFWITRQEYQEEGLACL-RKC 364


>UniRef50_Q2GY63 Cluster: Putative uncharacterized protein; n=1;
           Chaetomium globosum|Rep: Putative uncharacterized
           protein - Chaetomium globosum (Soil fungus)
          Length = 350

 Score =  120 bits (289), Expect = 4e-26
 Identities = 55/107 (51%), Positives = 76/107 (71%)
 Frame = -3

Query: 613 LGMEACGIHETTYNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMK 434
           +G+E  G+H+   +SI + D+D+RKDLYAN VLSGG+T+  G  DR+  E+  ++   M+
Sbjct: 243 IGLEYPGVHQIVVDSISRTDMDLRKDLYANIVLSGGSTVTKGFGDRLLAEVKGISVREMR 302

Query: 433 IKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRK 293
           IKI APPERKYS WIGGSILA LSTF +M I   ++ E  P+I+H +
Sbjct: 303 IKIYAPPERKYSTWIGGSILAQLSTFSKMTIKVDDWHED-PNIIHTR 348


>UniRef50_Q14BL3 Cluster: RIKEN cDNA 4921517D21 gene; n=7;
            Eutheria|Rep: RIKEN cDNA 4921517D21 gene - Mus musculus
            (Mouse)
          Length = 1207

 Score =  118 bits (284), Expect = 1e-25
 Identities = 55/137 (40%), Positives = 87/137 (63%)
 Frame = -3

Query: 706  LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYA 527
            ++  + LPD  VIT+G+ERF CPEALFQP+ LG+   G+ +    SI + +V  ++ L A
Sbjct: 1074 VQVDFVLPDKHVITLGSERFCCPEALFQPNLLGLNQLGLPQLALLSINRLEVKQQEQLLA 1133

Query: 526  NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 347
            N VL GG+T+  G  +RM++E   L P      ++  P R  + W+GGSI+A   +FQ +
Sbjct: 1134 NVVLEGGSTLINGFPERMRQE---LGPGA---TVLGSPHRAVAAWLGGSIMACRDSFQSL 1187

Query: 346  WISKQEYDESGPSIVHR 296
            W++++EY+E GP  V++
Sbjct: 1188 WLTRREYEEEGPWAVYK 1204


>UniRef50_Q10CH7 Cluster: Actin-related protein 7, putative,
           expressed; n=5; Oryza sativa|Rep: Actin-related protein
           7, putative, expressed - Oryza sativa subsp. japonica
           (Rice)
          Length = 398

 Score =  118 bits (284), Expect = 1e-25
 Identities = 62/142 (43%), Positives = 83/142 (58%), Gaps = 6/142 (4%)
 Frame = -3

Query: 694 YELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYANTVL 515
           + LPDGQVITI  ER+   EALFQP  LG+E  GI      S+     +  + L  NT+L
Sbjct: 258 HTLPDGQVITIEKERYIVGEALFQPHILGLEDYGIVHQLVTSVSNVTPEYHRQLLENTML 317

Query: 514 SGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPE------RKYSVWIGGSILASLSTFQ 353
            GGT    G  DR Q+E   L+ S +   ++ PPE       +YS W+GG+ILA +   Q
Sbjct: 318 CGGTASMTGFEDRFQREAN-LSASAICPSLVKPPEYMPENLARYSAWLGGAILAKVVFPQ 376

Query: 352 QMWISKQEYDESGPSIVHRKCF 287
              ++K +YDE+GPSIVH+KCF
Sbjct: 377 NQHVTKGDYDETGPSIVHKKCF 398


>UniRef50_Q22WQ4 Cluster: Actin family protein; n=1; Tetrahymena
           thermophila SB210|Rep: Actin family protein -
           Tetrahymena thermophila SB210
          Length = 444

 Score =  118 bits (284), Expect = 1e-25
 Identities = 64/157 (40%), Positives = 90/157 (57%), Gaps = 18/157 (11%)
 Frame = -3

Query: 706 LEKS-YELPDGQVITIGNERFRCPEALFQP--------------SFLGMEACGIHETTYN 572
           LE++ YELPDG  +     R +  E  F P                LG    G+H     
Sbjct: 289 LERAGYELPDGNFVEFDTARSKYSEFFFAPYETLQQQQENEISQDLLGFR--GMHHMVLE 346

Query: 571 SIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPP---ERKY 401
           SI  CD+DI++ L+ N +L+GG ++  G + R+Q ++  ++P   KIK+IA P   ERK+
Sbjct: 347 SINYCDIDIKRQLFNNIILTGGNSLLSGFSSRLQTKLNEISPPNSKIKMIAYPATTERKF 406

Query: 400 SVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKC 290
           S WIGGSILASL +FQ +WI KQEY ++G  IV +KC
Sbjct: 407 SSWIGGSILASLGSFQSLWIGKQEYQDNGEYIVEKKC 443


>UniRef50_Q19R57 Cluster: Actin-like protein 1; n=2; Trypanosoma
           cruzi|Rep: Actin-like protein 1 - Trypanosoma cruzi
           strain CL Brener
          Length = 390

 Score =  118 bits (284), Expect = 1e-25
 Identities = 57/140 (40%), Positives = 80/140 (57%), Gaps = 1/140 (0%)
 Frame = -3

Query: 715 GPPLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKD 536
           G    + + LPDGQ I +G E FR PE LF P     E   + E    ++  C +DIRKD
Sbjct: 231 GDEKRRLFSLPDGQEIYVGKEAFRAPEILFSPFITFSENPSMSEFVVKAVKSCGIDIRKD 290

Query: 535 LYANTVLSGGTTMYPGIADRMQKEITALAPSTM-KIKIIAPPERKYSVWIGGSILASLST 359
           L ++ +LSGG T++ G A R+  E+    P      K+I   +R+YSVW G S+LA LST
Sbjct: 291 LLSSIILSGGNTLFDGFASRLAGEVLKEFPGLFGSAKVIDAVDRQYSVWSGASVLAGLST 350

Query: 358 FQQMWISKQEYDESGPSIVH 299
           F    +++  ++E GPSIVH
Sbjct: 351 FSDHLLTRDIFEEHGPSIVH 370


>UniRef50_Q29173 Cluster: Cytoplasmic beta-actin; n=1; Sus
           scrofa|Rep: Cytoplasmic beta-actin - Sus scrofa (Pig)
          Length = 115

 Score =  117 bits (281), Expect = 3e-25
 Identities = 50/83 (60%), Positives = 65/83 (78%)
 Frame = -2

Query: 707 PREVLRTSRRSGHHYRKRKIPLPRGSLPTLVLGYGSLRHPRDHI*LHHEVRRGHP*GLVR 528
           P E LR +RR GHH+R+R +PLPRG+LP L+ G+G LRHPR+++ LHHEVRR HP G +R
Sbjct: 31  PGEELRAARRPGHHHRQRALPLPRGALPALLPGHGILRHPRNYLQLHHEVRRRHPQGPLR 90

Query: 527 QHRIVRWYHHVPWNRRPYAKGNH 459
           QH  V W+HHVP +RR  A+G+H
Sbjct: 91  QHGAVGWHHHVPRHRRQDAEGDH 113


>UniRef50_A2FH22 Cluster: Actin family protein; n=1; Trichomonas
           vaginalis G3|Rep: Actin family protein - Trichomonas
           vaginalis G3
          Length = 390

 Score =  116 bits (280), Expect = 4e-25
 Identities = 52/139 (37%), Positives = 92/139 (66%), Gaps = 12/139 (8%)
 Frame = -3

Query: 694 YELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYANTVL 515
           Y+L DG+++ +  ERF  PE LFQP  +G+E  G+ +  +++IMK D+++R++L+ + V+
Sbjct: 240 YKLNDGRIVKVSGERFEAPEILFQPDLIGLECKGLSDLLFDTIMKADINLRRNLFESIVV 299

Query: 514 SGGTTMYPGIADRMQKEI-----------TALAPSTMKIKIIAPPERKYSVWIGGSILAS 368
           SGGTTM+PG+++R+Q ++            + +  + KI +  PP R+Y V++G +ILA+
Sbjct: 300 SGGTTMFPGLSERLQNDLKKSVLTKVLGGNSKSLESYKINVEDPPNRRYLVYLGATILAN 359

Query: 367 LS-TFQQMWISKQEYDESG 314
           L+    Q W +KQ+Y+E G
Sbjct: 360 LTENKSQQWATKQDYNEIG 378


>UniRef50_Q4DMP2 Cluster: Actin-related protein 2, putative; n=4;
           Trypanosoma|Rep: Actin-related protein 2, putative -
           Trypanosoma cruzi
          Length = 403

 Score =  116 bits (278), Expect = 8e-25
 Identities = 58/150 (38%), Positives = 92/150 (61%), Gaps = 12/150 (8%)
 Frame = -3

Query: 706 LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYA 527
           LE+++ LPDG   +IG ERF   EALFQP  + +E  G+    +N I   ++D+R  LY+
Sbjct: 251 LEQTFLLPDGSSCSIGQERFEATEALFQPHLIDVECDGLSTQLWNCIQAAEIDVRAQLYS 310

Query: 526 NTVLSGGTTMYPGIADRMQKEITAL-----------APSTMKIKIIAPPERKYSVWIGGS 380
           + VLSGG+TM+PG+  R++K++ A+                K++I  PP RKY V++GG+
Sbjct: 311 HVVLSGGSTMFPGLPSRIEKDMRAMFLEKALKGDRSRLGHFKLQIEDPPRRKYMVFLGGA 370

Query: 379 ILASLSTFQ-QMWISKQEYDESGPSIVHRK 293
            LA+L+  Q +MW+++ E+ E G S V  +
Sbjct: 371 TLAALTVDQPEMWLTQAEWQEGGVSAVRAR 400


>UniRef50_Q09849 Cluster: Uncharacterized protein C23D3.09; n=1;
           Schizosaccharomyces pombe|Rep: Uncharacterized protein
           C23D3.09 - Schizosaccharomyces pombe (Fission yeast)
          Length = 430

 Score =  116 bits (278), Expect = 8e-25
 Identities = 60/140 (42%), Positives = 80/140 (57%), Gaps = 11/140 (7%)
 Frame = -3

Query: 700 KSYELPDGQVITIGNERFRCPEALFQPSFLGMEAC---------GIHETTYNSIMKCDVD 548
           K +E PDG     G ERFR  E LF PSF    +          G+HE  Y SI+ CD +
Sbjct: 279 KPFEFPDGVTHKFGQERFRISEILFNPSFSASRSAETTPPQGSVGLHELVYQSILACDSE 338

Query: 547 IRKDLYANTVLSGGTTMYPGIADRMQKEITALAP-STMKIKII-APPERKYSVWIGGSIL 374
           +R  L  N V++GGT++ PG+++R+Q E+  LA  S + +           +VW GGSIL
Sbjct: 339 LRSPLLNNIVVTGGTSLIPGLSERLQAEVQRLATGSRINVHTAETASATSNAVWFGGSIL 398

Query: 373 ASLSTFQQMWISKQEYDESG 314
           ASL  FQ +W+SKQEYDE G
Sbjct: 399 ASLDNFQHLWVSKQEYDEVG 418


>UniRef50_Q8ILM5 Cluster: Actin, putative; n=1; Plasmodium
           falciparum 3D7|Rep: Actin, putative - Plasmodium
           falciparum (isolate 3D7)
          Length = 522

 Score =  115 bits (276), Expect = 1e-24
 Identities = 62/146 (42%), Positives = 92/146 (63%), Gaps = 7/146 (4%)
 Frame = -3

Query: 703 EKSYELPDGQVITIGNERFRCPEALFQ--PSFLGMEACGIHETTYNSIMKCDVDIRKDLY 530
           E+ +ELPDG  I I   ++   E LF   PS    +  G+ ++  N I+  DVDIRK+L 
Sbjct: 379 EEFFELPDGYKINIHKYKYDIAEHLFHSIPSLNNFK--GLPQSIINCIISTDVDIRKELL 436

Query: 529 ANTVLSGGTTMYPGIADRMQKEITALAPSTM--KIKII---APPERKYSVWIGGSILASL 365
            + V++GG++++PG+ +R+   +      T   K KI+   +  E+KYS W+GGSILASL
Sbjct: 437 QSIVITGGSSLFPGLIERLHNSLKEKECFTQSNKFKILNMTSLVEQKYSSWLGGSILASL 496

Query: 364 STFQQMWISKQEYDESGPSIVHRKCF 287
            TFQQMW+SK+EY ESG +I+  +CF
Sbjct: 497 GTFQQMWVSKKEYHESGHNIILDRCF 522


>UniRef50_A7RTR2 Cluster: Predicted protein; n=1; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 202

 Score =  114 bits (275), Expect = 2e-24
 Identities = 49/134 (36%), Positives = 85/134 (63%), Gaps = 1/134 (0%)
 Frame = -3

Query: 694 YELPDGQV-ITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYANTV 518
           Y LPDG + +++   R+RC E LF+P   G +  GIHE  Y +I  C +DIRK +  +  
Sbjct: 65  YNLPDGTIKVSLDTARYRCTEGLFEPRHWGKDHLGIHELVYKAIQACAMDIRKQMGRSIY 124

Query: 517 LSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWIS 338
           LSGG +M PG A+R+Q E++++ P +   ++ A  +R ++ +IG S++A L  F Q+ +S
Sbjct: 125 LSGGGSMIPGFAERLQFEVSSMLPQSSHAQVHAGTDRHHAAFIGASVVARLPIFDQLCVS 184

Query: 337 KQEYDESGPSIVHR 296
           ++E+++ GP  + +
Sbjct: 185 QEEWEQVGPDALEK 198


>UniRef50_Q5KB93 Cluster: Actin binding protein, putative; n=3;
           Filobasidiella neoformans|Rep: Actin binding protein,
           putative - Cryptococcus neoformans (Filobasidiella
           neoformans)
          Length = 390

 Score =  114 bits (275), Expect = 2e-24
 Identities = 55/141 (39%), Positives = 90/141 (63%), Gaps = 12/141 (8%)
 Frame = -3

Query: 700 KSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYANT 521
           ++Y LPDG+VI +G+ER+  PE +FQP  + +E  G+ E  +N+I +  VD R +LY + 
Sbjct: 239 ENYTLPDGRVIKVGSERYEAPECMFQPHLVDVEQPGVAELLFNTIQQAAVDTRTELYKHI 298

Query: 520 VLSGGTTMYPGIADRMQKEITALAPSTM-----------KIKIIAPPERKYSVWIGGSIL 374
           VLSGG++MYPG   R++KE+  L  + +           KI+I  PP RK+ V++GG++L
Sbjct: 299 VLSGGSSMYPGFPSRLEKEMKQLYLTRVLGNDTSRLKHFKIRIEDPPRRKHMVFLGGAVL 358

Query: 373 ASLSTFQQ-MWISKQEYDESG 314
           A +   +   W++K+E++E G
Sbjct: 359 ADIMKDKDAFWVTKEEWEEQG 379


>UniRef50_Q54UQ7 Cluster: Actin-like protein 6A; n=1; Dictyostelium
           discoideum AX4|Rep: Actin-like protein 6A -
           Dictyostelium discoideum AX4
          Length = 440

 Score =  111 bits (268), Expect = 1e-23
 Identities = 60/159 (37%), Positives = 92/159 (57%), Gaps = 24/159 (15%)
 Frame = -3

Query: 694 YELPDGQVITIGNERFRCPEALFQPSFLGMEAC------------------------GIH 587
           YELPDG ++ IG++RF+ PE LF P+ L  +                          G+ 
Sbjct: 282 YELPDGNLLEIGSDRFQIPELLFNPTPLNEQILNNNNNNSNGENTTTSSVVQQPQYQGLG 341

Query: 586 ETTYNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPER 407
                S+ K D DIRK+L +N +++GG T++ G  +R+ ++I+ ++ +  KI +    E+
Sbjct: 342 RMIIESLEKSDTDIRKELISNLIITGGNTLFAGFQERLVRDISEISYNKPKI-VANQTEK 400

Query: 406 KYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKC 290
           K SVWIGGS+L SL TFQQMW+SK E++E G  +V +KC
Sbjct: 401 KNSVWIGGSVLGSLGTFQQMWMSKSEWEEFGRPLVEKKC 439


>UniRef50_UPI0000D56C2F Cluster: PREDICTED: similar to Actin-57B;
           n=1; Tribolium castaneum|Rep: PREDICTED: similar to
           Actin-57B - Tribolium castaneum
          Length = 291

 Score =  111 bits (267), Expect = 2e-23
 Identities = 55/144 (38%), Positives = 90/144 (62%), Gaps = 5/144 (3%)
 Frame = -3

Query: 703 EKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYAN 524
           E+ + LPDG  IT+GNE++  PE L++ S   +E   +HE  ++++ + D ++R  L + 
Sbjct: 151 EEEFLLPDGSKITLGNEKYLIPEELYKSS---IEYSPLHEFIFHALGRSDPELRPLLASK 207

Query: 523 TVLSGGTTMYPGIADRMQKEITALAP-----STMKIKIIAPPERKYSVWIGGSILASLST 359
            VL+GGTT+ PG  +R+++E+   AP     S    ++++   R  S W+GG+IL  L+T
Sbjct: 208 LVLAGGTTLLPGFGERLERELVNGAPQFKFMSGRTPRVVSQANRGDSAWLGGAILGQLAT 267

Query: 358 FQQMWISKQEYDESGPSIVHRKCF 287
           F  M +S+ EY+E GPS+VH K F
Sbjct: 268 FPNMCMSRDEYEEYGPSLVHTKIF 291


>UniRef50_Q5KLG9 Cluster: 53 kDa brg1-associated factor b
           (Actin-related protein baf53b), putative; n=1;
           Filobasidiella neoformans|Rep: 53 kDa brg1-associated
           factor b (Actin-related protein baf53b), putative -
           Cryptococcus neoformans (Filobasidiella neoformans)
          Length = 476

 Score =  111 bits (267), Expect = 2e-23
 Identities = 65/160 (40%), Positives = 88/160 (55%), Gaps = 25/160 (15%)
 Frame = -3

Query: 694 YELPDGQVITIGNERFRCPEALFQPS---------------FLGME-------ACGIHET 581
           YE PDG     G ER+R  E LF P                 L  E          + + 
Sbjct: 317 YEFPDGYHQYFGEERYRFTEMLFDPERYYNQSIPPPPTLQKVLTTEHSRSLRDLVSLSQL 376

Query: 580 TYNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPP---E 410
            ++S+M CDVD+R  L  N V+ G T +  G+ +R+  E+ A  PS  KIKI +P    E
Sbjct: 377 VHDSVMACDVDVRASLLQNIVVVGNTALTRGLIERLDVELAATMPS-QKIKIHSPTIPFE 435

Query: 409 RKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKC 290
           RKY+ W+GGSILASL TF Q+W++K+EY+E G SIVH++C
Sbjct: 436 RKYASWVGGSILASLGTFHQLWVTKEEYEEHGMSIVHQRC 475


>UniRef50_A5K109 Cluster: Actin, putative; n=4; Plasmodium|Rep:
           Actin, putative - Plasmodium vivax
          Length = 493

 Score =  111 bits (266), Expect = 2e-23
 Identities = 57/144 (39%), Positives = 87/144 (60%), Gaps = 5/144 (3%)
 Frame = -3

Query: 703 EKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYAN 524
           E+ +ELPDG  I     R+   E LF+         G+ E   N I+  DVDIRK+L   
Sbjct: 350 EEFFELPDGVKIKTDKYRYDIAEELFRAVPSAHNFNGLPEAIVNCIISSDVDIRKELLQA 409

Query: 523 TVLSGGTTMYPGIADRMQKEITALA--PSTMKIKII---APPERKYSVWIGGSILASLST 359
            +++GG++++PG+ DR+   +        ++K+KI+   +  E  YS W+GGSILASL T
Sbjct: 410 IIVTGGSSLFPGLVDRLYNSLREKECFSQSIKMKILNMTSSVECLYSSWLGGSILASLGT 469

Query: 358 FQQMWISKQEYDESGPSIVHRKCF 287
           FQQ+W+S+ EYD++G +IV  +CF
Sbjct: 470 FQQLWVSRAEYDDAGHAIVSDRCF 493


>UniRef50_Q9SRK2 Cluster: Putative actin; n=1; Arabidopsis
           thaliana|Rep: Putative actin - Arabidopsis thaliana
           (Mouse-ear cress)
          Length = 378

 Score =  110 bits (265), Expect = 3e-23
 Identities = 53/140 (37%), Positives = 83/140 (59%)
 Frame = -3

Query: 706 LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYA 527
           ++ +Y LPDG+ I + NERF  PE LFQP+ LGM   G+ E    +I  C   ++  LY 
Sbjct: 239 IKSTYVLPDGE-IDLTNERFLVPETLFQPADLGMNQAGLAECIVRAINSCHSYLQPVLYQ 297

Query: 526 NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 347
           + +L+GG+T++P + +R++ E+  L P    +KI    +    VW GGS+LAS   F+ M
Sbjct: 298 SIILTGGSTLFPQLKERLEGELRPLVPDHFDVKITTQEDPILGVWRGGSLLASSPDFESM 357

Query: 346 WISKQEYDESGPSIVHRKCF 287
            ++K EY+E G +   R+ F
Sbjct: 358 CVTKAEYEELGSARCRRRFF 377


>UniRef50_Q19R56 Cluster: Actin-like protein 3; n=4; Trypanosoma
           cruzi|Rep: Actin-like protein 3 - Trypanosoma cruzi
           strain CL Brener
          Length = 426

 Score =  110 bits (265), Expect = 3e-23
 Identities = 50/137 (36%), Positives = 80/137 (58%), Gaps = 1/137 (0%)
 Frame = -3

Query: 700 KSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYANT 521
           K + LPDG  +T+G E  + PE LF P+ LG E  G+     N++   D+++R +L  + 
Sbjct: 287 KKHRLPDGTELTLGYELLQAPEVLFNPALLGKEHPGLAGIVSNAVRVADIELRTELCEHI 346

Query: 520 VLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTF-QQMW 344
            L+GG+T+  G   R   E+  L P   +++I AP ER ++ W+G S+L  LSTF QQM 
Sbjct: 347 YLTGGSTLLSGFGQRFLSELLQLTPRNCRVRISAPAERSHTAWLGASLLTRLSTFPQQML 406

Query: 343 ISKQEYDESGPSIVHRK 293
           +S+ ++ E G   +H +
Sbjct: 407 VSRADFLEEGERALHNR 423


>UniRef50_Q0VHZ5 Cluster: Actin deviating protein; n=7;
           Eukaryota|Rep: Actin deviating protein - Bolivina sp.
           isolate 615
          Length = 360

 Score = 98.7 bits (235), Expect(2) = 8e-23
 Identities = 41/93 (44%), Positives = 63/93 (67%)
 Frame = -3

Query: 706 LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYA 527
           +E  YELPDG+ I +GNERFR PE LF P+ +G E  GIH   Y SIM+C + ++ +L+A
Sbjct: 214 VEVVYELPDGEKIIVGNERFRAPEILFNPTHVGNERLGIHHDIYKSIMQCPIGMKNELWA 273

Query: 526 NTVLSGGTTMYPGIADRMQKEITALAPSTMKIK 428
           N VLSGG T++   ++R+ KE+  +   ++ ++
Sbjct: 274 NIVLSGGNTLFGNFSERLSKELGMIDDKSISVQ 306



 Score = 31.5 bits (68), Expect(2) = 8e-23
 Identities = 12/21 (57%), Positives = 17/21 (80%)
 Frame = -3

Query: 442 TMKIKIIAPPERKYSVWIGGS 380
           T +  +IAP +RKY+VWIGG+
Sbjct: 340 TNQPNVIAPLDRKYNVWIGGT 360


>UniRef50_Q6BG23 Cluster: Actin, putative; n=1; Paramecium
           tetraurelia|Rep: Actin, putative - Paramecium
           tetraurelia
          Length = 328

 Score =  108 bits (260), Expect = 1e-22
 Identities = 51/138 (36%), Positives = 78/138 (56%), Gaps = 1/138 (0%)
 Frame = -3

Query: 697 SYELPDGQVITIGNERFRCPEALFQPSFLGMEAC-GIHETTYNSIMKCDVDIRKDLYANT 521
           SY+LPDG  + +  + F  PE +F P      +  G H+   NSI +CD D+R  L  +T
Sbjct: 191 SYDLPDGSHLKLDIQIFLAPEIMFNPKLYDNSSIFGFHQLALNSIGQCDSDLRIQLLKHT 250

Query: 520 VLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWI 341
           ++SGG ++  G ++R   E + +       ++      K+SVWIGG I+ +L+     WI
Sbjct: 251 MISGGNSLIRGFSERFHYEFSKINNYRYSQQLNFIKSEKFSVWIGGCIMTNLAQISSDWI 310

Query: 340 SKQEYDESGPSIVHRKCF 287
           S+ +YDE GP+IV RKCF
Sbjct: 311 SRNDYDEYGPNIVQRKCF 328


>UniRef50_A7AWQ4 Cluster: Actin, putative; n=1; Babesia bovis|Rep:
           Actin, putative - Babesia bovis
          Length = 405

 Score =  108 bits (260), Expect = 1e-22
 Identities = 59/144 (40%), Positives = 84/144 (58%), Gaps = 8/144 (5%)
 Frame = -3

Query: 697 SYELPDGQVITIGNERFRCPEALFQPSFLGMEAC----GIHETTYNSIMKCDVDIRKDLY 530
           SY+LPDG VI I  +    P+ LF P    +       GIH+   +S+   DVDIR++L 
Sbjct: 261 SYKLPDGDVIKIDEKICEVPKHLFAPETASVAEFNNFKGIHQMIADSMFDTDVDIRRELL 320

Query: 529 ANTVLSGGTTMYPGIADRMQKEIT-ALAPSTMKIKII---APPERKYSVWIGGSILASLS 362
           ++ V+ GG T+ PG  D + K ++  +     K KI+   +  E +YS W+G SILASL 
Sbjct: 321 SSIVVVGGVTLTPGFVDVLNKYVSEGIIGKCNKFKIVHSSSYSECRYSTWLGASILASLG 380

Query: 361 TFQQMWISKQEYDESGPSIVHRKC 290
            FQQ+WISK EY E G +I +R+C
Sbjct: 381 RFQQLWISKGEYREHGTTIAYRRC 404


>UniRef50_Q4P2E8 Cluster: Actin-related protein 4; n=1; Ustilago
           maydis|Rep: Actin-related protein 4 - Ustilago maydis
           (Smut fungus)
          Length = 534

 Score =  108 bits (259), Expect = 2e-22
 Identities = 54/110 (49%), Positives = 73/110 (66%), Gaps = 3/110 (2%)
 Frame = -3

Query: 610 GMEACGIHETTYNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKI 431
           G  A G+ +   +SI   DVD R  LY N VL GG+++  G++DR+  E+   AP+  KI
Sbjct: 425 GKAAIGLADMVLSSINAVDVDSRPSLYGNIVLVGGSSLIQGLSDRLSYELGVKAPN-QKI 483

Query: 430 KIIAP---PERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKC 290
           KI +P    ER++S W+G SILASL TF Q+WISKQEY+E G +IVH +C
Sbjct: 484 KIHSPGNTTERRHSSWLGASILASLGTFHQLWISKQEYEEHGAAIVHARC 533


>UniRef50_UPI0000EC9F4D Cluster: HSD21.; n=2; Gallus gallus|Rep:
           HSD21. - Gallus gallus
          Length = 373

 Score =  107 bits (258), Expect = 2e-22
 Identities = 49/134 (36%), Positives = 79/134 (58%)
 Frame = -3

Query: 688 LPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYANTVLSG 509
           LPDG  +T+  ERF+CPE LF P     E+  + ET + S+ +   ++   +  N +L G
Sbjct: 241 LPDGMTLTLSKERFQCPEVLFNPPSSWGESF-VSETVWKSLTQLPEEVIPTMCTNILLCG 299

Query: 508 GTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQE 329
           G++++ G+  R+ +E+      +  +++     ++++ W GGSILASL  FQ  WI + E
Sbjct: 300 GSSLFKGLETRLCQELAGHPLPSTTVEVGGSALQRHAAWTGGSILASLRNFQSCWIHRNE 359

Query: 328 YDESGPSIVHRKCF 287
           Y E GP IVH+KCF
Sbjct: 360 YYEVGPCIVHQKCF 373


>UniRef50_Q6FRF2 Cluster: Similar to sp|P38696 Saccharomyces
           cerevisiae YHR129c ACT5; n=1; Candida glabrata|Rep:
           Similar to sp|P38696 Saccharomyces cerevisiae YHR129c
           ACT5 - Candida glabrata (Yeast) (Torulopsis glabrata)
          Length = 387

 Score =  107 bits (257), Expect = 3e-22
 Identities = 51/125 (40%), Positives = 71/125 (56%)
 Frame = -3

Query: 694 YELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYANTVL 515
           Y LPDG +I IG+ERF  PE +F P   G     + +   NSI +  +  R  L  + VL
Sbjct: 249 YRLPDGNIIEIGSERFEAPEIIFNPQAYGYSEIPLQKMIINSISRAGILPRSQLLESIVL 308

Query: 514 SGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISK 335
           SGG+++  G  +R+ KEI        KI + AP ER++  WIGGS+L+ LST + +W SK
Sbjct: 309 SGGSSLIKGFGERLTKEIRKEIDGNQKIMLNAPHERRFLPWIGGSVLSGLSTMKLLWKSK 368

Query: 334 QEYDE 320
             Y E
Sbjct: 369 SAYRE 373


>UniRef50_Q6SQL6 Cluster: Actin; n=1; Pandalus platyceros|Rep: Actin
           - Pandalus platyceros
          Length = 179

 Score =  106 bits (254), Expect = 6e-22
 Identities = 46/69 (66%), Positives = 56/69 (81%)
 Frame = -3

Query: 628 FQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALA 449
           FQPSFLG+E+  +HE  +NSIM CD+DIRKDL AN V+SGGTTMY GIADR+QK+IT  A
Sbjct: 110 FQPSFLGIESASVHEIVHNSIMACDIDIRKDLLANVVMSGGTTMYDGIADRVQKDITGFA 169

Query: 448 PSTMKIKII 422
           P + K+ II
Sbjct: 170 PPSFKVNII 178


>UniRef50_UPI00006CBDF1 Cluster: Actin family protein; n=1;
           Tetrahymena thermophila SB210|Rep: Actin family protein
           - Tetrahymena thermophila SB210
          Length = 400

 Score =  104 bits (249), Expect = 3e-21
 Identities = 54/138 (39%), Positives = 84/138 (60%), Gaps = 4/138 (2%)
 Frame = -3

Query: 694 YELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYANTVL 515
           +ELPD Q + + NE F  PE LF P        G+ +    SI + D + R++L  N ++
Sbjct: 261 FELPDKQKLEVLNEMFEVPELLFNP-IPEENFMGLQDLIKQSIERVDSENRRELLNNIMV 319

Query: 514 SGGTTMYPGIADRMQKEITALAPSTM-KIKIIAPP---ERKYSVWIGGSILASLSTFQQM 347
            GG +M P + +R+Q+EIT L  +T  ++KI       ER +S W+GGSI+AS+STF  +
Sbjct: 320 VGGNSMIPNLIERLQREITQLEINTSGRVKIYTTQTINERAHSSWVGGSIVASMSTFDNL 379

Query: 346 WISKQEYDESGPSIVHRK 293
            ++K++YDE GP ++ RK
Sbjct: 380 LMTKRDYDEHGPILIERK 397


>UniRef50_A2DNQ0 Cluster: Actin family protein; n=1; Trichomonas
           vaginalis G3|Rep: Actin family protein - Trichomonas
           vaginalis G3
          Length = 358

 Score =  103 bits (248), Expect = 3e-21
 Identities = 47/139 (33%), Positives = 82/139 (58%)
 Frame = -3

Query: 703 EKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYAN 524
           EK +   DG  + IG  R++C E +F P+ LG++  G+ +   + +   D DI   L  N
Sbjct: 220 EKIFLTHDGIQLCIGRPRYQCTEVMFDPNLLGLQCQGVPKAIIDVLKVSDQDIVDVLADN 279

Query: 523 TVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMW 344
            +LSGG T      DR++K I     + +K+ + +PP R+++ W+GGSIL+ + TF+ + 
Sbjct: 280 VLLSGGNTCIQRFTDRVEKGILIHNSTQLKVNVNSPPNRRFASWVGGSILSCVDTFKDLS 339

Query: 343 ISKQEYDESGPSIVHRKCF 287
           ++++EY E+G SI+  K +
Sbjct: 340 VTREEYQETGLSILELKSY 358


>UniRef50_A2DEE0 Cluster: Actin family protein; n=1; Trichomonas
           vaginalis G3|Rep: Actin family protein - Trichomonas
           vaginalis G3
          Length = 378

 Score =  103 bits (248), Expect = 3e-21
 Identities = 48/126 (38%), Positives = 77/126 (61%), Gaps = 3/126 (2%)
 Frame = -3

Query: 670 ITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYANTVLSGGTTMYP 491
           + IG+ER +  E LF P   G++  GI    ++SIM+CD+ +R +L+ N VL+GGTT+  
Sbjct: 248 VKIGDERAKATEVLFSPDKFGLKGRGIPTLIFDSIMRCDISLRHELFGNIVLTGGTTLLE 307

Query: 490 GIADRMQKEITALAPS---TMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDE 320
           G   R+Q+E+  +  S     ++ ++A   R+Y+ WIGGSIL SL ++  +   K EY E
Sbjct: 308 GFQQRIQEELQEILESEHIKSQVNVVALANREYASWIGGSILGSLESYPNLLAYKDEYLE 367

Query: 319 SGPSIV 302
            G S++
Sbjct: 368 LGASLI 373


>UniRef50_UPI0000605B09 Cluster: PREDICTED: similar to actin alpha 1
           skeletal muscle protein; n=1; Mus musculus|Rep:
           PREDICTED: similar to actin alpha 1 skeletal muscle
           protein - Mus musculus
          Length = 255

 Score =  102 bits (245), Expect = 8e-21
 Identities = 47/103 (45%), Positives = 64/103 (62%)
 Frame = -3

Query: 595 GIHETTYNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAP 416
           GIH  T  SIM C+   ++ L+   VL+GGT+   G+  RMQKE+  +      +K+ A 
Sbjct: 153 GIHMLTLESIMSCEKSHQRTLFNYIVLTGGTSACTGLRFRMQKEMAKVVSPDFCVKVTAS 212

Query: 415 PERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 287
           P  KYS WIG SIL+SL  F+ MWI+  EY E GPS++ R+CF
Sbjct: 213 PYAKYSAWIGASILSSLPLFKDMWITNHEYLEIGPSVIFRRCF 255


>UniRef50_Q5JWF8 Cluster: Putative uncharacterized protein C20orf134
           precursor; n=6; Eutheria|Rep: Putative uncharacterized
           protein C20orf134 precursor - Homo sapiens (Human)
          Length = 245

 Score =  102 bits (244), Expect = 1e-20
 Identities = 47/137 (34%), Positives = 81/137 (59%), Gaps = 4/137 (2%)
 Frame = -3

Query: 697 SYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYANTV 518
           S+ + +G  + + +ERFRCPE +FQP  LG    G+    + ++ K    +R  L    V
Sbjct: 105 SFSVGNGCCVCLSSERFRCPEPIFQPGLLGQAEQGLPALAFRALQKMPKTLRTRLADTVV 164

Query: 517 LSGGTTMYPGIADRMQKEITALAP----STMKIKIIAPPERKYSVWIGGSILASLSTFQQ 350
           L+GG+T++PG A+R+ KE+ A       + ++  ++A   R  +VW GGS++ASL +FQ+
Sbjct: 165 LAGGSTLFPGFAERLDKELEAQCRRHGYAALRPHLVAKHGRGMAVWTGGSMVASLHSFQR 224

Query: 349 MWISKQEYDESGPSIVH 299
            WI++  Y E G  +++
Sbjct: 225 RWITRAMYQECGSRLLY 241


>UniRef50_Q24C02 Cluster: Actin family protein; n=3;
           Oligohymenophorea|Rep: Actin family protein -
           Tetrahymena thermophila SB210
          Length = 398

 Score =  101 bits (243), Expect = 1e-20
 Identities = 48/118 (40%), Positives = 68/118 (57%)
 Frame = -3

Query: 688 LPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYANTVLSG 509
           LPDG  I++  E+ R  E LF PS +G+E   I E    SI K D+D+R  LY   V+SG
Sbjct: 245 LPDGNQISLTFEKSRAAEILFNPSIIGLEYPSISELLIRSIQKVDIDLRNTLYQELVISG 304

Query: 508 GTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISK 335
           G T      +R   E+    P   K++  +P  R+   WIGGSIL++L++F+ MWI+K
Sbjct: 305 GCTKLKDFPNRFVNEVKKSIPKAQKLRAYSPENREDLCWIGGSILSNLASFKNMWITK 362


>UniRef50_Q8LKR0 Cluster: Actin-related protein 6; n=26;
           Magnoliophyta|Rep: Actin-related protein 6 - Arabidopsis
           thaliana (Mouse-ear cress)
          Length = 422

 Score =  101 bits (242), Expect = 2e-20
 Identities = 48/128 (37%), Positives = 74/128 (57%)
 Frame = -3

Query: 670 ITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYANTVLSGGTTMYP 491
           I + NERF  PE LFQP+ LGM   G+ E    +I  C   ++  LY + +L+GG+T++P
Sbjct: 294 IDLTNERFLVPETLFQPADLGMNQAGLAECIVRAINSCHSYLQPVLYQSIILTGGSTLFP 353

Query: 490 GIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP 311
            + +R++ E+  L P    +KI    +    VW GGS+LAS   F+ M ++K EY+E G 
Sbjct: 354 QLKERLEGELRPLVPDHFDVKITTQEDPILGVWRGGSLLASSPDFESMCVTKAEYEELGS 413

Query: 310 SIVHRKCF 287
           +   R+ F
Sbjct: 414 ARCRRRFF 421


>UniRef50_Q5DBE5 Cluster: SJCHGC08419 protein; n=1; Schistosoma
           japonicum|Rep: SJCHGC08419 protein - Schistosoma
           japonicum (Blood fluke)
          Length = 120

 Score =  100 bits (239), Expect = 4e-20
 Identities = 45/103 (43%), Positives = 71/103 (68%), Gaps = 2/103 (1%)
 Frame = -3

Query: 595 GIHETTYNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAP 416
           G+      SI KC  +++  +Y+N VLSGG+T++PG + R++ E+  L  ST +  ++  
Sbjct: 18  GLQNAINESIQKCPSELQSTMYSNIVLSGGSTLFPGFSQRLEHELRKLNSSTNRRILVHK 77

Query: 415 PE--RKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRK 293
            +  +KY+VWIGGSILASLS+F++++I K+EYDE G  IVH +
Sbjct: 78  KQNDQKYAVWIGGSILASLSSFKEIYIKKKEYDECGAGIVHTR 120


>UniRef50_Q6C061 Cluster: Actin-related protein 4; n=1; Yarrowia
           lipolytica|Rep: Actin-related protein 4 - Yarrowia
           lipolytica (Candida lipolytica)
          Length = 432

 Score =  100 bits (239), Expect = 4e-20
 Identities = 55/154 (35%), Positives = 89/154 (57%), Gaps = 11/154 (7%)
 Frame = -3

Query: 715 GPPLEKSYELPDGQVITIGNERFRCPEALFQPSFLGME-------ACGIHETTYNSIMKC 557
           G   ++ +E P G   T G +R    E+LF+PS    +       A G+ E   ++I   
Sbjct: 279 GEAADRVFEFPTGYSTTFGADRLSTSESLFKPSEYPFDGETVPDTARGLSEMVVDTINAS 338

Query: 556 DVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPP---ERKYSVWIG 386
           +VD+R  L  N V++GG ++  G++DR+ K++T  A S +K+++ A     ER++  WIG
Sbjct: 339 NVDVRAHLANNIVITGGGSLVQGLSDRVSKDVTQ-ALSGLKVRVAAASNQEERRHGAWIG 397

Query: 385 GSILASLSTFQQMWISKQEYDESGPS-IVHRKCF 287
           GS+L SL +F Q+W+SKQE+ E G   +V +K F
Sbjct: 398 GSVLGSLGSFHQLWVSKQEWQEKGGDYLVEKKRF 431


>UniRef50_P80428 Cluster: Actin-related protein 4; n=4;
           Saccharomycetales|Rep: Actin-related protein 4 -
           Saccharomyces cerevisiae (Baker's yeast)
          Length = 489

 Score =   99 bits (238), Expect = 5e-20
 Identities = 50/118 (42%), Positives = 72/118 (61%), Gaps = 3/118 (2%)
 Frame = -3

Query: 658 NERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYANTVLSGGTTMYPGIAD 479
           NE  + P    +P     E  G+ +  Y+SIM  DVD+R  L  N VL+GGT+  PG++D
Sbjct: 363 NETGKRPLEEEKPPKENNELIGLADLVYSSIMSSDVDLRATLAHNVVLTGGTSSIPGLSD 422

Query: 478 RMQKEITALAPSTMKIKIIAPP---ERKYSVWIGGSILASLSTFQQMWISKQEYDESG 314
           R+  E+  + PS +K +I+      ER+Y  W+GGSIL SL TF Q+W+ K+EY+E G
Sbjct: 423 RLMTELNKILPS-LKFRILTTGHTIERQYQSWLGGSILTSLGTFHQLWVGKKEYEEVG 479


>UniRef50_Q4UF64 Cluster: Actin-related protein, putative; n=2;
           Theileria|Rep: Actin-related protein, putative -
           Theileria annulata
          Length = 451

 Score = 99.1 bits (236), Expect = 9e-20
 Identities = 56/144 (38%), Positives = 82/144 (56%), Gaps = 8/144 (5%)
 Frame = -3

Query: 697 SYELPDGQVITIGNERFRCPEALFQPSFLGMEAC----GIHETTYNSIMKCDVDIRKDLY 530
           +Y LPDG V+ +       PE LF PS   +       GI     + I + DVDIR++L 
Sbjct: 307 TYNLPDGTVVNMEKYVNSIPELLFNPSGSTISEFNNFKGIVTMINDCIFESDVDIRRELL 366

Query: 529 ANTVLSGGTTMYPGIADRMQKEIT-ALAPSTMKIKIIAPP---ERKYSVWIGGSILASLS 362
           ++ V++GG T+  GI  R+  ++  +   S  K K++      E+++S W+GGSILASL 
Sbjct: 367 SSIVIAGGYTLTHGIIPRLNGDLLKSPIGSIAKFKLVHSSSYLEKRFSTWLGGSILASLG 426

Query: 361 TFQQMWISKQEYDESGPSIVHRKC 290
            FQQ+WISK EY E G  I +R+C
Sbjct: 427 RFQQLWISKSEYQEHGTIIAYRRC 450


>UniRef50_Q4QD95 Cluster: Actin-related protein 2, putative; n=3;
           Leishmania|Rep: Actin-related protein 2, putative -
           Leishmania major
          Length = 392

 Score = 99.1 bits (236), Expect = 9e-20
 Identities = 54/147 (36%), Positives = 82/147 (55%), Gaps = 12/147 (8%)
 Frame = -3

Query: 706 LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYA 527
           L +   LPDG    +G ERF  PE LF    +G E+ GI    + SI   D+D+R  LY 
Sbjct: 238 LHRDCVLPDGTSCRLGPERFAAPEVLFNTQEIGHESDGITTALWKSIEAADIDVRAALYE 297

Query: 526 NTVLSGGTTMYPGIADRMQKEITAL--------APSTM---KIKIIAPPERKYSVWIGGS 380
           N +LSGG+T+ PG  +R+Q+E+ +          P+ M    I++  P  R++ V++GG+
Sbjct: 298 NIILSGGSTLLPGFGERLQQEMKSFYLTEKLNGDPARMAWCPIRVKEPQRRQHMVYMGGA 357

Query: 379 ILASLSTFQ-QMWISKQEYDESGPSIV 302
           +LA LS  Q + W+S+  Y E G S +
Sbjct: 358 LLAELSQDQPERWLSRSAYGEGGTSAI 384


>UniRef50_Q20329 Cluster: Putative uncharacterized protein; n=2;
           Caenorhabditis|Rep: Putative uncharacterized protein -
           Caenorhabditis elegans
          Length = 552

 Score = 99.1 bits (236), Expect = 9e-20
 Identities = 41/112 (36%), Positives = 73/112 (65%)
 Frame = -3

Query: 664 IGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYANTVLSGGTTMYPGI 485
           I N RF C E LF+P   G++  G+H+  + +I++C +D R+ LY N  L+GG ++ PGI
Sbjct: 428 IDNSRFLCTEGLFKPKKWGLDTKGLHQLIHEAILQCPIDSRRTLYRNIYLAGGASLMPGI 487

Query: 484 ADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQE 329
           A+++++E++ + P+T+  ++   P R  + ++G  I+AS STF+   IS Q+
Sbjct: 488 AEKLEQELSTVVPNTIHTQVNISPWRYNAAYLGAQIVASASTFEDSCISLQQ 539


>UniRef50_Q9GZN1 Cluster: Actin-related protein 6; n=26;
           Chordata|Rep: Actin-related protein 6 - Homo sapiens
           (Human)
          Length = 396

 Score = 97.9 bits (233), Expect = 2e-19
 Identities = 40/128 (31%), Positives = 72/128 (56%)
 Frame = -3

Query: 676 QVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYANTVLSGGTTM 497
           Q++ + NERF  PE LF PS +G++  GI E    SI     +++   + N VL+GG ++
Sbjct: 266 QILRLANERFAVPEILFNPSDIGIQEMGIPEAIVYSIQNLPEEMQPHFFKNIVLTGGNSL 325

Query: 496 YPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDES 317
           +PG  DR+  E+  L P+   + ++ P       W GG +++    F+ M +++++Y+E+
Sbjct: 326 FPGFRDRVYSEVRCLTPTDYDVSVVLPENPITYAWEGGKLISENDDFEDMVVTREDYEEN 385

Query: 316 GPSIVHRK 293
           G S+   K
Sbjct: 386 GHSVCEEK 393


>UniRef50_Q5CSX9 Cluster: Actin; n=2; Cryptosporidium|Rep: Actin -
           Cryptosporidium parvum Iowa II
          Length = 405

 Score = 97.1 bits (231), Expect = 4e-19
 Identities = 50/149 (33%), Positives = 83/149 (55%), Gaps = 11/149 (7%)
 Frame = -3

Query: 706 LEKSYELPDGQV--------ITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDV 551
           + + Y LPDG          I I  ERF  PE +F P  +  +   +HE    SIM   +
Sbjct: 248 INEVYTLPDGLTLHDEHTNKIEIDKERFYAPEVIFDPKLIMRDVQPVHELIMESIMSSPM 307

Query: 550 DIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMK--IKIIAPPERKYSVWIGGSI 377
           ++RK L  + +LSGGT++  GI +R+++E+  + PS  K  I++    +R Y++W G  +
Sbjct: 308 EVRKTLMGSILLSGGTSLTTGIEERLEEELMYICPSQAKSNIRVTPADDRNYAIWKGAQL 367

Query: 376 LASLSTFQQ-MWISKQEYDESGPSIVHRK 293
            ++L  +Q+ +WIS+ EY E G +I  +K
Sbjct: 368 FSALRDYQENLWISRDEYLEEGVNICIKK 396


>UniRef50_Q54KZ7 Cluster: Putative uncharacterized protein; n=1;
           Dictyostelium discoideum AX4|Rep: Putative
           uncharacterized protein - Dictyostelium discoideum AX4
          Length = 490

 Score = 97.1 bits (231), Expect = 4e-19
 Identities = 49/130 (37%), Positives = 76/130 (58%)
 Frame = -3

Query: 676 QVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYANTVLSGGTTM 497
           QV+++ NERF  PE LF PS +GM   G+ E+   SI   + ++   LY+N +L GG+T+
Sbjct: 361 QVLSLVNERFTVPELLFNPSDIGMNQAGLAESIVQSINCTNSNLHIPLYSNIILLGGSTL 420

Query: 496 YPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDES 317
           +PG+ +R++ E+  LAP    I I  P +   S   GG  LA    + +  ISKQ+Y+E 
Sbjct: 421 FPGLKERLELELRKLAPEQYNINIFQPQDPILSPLYGGIRLAQQPDYLKYSISKQDYEEY 480

Query: 316 GPSIVHRKCF 287
           G +  ++K F
Sbjct: 481 GYNYCNKKFF 490


>UniRef50_Q55DY5 Cluster: Putative uncharacterized protein; n=1;
           Dictyostelium discoideum AX4|Rep: Putative
           uncharacterized protein - Dictyostelium discoideum AX4
          Length = 355

 Score = 96.7 bits (230), Expect = 5e-19
 Identities = 47/132 (35%), Positives = 81/132 (61%), Gaps = 2/132 (1%)
 Frame = -3

Query: 703 EKSYELPDGQVITI-GNERFRCPEALFQPSFLGMEAC-GIHETTYNSIMKCDVDIRKDLY 530
           ++S+  P    I I     + CPE LF+PS +G ++   +  +TY+SIMKCD  +++ L+
Sbjct: 225 KQSFSYPGSSDIQIDARYLYGCPEPLFRPSLVGFDSSDSLCNSTYSSIMKCDQSVQQSLF 284

Query: 529 ANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQ 350
           +N +L+GG++M+ GI +R++ EI+ +  ++ KI II   +RK S W+G S      T   
Sbjct: 285 SNIILTGGSSMFTGIKERLELEISKINTTSNKINIICSKDRKNSNWLGAS---KSITSTD 341

Query: 349 MWISKQEYDESG 314
            W+SK+++ E G
Sbjct: 342 NWVSKEKFTEKG 353


>UniRef50_Q7SHR0 Cluster: Actin-related protein 4; n=16;
           Pezizomycotina|Rep: Actin-related protein 4 - Neurospora
           crassa
          Length = 469

 Score = 96.3 bits (229), Expect = 7e-19
 Identities = 55/147 (37%), Positives = 83/147 (56%), Gaps = 12/147 (8%)
 Frame = -3

Query: 694 YELPDGQVITIGNERFRCPEALFQPSFL----GMEACGIHETTYNSIMKC-----DVDIR 542
           +E+PDG       +RF+  E ++  +        E       T  +++K      DVD+R
Sbjct: 323 FEMPDGSNQMWREQRFKVSEGMWDETAAYNSTDEEGRVTKAQTIPALIKAALEGVDVDLR 382

Query: 541 KDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAP---PERKYSVWIGGSILA 371
            ++  N V++G T++  G  DR+  E+  + P  +KIKI A     ER++  WIGGSILA
Sbjct: 383 PNILGNVVVTGSTSLLNGFNDRLNHELAQMYPG-VKIKIHAAGLTTERRFGAWIGGSILA 441

Query: 370 SLSTFQQMWISKQEYDESGPSIVHRKC 290
           SL TF QMWIS++EYDE+G  IV ++C
Sbjct: 442 SLGTFHQMWISRKEYDENGAGIVEKRC 468


>UniRef50_A3BPG0 Cluster: Putative uncharacterized protein; n=3;
           Oryza sativa|Rep: Putative uncharacterized protein -
           Oryza sativa subsp. japonica (Rice)
          Length = 467

 Score = 95.9 bits (228), Expect = 9e-19
 Identities = 51/126 (40%), Positives = 77/126 (61%), Gaps = 3/126 (2%)
 Frame = -3

Query: 697 SYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYANTV 518
           SYELPDGQ+   G + F             M   G+     +S+ +CDVDIRK+L ++ +
Sbjct: 318 SYELPDGQLTIPGVDGFAD----------SMSVRGLPRMVIDSVNRCDVDIRKELLSSIL 367

Query: 517 LSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPP---ERKYSVWIGGSILASLSTFQQM 347
           LSGG++    + +R++KE+   +    ++K++A     ER++SVWIGGSILASL +FQQM
Sbjct: 368 LSGGSSSILQLKERLEKEVLEESSGNTRVKVLASGNSVERRFSVWIGGSILASLGSFQQM 427

Query: 346 WISKQE 329
           W SK +
Sbjct: 428 WFSKAD 433


>UniRef50_A4RLB1 Cluster: Putative uncharacterized protein; n=1;
           Magnaporthe grisea|Rep: Putative uncharacterized protein
           - Magnaporthe grisea (Rice blast fungus) (Pyricularia
           grisea)
          Length = 445

 Score = 95.5 bits (227), Expect = 1e-18
 Identities = 44/92 (47%), Positives = 66/92 (71%), Gaps = 3/92 (3%)
 Frame = -3

Query: 556 DVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAP---PERKYSVWIG 386
           D D+R +L AN V++G T++  G  DR+  E++A  P T+++K+ A     ER++  WIG
Sbjct: 354 DQDLRPNLLANVVVTGSTSLLNGFNDRLNGELSAKYP-TLRVKLHAAGLTTERRFGSWIG 412

Query: 385 GSILASLSTFQQMWISKQEYDESGPSIVHRKC 290
           GSIL+SL TF QMWIS++EY+E+GP IV ++C
Sbjct: 413 GSILSSLGTFHQMWISRKEYEENGPGIVEKRC 444


>UniRef50_Q4N7N1 Cluster: Actin, putative; n=2; Theileria|Rep:
           Actin, putative - Theileria parva
          Length = 383

 Score = 95.1 bits (226), Expect = 2e-18
 Identities = 55/151 (36%), Positives = 81/151 (53%), Gaps = 13/151 (8%)
 Frame = -3

Query: 706 LEKSYELPDGQVITIGN--------ERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDV 551
           L + YELPDG+V+  G         ERF   E LF PS + ++A  I  T +N+I    +
Sbjct: 228 LVEVYELPDGKVLRDGETNDIDLSLERFYVCEPLFNPSIVNIDAPSIVTTIWNAITSSPI 287

Query: 550 DIRKDLYANTVLSGGTTMYPGIADRMQKEITALAP--STMKIKIIAPPERKYSVWIGGSI 377
             R  L  +  + GGT+++P    R+Q E+  +AP     K+++ AP +R    W GGSI
Sbjct: 288 QDRTTLTDSIFVCGGTSLFPNFEKRLQMELQDIAPPGGRSKVRVTAPQDRDTLAWRGGSI 347

Query: 376 LAS---LSTFQQMWISKQEYDESGPSIVHRK 293
           L+          MW+S+ E+DESGP I+ RK
Sbjct: 348 LSEPKLKDISANMWVSRYEWDESGPEIILRK 378


>UniRef50_Q9P7X7 Cluster: Actin-related protein 4; n=1;
           Schizosaccharomyces pombe|Rep: Actin-related protein 4 -
           Schizosaccharomyces pombe (Fission yeast)
          Length = 433

 Score = 95.1 bits (226), Expect = 2e-18
 Identities = 47/108 (43%), Positives = 71/108 (65%), Gaps = 6/108 (5%)
 Frame = -3

Query: 595 GIHETTYNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAP 416
           GI +   N I +CDVDIR  L  N ++ GGT++  G + R+Q E++ L P + ++KI A 
Sbjct: 326 GIPQLFQNCISECDVDIRASLLNNVIVCGGTSLMQGFSLRLQNELSKLYPGS-RLKIHAS 384

Query: 415 P---ERKYSVWIGGSILASLSTFQQMWISKQEYDESGP---SIVHRKC 290
               ER Y+ W+GGSIL+SL TF Q+WIS+QEY+E G    +++ ++C
Sbjct: 385 GHVVERSYASWLGGSILSSLGTFHQLWISRQEYEEHGSDRLALIEKRC 432


>UniRef50_Q9LZY1 Cluster: Actin-like protein; n=4; core
           eudicotyledons|Rep: Actin-like protein - Arabidopsis
           thaliana (Mouse-ear cress)
          Length = 368

 Score = 94.7 bits (225), Expect = 2e-18
 Identities = 51/119 (42%), Positives = 66/119 (55%), Gaps = 6/119 (5%)
 Frame = -3

Query: 625 QPSFLGMEACGIHETTYNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAP 446
           QPS LG+E  GI E     I     +  + L  NTVL GGTT   G   R QKE   L  
Sbjct: 251 QPSILGLEEHGIVEQLVRIISTVSSENHRQLLENTVLCGGTTSMTGFESRFQKEAN-LCS 309

Query: 445 STMKIKIIAPPERK------YSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 287
           S ++  ++ PPE        YS W+GG+ILA +   Q   ++K +YDE+GPS+VHRKCF
Sbjct: 310 SAIRPTLVKPPEYMPENLGMYSAWVGGAILAKVVFPQNQHVTKADYDETGPSVVHRKCF 368


>UniRef50_Q3M0W2 Cluster: Actin 4-2; n=3; Paramecium
           tetraurelia|Rep: Actin 4-2 - Paramecium tetraurelia
          Length = 345

 Score = 94.7 bits (225), Expect = 2e-18
 Identities = 53/142 (37%), Positives = 84/142 (59%), Gaps = 5/142 (3%)
 Frame = -3

Query: 700 KSYELPDGQVITIGNERF-RCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYAN 524
           + YELPDG+ +++   +     + LF  +       GI     + I     DI++ L + 
Sbjct: 205 QQYELPDGKFVSMQQAQLSEIADKLFNSND---NFKGIQHMLLDIINNSVNDIKQQLCST 261

Query: 523 TVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPE---RKYSVWIGGSILASLSTFQ 353
            + +GG++  PG  +++Q  ++ALAP   K+K++  P    R +SV+IGGSILASLS+FQ
Sbjct: 262 VISTGGSSNIPGFLNKLQTTLSALAPPMCKVKLVMYPSNQNRYHSVFIGGSILASLSSFQ 321

Query: 352 QMWISKQEYDESGP-SIVHRKC 290
            +W++K EY ESG  SI+ RKC
Sbjct: 322 SLWVAKNEYQESGRFSIIERKC 343


>UniRef50_A7TST0 Cluster: Putative uncharacterized protein; n=1;
           Vanderwaltozyma polyspora DSM 70294|Rep: Putative
           uncharacterized protein - Vanderwaltozyma polyspora DSM
           70294
          Length = 501

 Score = 94.7 bits (225), Expect = 2e-18
 Identities = 45/97 (46%), Positives = 64/97 (65%), Gaps = 3/97 (3%)
 Frame = -3

Query: 595 GIHETTYNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAP 416
           GI +   +SIM  DVD+R  L  N VL+GGT+  PG +DR+  E+    P+ +K +++  
Sbjct: 396 GIVDLIESSIMATDVDLRASLAHNIVLTGGTSCIPGFSDRLMLELNKKLPA-LKFRVLTT 454

Query: 415 P---ERKYSVWIGGSILASLSTFQQMWISKQEYDESG 314
               ER+Y  W+GGSIL+SL TF Q+W+ KQEY+ESG
Sbjct: 455 GQTRERQYQAWLGGSILSSLGTFHQLWVGKQEYEESG 491


>UniRef50_Q6CSB9 Cluster: Actin-related protein 4; n=1;
           Kluyveromyces lactis|Rep: Actin-related protein 4 -
           Kluyveromyces lactis (Yeast) (Candida sphaerica)
          Length = 520

 Score = 94.7 bits (225), Expect = 2e-18
 Identities = 44/101 (43%), Positives = 67/101 (66%), Gaps = 3/101 (2%)
 Frame = -3

Query: 604 EACGIHETTYNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKI 425
           E  GI +    S+M+ DVD+R  L  N VL+GGT+  PG++DR+  E+    P+ +K ++
Sbjct: 412 EVAGIVDLINKSMMEADVDLRATLAHNVVLTGGTSKIPGLSDRIMHELNKSLPA-LKFRM 470

Query: 424 IAPP---ERKYSVWIGGSILASLSTFQQMWISKQEYDESGP 311
           ++     ER+Y  W+GGSILASL TF Q+W+ ++EY+E GP
Sbjct: 471 LSSGHLRERQYQGWLGGSILASLGTFHQLWVGREEYEEVGP 511


>UniRef50_Q19R52 Cluster: ALP5; n=6; Trypanosomatidae|Rep: ALP5 -
           Trypanosoma cruzi strain CL Brener
          Length = 422

 Score = 93.9 bits (223), Expect = 4e-18
 Identities = 55/156 (35%), Positives = 80/156 (51%), Gaps = 20/156 (12%)
 Frame = -3

Query: 694 YELPDGQVITIGNERFRCPEALFQPSFLGMEAC--------------------GIHETTY 575
           + LPDG +IT+ + RF   E L  PS +  +                      G+     
Sbjct: 269 HRLPDGTIITLDSNRFVPAEMLIDPSLVSSDVLSGDQFFIDNVERLRTSTEPHGLPRLIL 328

Query: 574 NSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSV 395
            S+  CD DI   L  +  LSGG +M  G  +R+  E+    P T  +   A  ER+++ 
Sbjct: 329 GSLNVCDRDISPLLERSIHLSGGCSMIRGFPERLDSELNTFMPHTFHVT--ARTERRHAA 386

Query: 394 WIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 287
           ++GGSILASL TFQ+ W++K +Y+ESGPS V R+CF
Sbjct: 387 FVGGSILASLPTFQEFWVTKLDYEESGPSAVLRRCF 422


>UniRef50_A7RG28 Cluster: Predicted protein; n=1; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 96

 Score = 93.9 bits (223), Expect = 4e-18
 Identities = 43/92 (46%), Positives = 56/92 (60%)
 Frame = -3

Query: 562 KCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGG 383
           +CD +IR     +  +SGGTT   G   R+Q E+  + P   K++  AP  RKYS WIGG
Sbjct: 7   RCDSEIRDHARHHVTISGGTTTAQGFVPRLQSELKQIEPKIKKLR--APEHRKYSAWIGG 64

Query: 382 SILASLSTFQQMWISKQEYDESGPSIVHRKCF 287
           SIL SL T    +++  EY +SGP IVHRKCF
Sbjct: 65  SILGSLPTMDSQYVTVDEYADSGPRIVHRKCF 96


>UniRef50_UPI00004987CF Cluster: actin; n=2; Entamoeba histolytica
            HM-1:IMSS|Rep: actin - Entamoeba histolytica HM-1:IMSS
          Length = 876

 Score = 92.7 bits (220), Expect = 8e-18
 Identities = 44/119 (36%), Positives = 74/119 (62%), Gaps = 5/119 (4%)
 Frame = -3

Query: 700  KSYELPDGQVIT-IGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYAN 524
            K +++P  +  +    ERF+CPEALFQP  +G++A G+    +++I KC +  R+ L  +
Sbjct: 742  KEFQVPGNENTSKFFQERFQCPEALFQPEKVGIDAEGVPSMLFSTIKKCPLTSRRPLLNH 801

Query: 523  TVLSGGTTMYPGIADRMQKEITALAP----STMKIKIIAPPERKYSVWIGGSILASLST 359
             +LSGG+T++PG+ +R++KE+  L      +   +KI A   RKY  W G ++LA +ST
Sbjct: 802  IILSGGSTLFPGLPERLEKELKQLCTENKMNPRDVKISALQNRKYLAWTGAALLAGMST 860


>UniRef50_UPI0000E47BC7 Cluster: PREDICTED: similar to ubiquitin/actin
            fusion protein; n=1; Strongylocentrotus purpuratus|Rep:
            PREDICTED: similar to ubiquitin/actin fusion protein -
            Strongylocentrotus purpuratus
          Length = 1608

 Score = 92.3 bits (219), Expect = 1e-17
 Identities = 45/135 (33%), Positives = 76/135 (56%), Gaps = 1/135 (0%)
 Frame = -3

Query: 694  YELPDGQVITIGN-ERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYANTV 518
            Y LPDG  +++   + F C E +F+P  +G+   G+ +   + + KCD    + L    +
Sbjct: 1475 YSLPDGSSVSLRKKDLFHCSETMFRPDIVGLPQEGLVQVLTDCLEKCDPAFLESLDPTLL 1534

Query: 517  LSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWIS 338
            L+GG T   G  +R+Q E+        +  +IA   R  + WIGG+ILAS S+F + WI+
Sbjct: 1535 LAGGNTKLRGFPERLQHEMDK---GGFERTVIAHDNRDITTWIGGAILASHSSFGERWIT 1591

Query: 337  KQEYDESGPSIVHRK 293
             +++DE G S+VH++
Sbjct: 1592 SEDFDEFGTSLVHKQ 1606


>UniRef50_O96819 Cluster: Actin-related protein; n=5;
           Trypanosoma|Rep: Actin-related protein - Trypanosoma
           brucei
          Length = 433

 Score = 91.9 bits (218), Expect = 1e-17
 Identities = 57/163 (34%), Positives = 78/163 (47%), Gaps = 25/163 (15%)
 Frame = -3

Query: 703 EKSYELPDGQVITIGNERFRCPEALFQPSFLGME-------------------ACGIHET 581
           E+ + LPDG  I I   R    EALF    LG +                     G+   
Sbjct: 270 ERVFYLPDGNAIPISTHRSLTTEALFDFGILGSQYVPKSRYMTELGEIFQPSFPMGVSWL 329

Query: 580 TYNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAP----- 416
            + +I  C   IR  LYA+ VLSGG   +PG  +R++ E+T L   T   + + P     
Sbjct: 330 AFAAINNCQPVIRAQLYASIVLSGGNVSFPGTRERIETEVTQLYRETHTSEAVTPIAVND 389

Query: 415 -PERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKC 290
            P R YS W+GGS+LA  S F  + +S+QEY+E G  +VH KC
Sbjct: 390 IPCRVYSAWVGGSMLAGTSMFPHLAVSRQEYEEQGHRVVHCKC 432


>UniRef50_Q0J646 Cluster: Os08g0369300 protein; n=2; Oryza sativa
           (japonica cultivar-group)|Rep: Os08g0369300 protein -
           Oryza sativa subsp. japonica (Rice)
          Length = 495

 Score = 89.8 bits (213), Expect = 6e-17
 Identities = 52/139 (37%), Positives = 79/139 (56%), Gaps = 25/139 (17%)
 Frame = -3

Query: 706 LEKSYELPDGQVITIGNERFRCPEALFQPS--------------FLGMEACGIHETTYNS 569
           L KSY LPDG+VI +G ERF+ PEALF P                + +E  G+ +  +  
Sbjct: 252 LVKSYTLPDGRVIKVGTERFQAPEALFTPDQYQHNIDKTFVEQELIDVEGDGMADMAFRC 311

Query: 568 IMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEI------TALAPS-----TMKIKII 422
           I + D+D R  LY + VLSGG+TMYPG+  R++KE+        L  +      ++++I 
Sbjct: 312 IQEMDIDNRMTLYQHIVLSGGSTMYPGLPSRLEKEMLDRYLDVVLKGNKDGLKKLRLRIE 371

Query: 421 APPERKYSVWIGGSILASL 365
            PP RK+ V++GG++LA +
Sbjct: 372 DPPRRKHMVYLGGAVLAGI 390


>UniRef50_Q6C982 Cluster: Actin-like protein ARP6; n=1; Yarrowia
           lipolytica|Rep: Actin-like protein ARP6 - Yarrowia
           lipolytica (Candida lipolytica)
          Length = 387

 Score = 89.4 bits (212), Expect = 8e-17
 Identities = 43/129 (33%), Positives = 68/129 (52%)
 Frame = -3

Query: 700 KSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYANT 521
           K +++ + Q + +GNERF  PE LF PS + ++  G+ ET   SI     + R  L +N 
Sbjct: 239 KQHDISELQTLKLGNERFTMPEILFDPSIIDLQQSGLCETIAESIQASPKEFRSLLCSNI 298

Query: 520 VLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWI 341
           V+ GG    PG   R++K++  L PS   +K     +  ++   GG +L     F  + +
Sbjct: 299 VIVGGCAKLPGFQSRLEKDLRPLIPSEYHMKTRLDDKPDFTTLQGGKVLVDQPGFSNLCV 358

Query: 340 SKQEYDESG 314
           +KQEYDE G
Sbjct: 359 TKQEYDEYG 367


>UniRef50_P45890 Cluster: Actin-like protein 13E; n=8;
           Eumetazoa|Rep: Actin-like protein 13E - Drosophila
           melanogaster (Fruit fly)
          Length = 398

 Score = 89.4 bits (212), Expect = 8e-17
 Identities = 36/121 (29%), Positives = 70/121 (57%)
 Frame = -3

Query: 676 QVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYANTVLSGGTTM 497
           Q++++ NERF  PE LF PS +G++  GI E   + +  C  +  ++L  N ++ GG+  
Sbjct: 271 QMVSLCNERFTVPELLFNPSDIGVQQVGIPEAVADCLKACPWEAHRELLLNILIVGGSAQ 330

Query: 496 YPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDES 317
           +PG   R+++++ AL P  +++ +I P +     W GG  +A+   F++   ++ +Y+E 
Sbjct: 331 FPGFLPRLKRDLRALVPDDLEVSLICPEDPVRYAWYGGKEVATSPNFEEFVYTQDDYEEY 390

Query: 316 G 314
           G
Sbjct: 391 G 391


>UniRef50_Q9H568 Cluster: Actin-like protein 8; n=10; Eutheria|Rep:
           Actin-like protein 8 - Homo sapiens (Human)
          Length = 366

 Score = 89.0 bits (211), Expect = 1e-16
 Identities = 40/126 (31%), Positives = 66/126 (52%)
 Frame = -3

Query: 697 SYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYANTV 518
           +Y+LPDG  + +   +   PE  F P         I      S+  C++ +R  L ++ +
Sbjct: 237 TYQLPDGSRVELTPMQRVAPEMFFSPQVFEQPGPSIPRAIVESVESCEISLRPLLVSHVM 296

Query: 517 LSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWIS 338
             GG T+YPG   R+ +E+     S+ K  +     R +SVW+G S++A LST+Q  W+S
Sbjct: 297 ACGGNTLYPGFTKRLFRELMGDHVSSTKATVWEGSNRNFSVWLGASVVAHLSTYQSEWMS 356

Query: 337 KQEYDE 320
           ++EY E
Sbjct: 357 REEYGE 362


>UniRef50_Q0VHZ6 Cluster: Actin deviating protein; n=2; Bolivina sp.
           isolate 615|Rep: Actin deviating protein - Bolivina sp.
           isolate 615
          Length = 387

 Score = 88.6 bits (210), Expect = 1e-16
 Identities = 37/72 (51%), Positives = 51/72 (70%)
 Frame = -3

Query: 595 GIHETTYNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAP 416
           G+H   + S MKCD +IR  L+ N VL GG TM+  +  R++ E+T L  ++ KIK+IAP
Sbjct: 316 GVHSLVHRSTMKCDENIRDKLFENIVLCGGNTMFDKMFTRLESELTLLTKNSTKIKVIAP 375

Query: 415 PERKYSVWIGGS 380
           PERKYS+WIGG+
Sbjct: 376 PERKYSIWIGGT 387



 Score = 56.0 bits (129), Expect = 9e-07
 Identities = 23/31 (74%), Positives = 25/31 (80%)
 Frame = -3

Query: 703 EKSYELPDGQVITIGNERFRCPEALFQPSFL 611
           +K YELP GQVIT GNERFRCPE LF+P  L
Sbjct: 235 DKHYELPSGQVITAGNERFRCPEVLFEPQLL 265


>UniRef50_Q0IFH2 Cluster: Actin; n=4; Endopterygota|Rep: Actin -
           Aedes aegypti (Yellowfever mosquito)
          Length = 400

 Score = 88.6 bits (210), Expect = 1e-16
 Identities = 40/121 (33%), Positives = 66/121 (54%)
 Frame = -3

Query: 676 QVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYANTVLSGGTTM 497
           Q + + NERF  PE LF PS +G++  G+ E    +I  C  + R  L +N V+ GG+ +
Sbjct: 270 QTLRLNNERFVIPEVLFHPSDIGIQQMGVAEAIVEAINTCPDETRPHLLSNIVVCGGSAL 329

Query: 496 YPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDES 317
           + G+  R+ KE+ ALAP   ++ +  P +     W GG   +   +F +  +S+ +YDE 
Sbjct: 330 FSGMQSRLLKEVRALAPDEFEVNVTVPKDPITYAWHGGKEYSQSLSFLKSCMSRSQYDEH 389

Query: 316 G 314
           G
Sbjct: 390 G 390


>UniRef50_Q38F20 Cluster: Actin-like protein 3, putative; n=1;
           Trypanosoma brucei|Rep: Actin-like protein 3, putative -
           Trypanosoma brucei
          Length = 416

 Score = 88.2 bits (209), Expect = 2e-16
 Identities = 50/146 (34%), Positives = 73/146 (50%), Gaps = 17/146 (11%)
 Frame = -3

Query: 682 DGQVITIGNERFRCPEALFQPSFLGME-ACGIHETTYNSIMKCDVDIRKDLYANTVLSGG 506
           +   + +G E+F  PE  F P     E    + +    +I  C +D R+ LY N VLSGG
Sbjct: 262 ESYTVDVGYEKFLGPEMFFSPDIFSREWTLPLPDVIDKAIWSCPIDCRRPLYRNVVLSGG 321

Query: 505 TTMYPGIADRMQKEITALA-------------PS---TMKIKIIAPPERKYSVWIGGSIL 374
           TTM+P    R+QK++ AL              PS   T  + ++A   ++Y+VW GGS+L
Sbjct: 322 TTMFPKFDKRLQKDLRALVSRRAKKFTKALGDPSKQITYDVNVVAHERQRYAVWYGGSML 381

Query: 373 ASLSTFQQMWISKQEYDESGPSIVHR 296
                F  +  +KQEYDE GP +  R
Sbjct: 382 GMSPDFAAVAKTKQEYDEHGPYVCRR 407


>UniRef50_UPI0000F2D272 Cluster: PREDICTED: similar to actin; n=1;
            Monodelphis domestica|Rep: PREDICTED: similar to actin -
            Monodelphis domestica
          Length = 790

 Score = 87.4 bits (207), Expect = 3e-16
 Identities = 38/125 (30%), Positives = 75/125 (60%)
 Frame = -3

Query: 688  LPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYANTVLSG 509
            LPDG ++++  +    P+ LF PS  G+    +    ++S M CD +  K ++++ VLSG
Sbjct: 662  LPDGTIVSLTEKHLTYPDLLFNPSKFGLPGEELGLKIFSSAMSCDKN-SKSIFSHVVLSG 720

Query: 508  GTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQE 329
            G+T++ G ++R+  ++     ++   ++++ P R Y  W+GGS+ + LSTF    I++++
Sbjct: 721  GSTLFDGFSERLFLDLGRFRFASCPTEVVSRPNRIYLPWLGGSMFSCLSTFMSCGITREK 780

Query: 328  YDESG 314
            Y E+G
Sbjct: 781  YHEAG 785



 Score = 60.1 bits (139), Expect = 5e-08
 Identities = 31/108 (28%), Positives = 51/108 (47%), Gaps = 1/108 (0%)
 Frame = -3

Query: 694 YELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYANTVL 515
           Y LPDG V+ +  +    P   F PS  G     +      S M C    +  +++N VL
Sbjct: 312 YVLPDGNVLFLSEKLCTIPNIFFDPSEFGGNGIKLGVEVLKSAMACHNKTKAYIFSNVVL 371

Query: 514 SGGTTMYPGIADRMQKEITALAPSTMKIKII-APPERKYSVWIGGSIL 374
           SGG+T++PG  +R+  E+ A+ P   +  +    P+   S  IG + +
Sbjct: 372 SGGSTLFPGFTERLSWELNAMKPLISRAHLFYLSPKTLSSSLIGSTFI 419


>UniRef50_Q4QG59 Cluster: Actin-like protein, putative; n=3;
           Leishmania|Rep: Actin-like protein, putative -
           Leishmania major
          Length = 483

 Score = 87.0 bits (206), Expect = 4e-16
 Identities = 43/119 (36%), Positives = 69/119 (57%), Gaps = 6/119 (5%)
 Frame = -3

Query: 631 LFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITAL 452
           LF+PSF      GI    + ++  C+  +R  LYAN VL+GG+T +PG+  R++ E+  L
Sbjct: 367 LFRPSF----EKGISWLPFAAVNNCEAALRPQLYANMVLAGGSTSFPGLKARLESEVRQL 422

Query: 451 APSTMKIKIIAP------PERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRK 293
              +   + + P      P R YS W+GGS+LA  + FQ + +S++EY+E G  ++H K
Sbjct: 423 YRESHPSEAVVPIQVRDMPCRTYSTWLGGSMLAQTAVFQHLVVSRKEYEEEGARVIHYK 481



 Score = 32.7 bits (71), Expect = 9.3
 Identities = 19/53 (35%), Positives = 27/53 (50%), Gaps = 1/53 (1%)
 Frame = -3

Query: 700 KSYELPDGQVITIGNERFRCPEALFQPSFLG-MEACGIHETTYNSIMKCDVDI 545
           + + LPDGQ I +  ER+   E LF  S L  M++ G   +TY    K   D+
Sbjct: 312 EDFLLPDGQRIPLAAERYDTAEVLFNYSLLALMDSNGKDSSTYEPRCKVRTDM 364


>UniRef50_UPI0000F2D271 Cluster: PREDICTED: similar to actin-like 8;
           n=1; Monodelphis domestica|Rep: PREDICTED: similar to
           actin-like 8 - Monodelphis domestica
          Length = 370

 Score = 86.6 bits (205), Expect = 5e-16
 Identities = 42/124 (33%), Positives = 66/124 (53%)
 Frame = -3

Query: 688 LPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYANTVLSG 509
           LPDG++I +  E    P+  FQ S     +  +      SI+ C  + R  L ++ VLSG
Sbjct: 239 LPDGKIIRMTKELCTYPDIFFQTSQHDFPSLDLSSKIIKSILNCKAEERAILASHVVLSG 298

Query: 508 GTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQE 329
           G T++PG  +R++ E+ A  P      +++ P R    W+G SIL+ LS F+   ++K E
Sbjct: 299 GNTLFPGFPERLKWELNATRPLWFPADVVSKPNRVCLSWVGASILSCLSNFESHCVTKME 358

Query: 328 YDES 317
           Y ES
Sbjct: 359 YGES 362


>UniRef50_Q8IIQ4 Cluster: Actin, putative; n=7; Apicomplexa|Rep:
           Actin, putative - Plasmodium falciparum (isolate 3D7)
          Length = 392

 Score = 86.2 bits (204), Expect = 7e-16
 Identities = 52/146 (35%), Positives = 79/146 (54%), Gaps = 12/146 (8%)
 Frame = -3

Query: 706 LEKSYELPDGQV-------ITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVD 548
           L  +Y LPDG V       I I +ERF   EALF P     +   I +  + SI+ C ++
Sbjct: 223 LAATYTLPDGDVLRDGYDSIEIAHERFYVAEALFNPQLCHRDNLSIIDIIWKSILSCPME 282

Query: 547 IRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMK--IKIIAPPERKYSVWIGGSIL 374
            RK L ++ VLSGG++++P + +R++ E+   AP + +  +K+ A   R    W G  I 
Sbjct: 283 NRKILSSSIVLSGGSSLFPNLVERIETEVRNNAPESARSMVKVHALENRAIMAWCGAQIF 342

Query: 373 --ASLSTFQQ-MWISKQEYDESGPSI 305
             A L   Q  +WISK+EY+E G +I
Sbjct: 343 SQAELRESQTGIWISKEEYEEIGSNI 368


>UniRef50_Q6C0A9 Cluster: Yarrowia lipolytica chromosome F of strain
           CLIB122 of Yarrowia lipolytica; n=1; Yarrowia
           lipolytica|Rep: Yarrowia lipolytica chromosome F of
           strain CLIB122 of Yarrowia lipolytica - Yarrowia
           lipolytica (Candida lipolytica)
          Length = 427

 Score = 86.2 bits (204), Expect = 7e-16
 Identities = 46/151 (30%), Positives = 74/151 (49%), Gaps = 11/151 (7%)
 Frame = -3

Query: 712 PPLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEAC------GIHETTYNSIMKCD- 554
           P +++ YE PDG       ERF   E+LF+P   G          GI E  Y++++K D 
Sbjct: 275 PNIQRPYEFPDGSTYIAEQERFGIAESLFRPVEFGPPGVVPEGTLGISELIYHAVLKTDP 334

Query: 553 -VDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPS---TMKIKIIAPPERKYSVWIG 386
             +++ +L  N V+ GGTT+  G+  R+ +++               +   ERK   W G
Sbjct: 335 KAEVQMELLNNIVVVGGTTLLNGLTARIHRDMAQFFTQFHVKQPYLSVTSTERKSLAWTG 394

Query: 385 GSILASLSTFQQMWISKQEYDESGPSIVHRK 293
            S+ ASL  F   W+ KQEY+E G  ++ ++
Sbjct: 395 ASVFASLGNFGSSWVIKQEYEEQGADVIDKR 425


>UniRef50_Q9H9F9 Cluster: Actin-related protein 5; n=19;
           Euteleostomi|Rep: Actin-related protein 5 - Homo sapiens
           (Human)
          Length = 607

 Score = 86.2 bits (204), Expect = 7e-16
 Identities = 43/126 (34%), Positives = 65/126 (51%), Gaps = 1/126 (0%)
 Frame = -3

Query: 664 IGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYANTVLSGGTTMYPGI 485
           +G ER R PE +FQPS +G E  GI ET    + +   DI++ L  N  L+GG TMYPG+
Sbjct: 444 VGTERIRAPEIIFQPSLIGEEQAGIAETLQYILDRYPKDIQEMLVQNVFLTGGNTMYPGM 503

Query: 484 ADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILA-SLSTFQQMWISKQEYDESGPS 308
             RM+KE+  + P     ++          W G    A +     ++WI+++EY+E G  
Sbjct: 504 KARMEKELLEMRPFRSSFQVQLASNPVLDAWYGARDWALNHLDDNEVWITRKEYEEKGGE 563

Query: 307 IVHRKC 290
            +   C
Sbjct: 564 YLKEHC 569


>UniRef50_P61158 Cluster: Actin-related protein 3; n=107;
           Eukaryota|Rep: Actin-related protein 3 - Homo sapiens
           (Human)
          Length = 418

 Score = 86.2 bits (204), Expect = 7e-16
 Identities = 49/139 (35%), Positives = 73/139 (52%), Gaps = 17/139 (12%)
 Frame = -3

Query: 670 ITIGNERFRCPEALFQPSFLGMEACG-IHETTYNSIMKCDVDIRKDLYANTVLSGGTTMY 494
           I +G ERF  PE  F P F   +    I E     I  C +D+R+ LY N VLSGG+TM+
Sbjct: 269 IDVGYERFLGPEIFFHPEFANPDFTQPISEVVDEVIQNCPIDVRRPLYKNIVLSGGSTMF 328

Query: 493 PGIADRMQKEIT----------------ALAPSTMKIKIIAPPERKYSVWIGGSILASLS 362
                R+Q+++                  L P  + +++I    ++Y+VW GGS+LAS  
Sbjct: 329 RDFGRRLQRDLKRTVDARLKLSEELSGGRLKPKPIDVQVITHHMQRYAVWFGGSMLASTP 388

Query: 361 TFQQMWISKQEYDESGPSI 305
            F Q+  +K++Y+E GPSI
Sbjct: 389 EFYQVCHTKKDYEEIGPSI 407


>UniRef50_A0CQQ2 Cluster: Chromosome undetermined scaffold_24, whole
           genome shotgun sequence; n=7; Oligohymenophorea|Rep:
           Chromosome undetermined scaffold_24, whole genome
           shotgun sequence - Paramecium tetraurelia
          Length = 869

 Score = 85.8 bits (203), Expect = 9e-16
 Identities = 49/144 (34%), Positives = 77/144 (53%), Gaps = 15/144 (10%)
 Frame = -3

Query: 700 KSYELPDGQVITIGNERFRCPEALFQPSFL-GMEACGIHETTYNSIMKCDVDIRKDLYAN 524
           KS    +   I IG ERF  PE  F P FL G     I E    SI    VD RK LY N
Sbjct: 256 KSSVTKEKYTIDIGYERFLGPEMFFHPEFLDGKWRSPIDEVIDKSIQTSPVDCRKKLYQN 315

Query: 523 TVLSGGTTMYPGIADRMQKEI--------------TALAPSTMKIKIIAPPERKYSVWIG 386
            +LSGG+T++ G + R+++++              +   P+++K+ +   P ++Y+VW G
Sbjct: 316 IILSGGSTLFDGFSQRLEQQVQLRIDSRLQKYEQRSGFKPASIKVNVTQNPFQRYAVWQG 375

Query: 385 GSILASLSTFQQMWISKQEYDESG 314
           GS++A    F++++ ++QEY E G
Sbjct: 376 GSLMALQPQFEKVYHTRQEYFERG 399


>UniRef50_P32392 Cluster: Actin-related protein 3; n=27;
           Eukaryota|Rep: Actin-related protein 3 - Drosophila
           melanogaster (Fruit fly)
          Length = 418

 Score = 85.8 bits (203), Expect = 9e-16
 Identities = 51/148 (34%), Positives = 75/148 (50%), Gaps = 18/148 (12%)
 Frame = -3

Query: 670 ITIGNERFRCPEALFQPSFLGME-ACGIHETTYNSIMKCDVDIRKDLYANTVLSGGTTMY 494
           + +G ERF  PE  F P F   +    + E   N I  C +D+R+ LY N VLSGG+TM+
Sbjct: 269 VDVGYERFLGPEIFFHPEFSNPDFTIPLSEIVDNVIQNCPIDVRRPLYNNIVLSGGSTMF 328

Query: 493 PGIADRMQKEIT----------------ALAPSTMKIKIIAPPERKYSVWIGGSILASLS 362
                R+Q++I                  + P  + +++I    ++Y+VW GGS+LAS  
Sbjct: 329 KDFGRRLQRDIKRSVDTRLRISENLSEGRIKPKPIDVQVITHHMQRYAVWFGGSMLASTP 388

Query: 361 TFQQMWISKQEYDESGPSIV-HRKCF*T 281
            F Q+  +K  Y+E GPSI  H   F T
Sbjct: 389 EFYQVCHTKAAYEEYGPSICRHNPVFGT 416


>UniRef50_UPI0000E46266 Cluster: PREDICTED: similar to actin; n=1;
           Strongylocentrotus purpuratus|Rep: PREDICTED: similar to
           actin - Strongylocentrotus purpuratus
          Length = 341

 Score = 85.4 bits (202), Expect = 1e-15
 Identities = 38/107 (35%), Positives = 64/107 (59%), Gaps = 2/107 (1%)
 Frame = -3

Query: 604 EACGIHETTYNSIMKCDV--DIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKI 431
           +  G H+    SI   D   D     + N +L GG +++PGI ++++ E+      T  +
Sbjct: 232 DCMGFHKAIPRSIYLTDEEDDYEHVYFRNIMLCGGNSLFPGIKEKLEIEVKTPYYLTCGV 291

Query: 430 KIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKC 290
           ++IAP  R+++ W+GGSI ASL TF+  WI+K++Y + G +I+ RKC
Sbjct: 292 RVIAPSFRQHAAWVGGSIAASLPTFKSFWITKEDYSDYGENILQRKC 338


>UniRef50_Q5AXH1 Cluster: Actin-like protein arp6; n=5;
           Trichocomaceae|Rep: Actin-like protein arp6 - Emericella
           nidulans (Aspergillus nidulans)
          Length = 479

 Score = 85.4 bits (202), Expect = 1e-15
 Identities = 44/136 (32%), Positives = 74/136 (54%), Gaps = 1/136 (0%)
 Frame = -3

Query: 697 SYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYANTV 518
           S E  +  V+ +GNERF  PE LF PS +GM++ GI +    S+      +     AN +
Sbjct: 339 SAEQLNEDVLVLGNERFTVPEILFTPSDIGMKSAGIPDIILQSLSVLPTGLHPAFLANVL 398

Query: 517 LSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILA-SLSTFQQMWI 341
           + GG ++ PG  +R++ E+  +A +   +++  P +     W+GGS LA +    +++ I
Sbjct: 399 VVGGNSLLPGFMERLETELRQIASAECVVRVRRPKDPIRFAWLGGSRLATNKEELKKVAI 458

Query: 340 SKQEYDESGPSIVHRK 293
           ++QEY E G S   RK
Sbjct: 459 TRQEYQEHGSSWTTRK 474


>UniRef50_Q7S6X6 Cluster: Actin-like protein arp-6; n=5;
           Pezizomycotina|Rep: Actin-like protein arp-6 -
           Neurospora crassa
          Length = 446

 Score = 85.0 bits (201), Expect = 2e-15
 Identities = 42/127 (33%), Positives = 68/127 (53%)
 Frame = -3

Query: 673 VITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYANTVLSGGTTMY 494
           V+T+ NERF  PE LF PS +G+   GI +    S++   + +   L AN V+ GG ++ 
Sbjct: 311 VLTLRNERFVVPELLFNPSDIGIRQPGIADLVKQSLLAVPIGLWPGLLANIVVVGGNSLS 370

Query: 493 PGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESG 314
            G   R+Q EI    P   ++++  P +   S W+G +  A      ++ ++KQEY+E G
Sbjct: 371 EGFCQRLQTEILKRFPDECRVRVARPEDPIISTWLGAANFAKHEHASKLEVTKQEYEEHG 430

Query: 313 PSIVHRK 293
            + V RK
Sbjct: 431 AAWVARK 437


>UniRef50_Q7QTA6 Cluster: GLP_15_20269_21672; n=1; Giardia lamblia
           ATCC 50803|Rep: GLP_15_20269_21672 - Giardia lamblia
           ATCC 50803
          Length = 467

 Score = 84.2 bits (199), Expect = 3e-15
 Identities = 46/145 (31%), Positives = 78/145 (53%), Gaps = 11/145 (7%)
 Frame = -3

Query: 694 YELPDGQVITIGNERFRCPEALFQ----PSFLG---MEACGIHETTYNSIMKCDVDIRKD 536
           Y LPDG  I +       PE LF     P F     ++   I    + +I+     ++ +
Sbjct: 321 YLLPDGNKIDLSFSASLIPEGLFNTSVYPIFFNTRLLDPTSIQMHAHKAIVSLHDSVQPE 380

Query: 535 LYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPP----ERKYSVWIGGSILAS 368
           L +N V+ GG +   G+ +R++ E+ ++ PS +K+K++        R+++VW GG++L+S
Sbjct: 381 LASNVVVVGGLSNINGVLNRLKLELESVIPSVLKVKLVNSQYNNLSRRFAVWYGGNVLSS 440

Query: 367 LSTFQQMWISKQEYDESGPSIVHRK 293
           L TF   W SK EY+E G SI+ R+
Sbjct: 441 LGTFPYFWASKAEYEEYGISILDRR 465


>UniRef50_Q3M0Y1 Cluster: Actin7-2; n=2; Paramecium tetraurelia|Rep:
           Actin7-2 - Paramecium tetraurelia
          Length = 387

 Score = 83.8 bits (198), Expect = 4e-15
 Identities = 48/143 (33%), Positives = 79/143 (55%), Gaps = 5/143 (3%)
 Frame = -3

Query: 700 KSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYANT 521
           ++YELPD   + I  E ++ PE L++P+    E  G+ +    S+ K D D RK+L  N 
Sbjct: 247 QAYELPDQNKLLISEEMYKYPEFLYEPTEF-FE--GMDKALETSLEKIDSDYRKELVQNV 303

Query: 520 VLSGGTTMYPGIADRMQKEITALA----PSTMKIKIIAPP-ERKYSVWIGGSILASLSTF 356
           VL GG +    + +R Q+ I  L      S  K++ +    +R+++ WIG SI+AS   +
Sbjct: 304 VLIGGASCTVNMVERFQRTINNLKIFGLSSRSKVQTLPKYFDRQHASWIGASIVASSQIY 363

Query: 355 QQMWISKQEYDESGPSIVHRKCF 287
            Q  ++K +YDE G S++ +K F
Sbjct: 364 DQWTLNKSDYDEHGSSLIEKKMF 386


>UniRef50_A7AQU0 Cluster: Actin-related, putative; n=1; Babesia
           bovis|Rep: Actin-related, putative - Babesia bovis
          Length = 508

 Score = 83.8 bits (198), Expect = 4e-15
 Identities = 45/122 (36%), Positives = 70/122 (57%), Gaps = 1/122 (0%)
 Frame = -3

Query: 676 QVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYANTVLSGGTTM 497
           QV T+G ERF+ PE LF P  LG+E CGI E  + +I+     I++DL  N +L+GG+T 
Sbjct: 381 QVATLGVERFQIPELLFNPQDLGLEECGIAELAHRTIILSPPCIQRDLANNILLTGGSTK 440

Query: 496 YPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILA-SLSTFQQMWISKQEYDE 320
           +PG   R+  E+  L P+   ++I +  +R  + + G  + A   STF +  I++  Y E
Sbjct: 441 FPGFERRLHDELCKLLPAEWDVQIHSSLDRALTSFYGARMFAKDDSTFLEAAITRNYYLE 500

Query: 319 SG 314
            G
Sbjct: 501 HG 502


>UniRef50_UPI0000498B53 Cluster: actin; n=1; Entamoeba histolytica
           HM-1:IMSS|Rep: actin - Entamoeba histolytica HM-1:IMSS
          Length = 338

 Score = 83.4 bits (197), Expect = 5e-15
 Identities = 39/120 (32%), Positives = 68/120 (56%), Gaps = 2/120 (1%)
 Frame = -3

Query: 643 CPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKE 464
           C E LF P  +     G+  T   S+MKCD D+  ++    +L+GGT++ P + +++   
Sbjct: 219 CRELLF-PLVIDESNIGVDNTVLKSLMKCDYDVIMEVSNRLILAGGTSLIPNLGEKVINT 277

Query: 463 ITALAPSTMK--IKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKC 290
           +    PS     IK   P  ++Y+ W GG+++A   + Q +W++K++Y+E+G  IV RKC
Sbjct: 278 MHTYFPSFSCEIIKGQTPTLQRYAAWRGGAMIADTKSIQNIWVTKKDYEENGIGIVDRKC 337


>UniRef50_Q383R8 Cluster: Actin-like protein, putative; n=4;
           Trypanosoma|Rep: Actin-like protein, putative -
           Trypanosoma brucei
          Length = 394

 Score = 82.6 bits (195), Expect = 9e-15
 Identities = 53/153 (34%), Positives = 80/153 (52%), Gaps = 19/153 (12%)
 Frame = -3

Query: 694 YELPDGQVITIGNERFRCPEALFQPSFLG-MEACGIHETTYN-------------SIMKC 557
           Y LPD Q I +   +F  PE LF PS  G +  CG +    N             +I K 
Sbjct: 241 YGLPDEQRIYVEESQFMVPELLFNPSAEGDIGCCGRNNAEVNVDASGVGAGGWTDAIAKV 300

Query: 556 DVDI----RKDLYANTVLSGGTTMYPGIADRMQKEITAL-APSTMKIKIIAPPERKYSVW 392
                   R  L  + VL GG TM+PGI  R+++E++AL A +  +   +A  +R  + W
Sbjct: 301 VESAPHFTRPHLLKSIVLGGGNTMFPGIEQRLRREVSALPASAECEANCVAFRDRDLAAW 360

Query: 391 IGGSILASLSTFQQMWISKQEYDESGPSIVHRK 293
           IGGS++AS+ TF  M +S+++Y E G ++VH +
Sbjct: 361 IGGSVVASMPTFPHMCLSRKDYLEKGATVVHER 393


>UniRef50_Q18PR4 Cluster: Actin-related protein; n=1; Porphyra
           yezoensis|Rep: Actin-related protein - Porphyra
           yezoensis
          Length = 573

 Score = 82.2 bits (194), Expect = 1e-14
 Identities = 36/102 (35%), Positives = 58/102 (56%)
 Frame = -3

Query: 601 ACGIHETTYNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKII 422
           + G+     +++   D    KDL+A   L+GGT+   G+ +R+  E+         +   
Sbjct: 469 SAGLSGLVLDALRSADQSTHKDLWAGICLTGGTSNLGGLFERLSGELMGHHFRARVLAAS 528

Query: 421 APPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHR 296
             PER++  W GGSILA+ + FQ+MW+SK +Y+E GPS +HR
Sbjct: 529 GVPERRFCTWTGGSILATFTDFQRMWVSKADYEEHGPSFLHR 570


>UniRef50_Q7SXV8 Cluster: ARP5 actin-related protein 5 homolog; n=6;
           Euteleostomi|Rep: ARP5 actin-related protein 5 homolog -
           Danio rerio (Zebrafish) (Brachydanio rerio)
          Length = 592

 Score = 81.8 bits (193), Expect = 2e-14
 Identities = 40/126 (31%), Positives = 63/126 (50%), Gaps = 1/126 (0%)
 Frame = -3

Query: 664 IGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYANTVLSGGTTMYPGI 485
           +G ER R PE +FQPS +G E  G+ ET    + +  ++ ++ L  N  L+GG   YPG+
Sbjct: 423 VGTERLRVPEIIFQPSLIGEEQMGLMETLQFVLEQYSLEQQEALVRNVFLTGGNLQYPGV 482

Query: 484 ADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM-WISKQEYDESGPS 308
            +R+++E+ A+ P     K+          W G    A  S      WIS+Q+Y+E G  
Sbjct: 483 KERVERELLAIRPFQSHFKVSVAGRPALDSWFGACDWALRSPADAPGWISRQDYEEKGGE 542

Query: 307 IVHRKC 290
            +   C
Sbjct: 543 YLSEHC 548


>UniRef50_Q6BXN0 Cluster: Actin-related protein 4; n=7;
           Saccharomycetales|Rep: Actin-related protein 4 -
           Debaryomyces hansenii (Yeast) (Torulaspora hansenii)
          Length = 492

 Score = 81.4 bits (192), Expect = 2e-14
 Identities = 40/112 (35%), Positives = 66/112 (58%), Gaps = 3/112 (2%)
 Frame = -3

Query: 640 PEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEI 461
           P    +PS    +  G+     +++   D+D+R  +  N +++GG ++ P + +R+  E+
Sbjct: 372 PSDAKKPSSKTSQIRGLTHLITHTLSTIDIDLRSSVAHNIIVTGGVSLIPQLTERLYSEL 431

Query: 460 TALAPSTMKIKIIA---PPERKYSVWIGGSILASLSTFQQMWISKQEYDESG 314
           +   P  +KI++ A     ER    WIGGS+LASL TF QMW+SKQEY+E+G
Sbjct: 432 SNSNPG-LKIRLHAVGNSSERFNQAWIGGSVLASLGTFHQMWVSKQEYEEAG 482


>UniRef50_A5CAW6 Cluster: Putative uncharacterized protein; n=1;
           Vitis vinifera|Rep: Putative uncharacterized protein -
           Vitis vinifera (Grape)
          Length = 451

 Score = 79.0 bits (186), Expect = 1e-13
 Identities = 40/130 (30%), Positives = 72/130 (55%), Gaps = 6/130 (4%)
 Frame = -3

Query: 697 SYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCD---VDIRKDLYA 527
           S+++      T+  ERF+  E LFQP   G+   G+H+   + +  C    +   +  + 
Sbjct: 308 SFQVASEGWFTLSRERFQTGEILFQPRMAGVTMMGLHQAVAHCMDHCQSAAITADESWFK 367

Query: 526 NTVLSGGTTMYPGIADRMQKEITALA-PSTMK-IKIIAPPERKYSVWIGGSILASLSTFQ 353
             VL+GG+   PG+A+R++KE+  L  PS    I+++ PP  + S W G  I+++LSTF 
Sbjct: 368 TVVLAGGSACLPGLAERLEKELHGLVCPSVANGIRVLPPPYGEKSAWFGAKIISNLSTFP 427

Query: 352 QMW-ISKQEY 326
             W ++K+++
Sbjct: 428 GSWCMTKKQF 437


>UniRef50_Q4Q187 Cluster: Actin-like protein, putative; n=3;
           Leishmania|Rep: Actin-like protein, putative -
           Leishmania major
          Length = 407

 Score = 78.2 bits (184), Expect = 2e-13
 Identities = 34/83 (40%), Positives = 50/83 (60%)
 Frame = -3

Query: 547 IRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILAS 368
           + + LY N VL GG+T++PG   R+Q+EI  +AP  ++   +A PER  + W+G SI   
Sbjct: 321 LEQALYENVVLGGGSTLFPGTEQRVQREIAGIAPKGVRATCVAFPERGAAAWMGASIWGC 380

Query: 367 LSTFQQMWISKQEYDESGPSIVH 299
            S F    ++K  YDE G S+VH
Sbjct: 381 SSVFPDTCLAKATYDEQGSSVVH 403


>UniRef50_Q4P303 Cluster: Putative uncharacterized protein; n=1;
            Ustilago maydis|Rep: Putative uncharacterized protein -
            Ustilago maydis (Smut fungus)
          Length = 1173

 Score = 77.4 bits (182), Expect = 3e-13
 Identities = 37/116 (31%), Positives = 60/116 (51%), Gaps = 2/116 (1%)
 Frame = -3

Query: 655  ERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADR 476
            ER R PE L+QPS  G++  G+ E   + +   D ++R  +  N   +G  T Y G   R
Sbjct: 1044 ERIRVPEVLWQPSIAGLDQAGLDEICSHVVHSFDEEVRVKMLQNIFCTGRHTGYKGFEQR 1103

Query: 475  MQKEITALAPSTMKIKIIAPPERKYSVWIGGS--ILASLSTFQQMWISKQEYDESG 314
            +   I A+ PS + +K+    +R++  W G +   +    TF+   I+KQ+YDE G
Sbjct: 1104 LYSSIRAIQPSNVVVKVSGAKDRRFDAWKGAAKWSIKEAQTFRASSITKQDYDEKG 1159


>UniRef50_Q0J891 Cluster: Os08g0128300 protein; n=5; Oryza
           sativa|Rep: Os08g0128300 protein - Oryza sativa subsp.
           japonica (Rice)
          Length = 257

 Score = 77.0 bits (181), Expect = 4e-13
 Identities = 44/137 (32%), Positives = 68/137 (49%), Gaps = 15/137 (10%)
 Frame = -3

Query: 670 ITIGNERFRCPEALFQPSFLGME-ACGIHETTYNSIMKCDVDIRKDLYANTVLSGGTTMY 494
           I IG ERF  PE  F P     + +  + E   + +    +D R+DLY N VLSGG+TM+
Sbjct: 110 IDIGYERFLGPEIFFHPEIYSADFSTPLPELIDSCVQSAPIDTRRDLYKNIVLSGGSTMF 169

Query: 493 PGIADRMQKEITALAP--------------STMKIKIIAPPERKYSVWIGGSILASLSTF 356
                R+Q +I  +                  +++ ++A P + Y+ W GGS+ AS   F
Sbjct: 170 KDFHKRLQNDIKKIVDERVAATNARHHVEVKPVEVNVVAHPIQSYAAWFGGSVAASNPEF 229

Query: 355 QQMWISKQEYDESGPSI 305
            +   +K+EY+E G SI
Sbjct: 230 YESCHTKEEYEEHGASI 246


>UniRef50_Q0V0G6 Cluster: Putative uncharacterized protein; n=1;
           Phaeosphaeria nodorum|Rep: Putative uncharacterized
           protein - Phaeosphaeria nodorum (Septoria nodorum)
          Length = 443

 Score = 77.0 bits (181), Expect = 4e-13
 Identities = 37/132 (28%), Positives = 71/132 (53%), Gaps = 1/132 (0%)
 Frame = -3

Query: 685 PDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYANTVLSGG 506
           P   ++T+GNERF  PE LF PS +G++  GI      S+      ++  + +N V+ GG
Sbjct: 307 PREDLLTMGNERFAVPELLFNPSDIGIQESGIPGAVMESLSGLPEALKVGMLSNVVVVGG 366

Query: 505 TTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASL-STFQQMWISKQE 329
            ++  G  +R++ E+ A+ P+   + I+   +     W+G +  AS     +++ ++K E
Sbjct: 367 NSLIKGFIERLEDELRAIVPAQYLLNIVRAEDPIKHTWLGAARFASQPELLREVLVTKAE 426

Query: 328 YDESGPSIVHRK 293
           Y+E G + + +K
Sbjct: 427 YEERGSTWLLKK 438


>UniRef50_O94241 Cluster: Actin-like protein arp6; n=1;
           Schizosaccharomyces pombe|Rep: Actin-like protein arp6 -
           Schizosaccharomyces pombe (Fission yeast)
          Length = 401

 Score = 77.0 bits (181), Expect = 4e-13
 Identities = 42/128 (32%), Positives = 64/128 (50%)
 Frame = -3

Query: 676 QVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYANTVLSGGTTM 497
           QV+ + NERF  PE LF PS + +   GI E    S+     +I+  L  N V  GG   
Sbjct: 272 QVLNLSNERFMIPELLFSPSDIEIREAGIPEAVMQSVTHFPENIQAMLLENVVTIGGNCK 331

Query: 496 YPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDES 317
           +PG   R+  E+ +LAP+  ++K+  P +     W   S +  L  +    I++ EY E 
Sbjct: 332 FPGFHKRLSSELRSLAPANWEVKVFEPSDPICFPWKKASHM-PLEHWNANKITRSEYSEH 390

Query: 316 GPSIVHRK 293
           G +I+ RK
Sbjct: 391 GANIMTRK 398


>UniRef50_Q19R70 Cluster: Actin-like protein 3; n=4; Leishmania|Rep:
           Actin-like protein 3 - Leishmania major
          Length = 519

 Score = 76.6 bits (180), Expect = 6e-13
 Identities = 43/151 (28%), Positives = 76/151 (50%), Gaps = 12/151 (7%)
 Frame = -3

Query: 709 PLEKSYELPDGQVITIGN-ERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDL 533
           P    + LPDG  + +G  E  +  E LF P+ +G E  G+ +   +++     +++  L
Sbjct: 366 PFSHPFTLPDGSFLEVGGAEAAQASEVLFYPALMGSEGRGVVDVVLDAVAAAPAELQPQL 425

Query: 532 YANTVLSGGTTMYPGIADR----MQKEITALAPST------MKIKIIAPPERKYSVWIGG 383
             N V++GG T   G   R    MQ+ I   A S+       +I + AP +R Y+ W+G 
Sbjct: 426 LGNVVVTGGVTCSAGFGYRFFNEMQQRIRGCAASSTNGSSNQRICVSAPEQRAYAAWMGA 485

Query: 382 SILASLSTF-QQMWISKQEYDESGPSIVHRK 293
           S +A +S+F   M +++  Y+E G + + R+
Sbjct: 486 SYVAQISSFASSMVVTRAAYEEEGEAALARR 516


>UniRef50_A7AS14 Cluster: Actin, putative; n=1; Babesia bovis|Rep:
           Actin, putative - Babesia bovis
          Length = 382

 Score = 76.6 bits (180), Expect = 6e-13
 Identities = 46/151 (30%), Positives = 73/151 (48%), Gaps = 13/151 (8%)
 Frame = -3

Query: 706 LEKSYELPDGQVITIGN--------ERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDV 551
           LEK Y LPDGQ +  G         ERF   E LF P+ +G    G+ +  + SI    +
Sbjct: 229 LEKQYVLPDGQTLRDGETNVVGLSVERFYVCEILFNPTIIGFSHPGLSQLLWQSIQDSGL 288

Query: 550 DIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSV--WIGGSI 377
             RK L  N  L G ++ +  + +R+  E+  LAP+  +  I+    R   +  W G   
Sbjct: 289 TQRKLLMENIYLCGASSKFENLGERLSFELQNLAPAAARSNIMVNTSRDQHLLSWKGACF 348

Query: 376 LAS---LSTFQQMWISKQEYDESGPSIVHRK 293
           L +     T+++ WI+K +Y+E GP +  R+
Sbjct: 349 LGTPEVRQTYKEQWITKADYEEEGPRVFLRQ 379


>UniRef50_UPI0000449ED3 Cluster: PREDICTED: similar to RIKEN cDNA
           4921517D21 gene; n=2; Gallus gallus|Rep: PREDICTED:
           similar to RIKEN cDNA 4921517D21 gene - Gallus gallus
          Length = 321

 Score = 76.2 bits (179), Expect = 8e-13
 Identities = 45/124 (36%), Positives = 62/124 (50%)
 Frame = -3

Query: 658 NERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYANTVLSGGTTMYPGIAD 479
           +E  RC EALF P  LG+   G+ E    S+   +           +L+GGTT+  G   
Sbjct: 208 DEYSRCAEALFTPEALGVPGPGLLEMAARSLHLSEAQAGNP---PLLLAGGTTLLCGFDQ 264

Query: 478 RMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVH 299
           R+ + +    P+       A P R  + W+GGSI ASL  FQ  W+ +  Y E+GPS VH
Sbjct: 265 RVAQGLGRGHPA-------AAPSRHVAAWLGGSIAASLDAFQGSWLPRDIYIENGPSAVH 317

Query: 298 RKCF 287
           R CF
Sbjct: 318 RHCF 321


>UniRef50_Q09443 Cluster: Actin-like protein C08B11.6; n=2;
           Caenorhabditis|Rep: Actin-like protein C08B11.6 -
           Caenorhabditis elegans
          Length = 418

 Score = 75.4 bits (177), Expect = 1e-12
 Identities = 40/133 (30%), Positives = 72/133 (54%), Gaps = 3/133 (2%)
 Frame = -3

Query: 670 ITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYANTVLSGGTTMYP 491
           I +G ERF  PE LF PS + ++ CG+ E    SI +C   +R  L  N ++ GG++ +P
Sbjct: 263 IHLGVERFAIPEILFNPSDIDIDQCGVAEAVIESICQCPEALRPALAENIIVIGGSSCFP 322

Query: 490 GIADRMQKEITALAPSTMKIKI---IAPPERKYSVWIGGSILASLSTFQQMWISKQEYDE 320
           G  +R+++E+ ++ P+   + +   +  P+     W  G  L  L+  +  WI+++++DE
Sbjct: 323 GFRERLEREVRSMLPAEYGLNVSNDVINPQT--HSWHCGQEL--LTASKVPWINRKDWDE 378

Query: 319 SGPSIVHRKCF*T 281
            G S+     F T
Sbjct: 379 RGDSLEFSNFFQT 391


>UniRef50_A2G7Z1 Cluster: Actin family protein; n=1; Trichomonas
           vaginalis G3|Rep: Actin family protein - Trichomonas
           vaginalis G3
          Length = 270

 Score = 74.9 bits (176), Expect = 2e-12
 Identities = 41/132 (31%), Positives = 68/132 (51%)
 Frame = -3

Query: 691 ELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYANTVLS 512
           ++ D   + I +ER + PE LF P  +G +   I +T  +S+     D R  +  N VLS
Sbjct: 140 DVGDAGKVFITSERIKAPEVLFNPKLIGSDDESIIQTIKSSLNSLSEDDRNKVLQNVVLS 199

Query: 511 GGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQ 332
           GGTT  PG  +R++KE+         I+     + +++ + G   LA    F  + ++KQ
Sbjct: 200 GGTTNMPGFKERLEKEL----KEYRNIRFYGSADNEFAAFRGCVTLAMKDEFPWLCVTKQ 255

Query: 331 EYDESGPSIVHR 296
           EY+E G +I+ R
Sbjct: 256 EYEEFGDNILSR 267


>UniRef50_A2E0F7 Cluster: Actin family protein; n=1; Trichomonas
           vaginalis G3|Rep: Actin family protein - Trichomonas
           vaginalis G3
          Length = 409

 Score = 74.9 bits (176), Expect = 2e-12
 Identities = 36/103 (34%), Positives = 60/103 (58%), Gaps = 4/103 (3%)
 Frame = -3

Query: 586 ETTYNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPER 407
           +T  + I KC  D+++ ++ N +  GG +  PG+ D++++ +  L P    + II P   
Sbjct: 306 DTIADVIGKCPGDVQRLMWKNIIPVGGLSNVPGMYDKLRELLGRLVPRNYMVDIIPPMHP 365

Query: 406 ----KYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKC 290
                +SVW+GGSI+ SL  F +  ISKQE+ E G +I+ +KC
Sbjct: 366 MCNGSFSVWVGGSIMGSLDNFPEFCISKQEWSEQGEAILSKKC 408


>UniRef50_Q9LHH0 Cluster: Actin-like protein; n=11;
           Magnoliophyta|Rep: Actin-like protein - Arabidopsis
           thaliana (Mouse-ear cress)
          Length = 724

 Score = 74.5 bits (175), Expect = 2e-12
 Identities = 37/122 (30%), Positives = 65/122 (53%), Gaps = 3/122 (2%)
 Frame = -3

Query: 670 ITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKC---DVDIRKDLYANTVLSGGTT 500
           I IG ERFRCPE LF P+ +G++  G+ E    SI +    + ++ + L ++ +++GG +
Sbjct: 589 IVIGIERFRCPEILFHPNLIGIDQVGLDEMAGTSIRRLPHDEKELEERLTSSILMTGGCS 648

Query: 499 MYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDE 320
           + PG+ +R++  I  + P    I ++   +     W G S  A+   F     +K +YDE
Sbjct: 649 LLPGMNERLECGIRMIRPCGSPINVVRAMDPVLDAWRGASAFAANLNFLGNAFTKMDYDE 708

Query: 319 SG 314
            G
Sbjct: 709 KG 710


>UniRef50_Q8MVP6 Cluster: Avwa2 protein; n=1; Boltenia villosa|Rep:
           Avwa2 protein - Boltenia villosa
          Length = 152

 Score = 74.1 bits (174), Expect = 3e-12
 Identities = 31/42 (73%), Positives = 35/42 (83%)
 Frame = -3

Query: 643 CPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYANTV 518
           CP+ L QPSF+GM + GIHETTYNSIMKCD+DIRKDLY   V
Sbjct: 1   CPKTLXQPSFIGMXSXGIHETTYNSIMKCDIDIRKDLYNRDV 42


>UniRef50_Q4UGT7 Cluster: Actin-related protein, putative; n=2;
           Theileria|Rep: Actin-related protein, putative -
           Theileria annulata
          Length = 575

 Score = 73.3 bits (172), Expect = 5e-12
 Identities = 40/138 (28%), Positives = 68/138 (49%), Gaps = 1/138 (0%)
 Frame = -3

Query: 703 EKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYAN 524
           E   ++ + Q + +  ERF  PE +F P  + +  CGI E  Y SI  C   ++  L +N
Sbjct: 415 EYERDVDETQFVELFAERFSVPEIIFNPQDIKLNDCGIVELAYRSISLCPPIVQPLLASN 474

Query: 523 TVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASL-STFQQM 347
             + GGTT +PG   R  K++  + P    I+I +  +   + + G  +  +  S F   
Sbjct: 475 IFICGGTTKFPGFIKRFYKDLRPMIPQEWDIRIYSTDDPMLASFYGARMWTNNDSMFLSN 534

Query: 346 WISKQEYDESGPSIVHRK 293
            I++ EY E+G S++  K
Sbjct: 535 AITRSEYFENGASVIKIK 552


>UniRef50_A5E5Q2 Cluster: Putative uncharacterized protein; n=1;
           Lodderomyces elongisporus NRRL YB-4239|Rep: Putative
           uncharacterized protein - Lodderomyces elongisporus
           (Yeast) (Saccharomyces elongisporus)
          Length = 541

 Score = 72.9 bits (171), Expect = 7e-12
 Identities = 37/97 (38%), Positives = 58/97 (59%), Gaps = 3/97 (3%)
 Frame = -3

Query: 595 GIHETTYNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIA- 419
           G+ E     I   D+D+R  L  N +++GGT++   + +R+  E+T   P  +KI++ A 
Sbjct: 436 GLVELVSYVINNIDIDLRAGLANNIIITGGTSLVTQLTERLYHELTLKNPG-LKIRLHAV 494

Query: 418 --PPERKYSVWIGGSILASLSTFQQMWISKQEYDESG 314
               ER    WIG S+LASL TF QMW+SK+E+++ G
Sbjct: 495 GNSTERINQSWIGASVLASLGTFHQMWVSKKEWEDEG 531



 Score = 35.5 bits (78), Expect = 1.3
 Identities = 14/28 (50%), Positives = 19/28 (67%)
 Frame = -3

Query: 703 EKSYELPDGQVITIGNERFRCPEALFQP 620
           ++ +ELP GQ IT+G ERF   E +F P
Sbjct: 351 QRLFELPTGQSITMGQERFTIAETIFDP 378


>UniRef50_Q22XS7 Cluster: Actin family protein; n=1; Tetrahymena
           thermophila SB210|Rep: Actin family protein -
           Tetrahymena thermophila SB210
          Length = 725

 Score = 72.1 bits (169), Expect = 1e-11
 Identities = 35/119 (29%), Positives = 65/119 (54%)
 Frame = -3

Query: 670 ITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYANTVLSGGTTMYP 491
           +T+  ERF  PE LF PS +G++ CGI +   + I +   DI++  Y N +L GG++ + 
Sbjct: 273 LTLDKERFTLPEILFNPSDIGLDQCGISQGASSVIKEIHPDIKEYFYENIILCGGSSNFV 332

Query: 490 GIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESG 314
           G+ +R+  E+T   P  +  K++   +   S + G   + S   F+ + +++ +Y E G
Sbjct: 333 GLKERLLNEVTQNTPDYLDNKLVHLKDTS-SAYQGCQRVTSGDNFEMLAMNRNDYKEYG 390


>UniRef50_UPI0000E4A0BF Cluster: PREDICTED: similar to Actin-related
           protein 5; n=2; Strongylocentrotus purpuratus|Rep:
           PREDICTED: similar to Actin-related protein 5 -
           Strongylocentrotus purpuratus
          Length = 602

 Score = 70.9 bits (166), Expect = 3e-11
 Identities = 35/128 (27%), Positives = 64/128 (50%)
 Frame = -3

Query: 697 SYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYANTV 518
           +++L +   + +G ER R  E LFQPS +G+E  G+ ET    + + + + +  L  N  
Sbjct: 452 TFDLAEYYQLALGVERIRVAETLFQPSIMGLEQGGMAETMEYVLRQYEPETQDKLVQNVF 511

Query: 517 LSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWIS 338
           ++GG   YP + +R++ E+ A+ P      +          W G +  A  +T    +I+
Sbjct: 512 VTGGNLSYPNMVERIEHELRAMRPFQSLFNVKRAGNPSLDAWCGAAKWALDTTNLSSFIT 571

Query: 337 KQEYDESG 314
           + EY+E G
Sbjct: 572 RSEYEEKG 579


>UniRef50_Q9Y7X8 Cluster: Actin-like protein Arp5; n=1;
           Schizosaccharomyces pombe|Rep: Actin-like protein Arp5 -
           Schizosaccharomyces pombe (Fission yeast)
          Length = 721

 Score = 70.1 bits (164), Expect = 5e-11
 Identities = 31/118 (26%), Positives = 62/118 (52%)
 Frame = -3

Query: 655 ERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADR 476
           E+ R PE +F PS +G++  GI E   + + +  ++ ++ L +N +++GG    PG+  R
Sbjct: 594 EQIRVPEVIFSPSIVGIDQAGILEIMRSILQRHSLEEQQKLVSNVLITGGLGSLPGMETR 653

Query: 475 MQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIV 302
           +++E+T++ P    I +          W G S  +    F+   ++++EY E GP  +
Sbjct: 654 IKRELTSIMPVGSSINVFRASNPLLDAWKGASEWSVTEKFKAAKVTREEYLEKGPEYI 711


>UniRef50_Q9FKT0 Cluster: Actin-related protein 8; n=23;
           Magnoliophyta|Rep: Actin-related protein 8 - Arabidopsis
           thaliana (Mouse-ear cress)
          Length = 471

 Score = 70.1 bits (164), Expect = 5e-11
 Identities = 39/132 (29%), Positives = 71/132 (53%), Gaps = 6/132 (4%)
 Frame = -3

Query: 703 EKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCD-VDIRKD--L 533
           + S E+      T+  ERF+  E LFQP   GM A  +H+     +  CD   +  D   
Sbjct: 332 QASVEVSGEGWFTLSKERFQTGEILFQPRLAGMRAMSLHQAVSLCMDHCDAAGLTGDDSW 391

Query: 532 YANTVLSGGTTMYPGIADRMQKEITALAPSTMK--IKIIAPPERKYSVWIGGSILASLST 359
           +   VL+GG+   PG+++R+++E+    PS++   I++I PP    + W G  ++++LS 
Sbjct: 392 FKTVVLTGGSACLPGLSERLERELQDHLPSSISNGIRVIPPPYGVDTSWHGAKLISNLSI 451

Query: 358 FQQMW-ISKQEY 326
           F   W I+++++
Sbjct: 452 FPGPWCITRKQF 463


>UniRef50_Q17GZ9 Cluster: Actin-related protein 5; n=4;
           Endopterygota|Rep: Actin-related protein 5 - Aedes
           aegypti (Yellowfever mosquito)
          Length = 655

 Score = 69.7 bits (163), Expect = 7e-11
 Identities = 37/117 (31%), Positives = 57/117 (48%)
 Frame = -3

Query: 664 IGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYANTVLSGGTTMYPGI 485
           IG ER R PE LFQPS +G++  G+  T    +     + +  L  N +L+GG     G 
Sbjct: 510 IGVERIRVPEILFQPSMIGVQEAGLTGTIDYVLKLFPKEDQVKLVGNVMLTGGCANIRGF 569

Query: 484 ADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESG 314
            +R+ +E+ A+ P      ++         W G S  A+   F+Q  I++Q YDE G
Sbjct: 570 KERLSRELQAILPFQSVYNLMVAGSPSLDAWRGASQFANSQEFKQSLITRQLYDECG 626


>UniRef50_A2D880 Cluster: Actin family protein; n=1; Trichomonas
           vaginalis G3|Rep: Actin family protein - Trichomonas
           vaginalis G3
          Length = 410

 Score = 69.3 bits (162), Expect = 9e-11
 Identities = 42/144 (29%), Positives = 69/144 (47%), Gaps = 5/144 (3%)
 Frame = -3

Query: 706 LEKSYELPDGQVITIGNE-RFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLY 530
           L+  Y +P  + + I +E  F  P    Q   +      +    YN+I     D+    +
Sbjct: 266 LDYIYFMPGRRPLEIKDEINFLKPLLWQQTEGVPQSNIPLQNVVYNAIDSSPKDLHSTFW 325

Query: 529 ANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAP----PERKYSVWIGGSILASLS 362
            N + SGG +  PG   +++++   +AP   +  ++ P          VW GGSI+ASL 
Sbjct: 326 KNIITSGGLSRIPGFNAKLEQKARQIAPKRTEPHVVRPLADVAAGSRCVWTGGSIVASLP 385

Query: 361 TFQQMWISKQEYDESGPSIVHRKC 290
            F Q+ I+K E++E G SI+ RKC
Sbjct: 386 NFDQLCITKAEWEEFGNSILLRKC 409


>UniRef50_Q7RLT3 Cluster: Unnamed protein product; n=2; Plasmodium
            (Vinckeia)|Rep: Unnamed protein product - Plasmodium
            yoelii yoelii
          Length = 893

 Score = 68.9 bits (161), Expect = 1e-10
 Identities = 37/124 (29%), Positives = 62/124 (50%), Gaps = 1/124 (0%)
 Frame = -3

Query: 682  DGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYANTVLSGGT 503
            D  +I + NER   PE LF P  + +  C I E  Y  I     +I+K   +   +SGG+
Sbjct: 767  DDNIINLTNERIGIPEILFNPQDVNLNHCSIVELIYRCISLLPKEIQKYFLSQIYISGGS 826

Query: 502  TMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSI-LASLSTFQQMWISKQEY 326
            T +     R+ KE+ A+ P+  +I I +     YS +IG  + L+  + +    I++Q+Y
Sbjct: 827  TKFKNFKHRLYKELRAIFPTEWEINIYSHKNSLYSNYIGTYVWLSDQNIYNYNLITRQQY 886

Query: 325  DESG 314
              +G
Sbjct: 887  FNNG 890


>UniRef50_Q7QA11 Cluster: ENSANGP00000003921; n=1; Anopheles gambiae
           str. PEST|Rep: ENSANGP00000003921 - Anopheles gambiae
           str. PEST
          Length = 390

 Score = 68.9 bits (161), Expect = 1e-10
 Identities = 38/117 (32%), Positives = 55/117 (47%)
 Frame = -3

Query: 664 IGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYANTVLSGGTTMYPGI 485
           +G ER R PE LFQPS +G    G+ ET    +     + R  L  N  L+GG     G+
Sbjct: 267 VGVERIRAPEILFQPSIIGSYEAGLAETIDFVLKLFPAEQRGCLVNNIFLTGGCAKIRGL 326

Query: 484 ADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESG 314
            DR+ +E+  + P   + +I    E     W G S      TF+Q  I++  Y+E G
Sbjct: 327 KDRLSREMREMLPFESRFEIEVAREPVLDAWNGASKFCLTETFRQSLITRPMYEECG 383


>UniRef50_Q54E71 Cluster: Putative uncharacterized protein; n=1;
           Dictyostelium discoideum AX4|Rep: Putative
           uncharacterized protein - Dictyostelium discoideum AX4
          Length = 684

 Score = 67.7 bits (158), Expect = 3e-10
 Identities = 42/136 (30%), Positives = 69/136 (50%), Gaps = 4/136 (2%)
 Frame = -3

Query: 709 PLEKSYELPDGQVITIGNERFRCPEALFQP-SFLGMEACGIHETTYNSIM-KCDVDIRKD 536
           P+ + +   D QV ++G ER +CPE LFQP + +G++  G+ E   +SI+ +  VD RK 
Sbjct: 535 PIGEYHTAEDFQV-SLGVERIKCPETLFQPKAIIGVDQMGLVEAIISSILSQLPVDTRKL 593

Query: 535 LYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGS--ILASLS 362
           +  N  L+GG        DR+  EI  +      + I+   + +   W+G     L +  
Sbjct: 594 VTENIFLTGGNVNTKHFKDRIHYEIQQIREPYSPLTILKSKDSQLDAWLGARKWCLDNQD 653

Query: 361 TFQQMWISKQEYDESG 314
            +  + ISKQ+Y E G
Sbjct: 654 NWSNVSISKQDYQEKG 669


>UniRef50_Q5KAQ4 Cluster: Actin-like protein ARP6; n=1;
           Filobasidiella neoformans|Rep: Actin-like protein ARP6 -
           Cryptococcus neoformans (Filobasidiella neoformans)
          Length = 490

 Score = 66.9 bits (156), Expect = 5e-10
 Identities = 37/129 (28%), Positives = 66/129 (51%), Gaps = 1/129 (0%)
 Frame = -3

Query: 676 QVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYANTVLSGGTTM 497
           QV+ +GNERF  PE LF PS +G++  G+ ET    I +   ++R   +A+  + GG   
Sbjct: 288 QVLWMGNERFAGPELLFHPSDIGLKQTGLPETIAYVISQMPEELRGMFWAHIGIIGGLGN 347

Query: 496 YPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMW-ISKQEYDE 320
              + +R+++++ AL P   +I I    +     +   + L S   +   + +++ EY E
Sbjct: 348 IENLGERLERDLQALCPVEYEIGIYEAFDPASLAYTSATALTSSEVYMSTYPVTRTEYFE 407

Query: 319 SGPSIVHRK 293
            G S+  RK
Sbjct: 408 QGSSLCRRK 416


>UniRef50_Q9VEC3 Cluster: Actin-related protein 5; n=1; Drosophila
           melanogaster|Rep: Actin-related protein 5 - Drosophila
           melanogaster (Fruit fly)
          Length = 648

 Score = 66.9 bits (156), Expect = 5e-10
 Identities = 40/131 (30%), Positives = 60/131 (45%)
 Frame = -3

Query: 661 GNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYANTVLSGGTTMYPGIA 482
           G E  R PE LFQPS +G    G+ E     +       ++ L  +  L+GG   + G+ 
Sbjct: 514 GVENIRVPEVLFQPSMIGCSEAGLAELIAFVLKLFPAAEQQRLVEHVYLTGGCAQFKGLK 573

Query: 481 DRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIV 302
           +R+ KE+  + P   K  I    E   S W+G  + A   TF Q   ++Q++ E G    
Sbjct: 574 ERLIKELMEMRPFQSKFAIYESDEPTLSAWLGACVHAGEPTFGQTLTTRQDHQEHG---- 629

Query: 301 HRKCF*THRAS 269
            R+ F  H AS
Sbjct: 630 -REFFREHTAS 639


>UniRef50_UPI0000498FDF Cluster: actin; n=1; Entamoeba histolytica
           HM-1:IMSS|Rep: actin - Entamoeba histolytica HM-1:IMSS
          Length = 763

 Score = 66.5 bits (155), Expect = 6e-10
 Identities = 38/111 (34%), Positives = 58/111 (52%), Gaps = 3/111 (2%)
 Frame = -3

Query: 697 SYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHE---TTYNSIMKCDVDIRKDLYA 527
           +Y LPDG  +TIGN R +C E LF P    M   GI +   T   +I  C  +I      
Sbjct: 639 NYSLPDGTSLTIGNSRVQCFEPLFNPQLCAMNCSGISQMIATVLRNINGCTNEI------ 692

Query: 526 NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSIL 374
             +L GG ++  G+ +R++ +I  L     KI +IA   RK++ W+G ++L
Sbjct: 693 --ILVGGGSLIKGLKERIENDIQQLL--NFKINVIAEDNRKFASWLGANLL 739


>UniRef50_A5KAY0 Cluster: Actin-related protein, putative; n=1;
           Plasmodium vivax|Rep: Actin-related protein, putative -
           Plasmodium vivax
          Length = 600

 Score = 66.5 bits (155), Expect = 6e-10
 Identities = 46/156 (29%), Positives = 72/156 (46%), Gaps = 21/156 (13%)
 Frame = -3

Query: 694 YELPDGQVITIGNERFRCPEALFQPSFLGMEAC---------------GIHETTYNSIMK 560
           Y LPDGQ I I        E  F PS L                    G+  T +N +  
Sbjct: 445 YILPDGQNINISKFNNIACEIFFTPSLLSNTKLNHHLGNLFFKEEQFEGVSTTLFNMLNG 504

Query: 559 CDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALA----PSTMKIKIIAPP--ERKYS 398
             V  +++L  N +L+G +T++     R  KE   L      +    ++++    +++YS
Sbjct: 505 KCVKQKEELLRNVILTGSSTLFDNFNQRFIKEFNHLDMMNNSNLQNFQVLSHGKYDKQYS 564

Query: 397 VWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKC 290
            W GGSIL+S   F   +++++EY+E G  IVHRKC
Sbjct: 565 SWKGGSILSSFKNFNSFFVTRREYEEFGLDIVHRKC 600


>UniRef50_A2FRF9 Cluster: Actin family protein; n=1; Trichomonas
           vaginalis G3|Rep: Actin family protein - Trichomonas
           vaginalis G3
          Length = 543

 Score = 66.5 bits (155), Expect = 6e-10
 Identities = 31/62 (50%), Positives = 38/62 (61%)
 Frame = -3

Query: 472 QKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRK 293
           QK      P  +   + APPERK SVWIGGS+L SL  F  + ISK+EY E+G  IV  K
Sbjct: 481 QKARKVKVPVGLNAHVTAPPERKNSVWIGGSVLGSLDQFPDLLISKEEYKETGSWIVQMK 540

Query: 292 CF 287
           C+
Sbjct: 541 CY 542



 Score = 54.4 bits (125), Expect = 3e-06
 Identities = 27/80 (33%), Positives = 43/80 (53%), Gaps = 2/80 (2%)
 Frame = -3

Query: 637 EALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEIT 458
           E LF PS   +    I ET   S++  D  +R ++  N VLSGG +M+ G+ +RM+ EI 
Sbjct: 257 EVLFNPSIAQLSTPSIPETIVQSLLLVDTAVRYEMLPNVVLSGGCSMFSGLPERMESEII 316

Query: 457 A--LAPSTMKIKIIAPPERK 404
              + P     + + PP+R+
Sbjct: 317 GIDIKPLLQPGETLPPPKRR 336


>UniRef50_A4S172 Cluster: Predicted protein; n=3; Ostreococcus|Rep:
           Predicted protein - Ostreococcus lucimarinus CCE9901
          Length = 503

 Score = 65.7 bits (153), Expect = 1e-09
 Identities = 36/131 (27%), Positives = 67/131 (51%), Gaps = 4/131 (3%)
 Frame = -3

Query: 685 PDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVD---IRKDLYANTVL 515
           P+ Q +T+ NERF  PE LF PS +G   CG+ E    ++   D+    +R   Y + ++
Sbjct: 318 PEHQFLTLVNERFMVPEVLFHPSDIGGRQCGVAELVTQAVENEDLSNEAMRALAYLDVIV 377

Query: 514 SGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGG-SILASLSTFQQMWIS 338
           +GG + +P   +R ++E+  L   +  ++I    +   +  +GG  I      F++  ++
Sbjct: 378 TGGCSKFPNFMERFERELRPLVSESYMLRIRQMDDPIQAACLGGVDIAKDREFFEKHALT 437

Query: 337 KQEYDESGPSI 305
           K+EY  +  SI
Sbjct: 438 KEEYLANKTSI 448


>UniRef50_A5KC80 Cluster: Putative uncharacterized protein; n=1;
            Plasmodium vivax|Rep: Putative uncharacterized protein -
            Plasmodium vivax
          Length = 855

 Score = 65.7 bits (153), Expect = 1e-09
 Identities = 37/121 (30%), Positives = 59/121 (48%), Gaps = 1/121 (0%)
 Frame = -3

Query: 673  VITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYANTVLSGGTTMY 494
            VI + NER   PE LF P  + +E C I E  Y  I     +I++   A   +SGG+T +
Sbjct: 732  VINLTNERIAIPEVLFNPKDINLEHCSIVELIYRCISLLPKEIQRYFLAQIYISGGSTKF 791

Query: 493  PGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSI-LASLSTFQQMWISKQEYDES 317
                 R+ KE+  + PS   I I +     YS +IG  + L+  + +    I++++Y   
Sbjct: 792  TNFKHRLYKELRGMFPSEWDINIYSHRNGLYSNYIGTYVWLSDHNIYSYNVITREQYFSH 851

Query: 316  G 314
            G
Sbjct: 852  G 852


>UniRef50_A2F9B6 Cluster: Actin family protein; n=1; Trichomonas
           vaginalis G3|Rep: Actin family protein - Trichomonas
           vaginalis G3
          Length = 329

 Score = 65.7 bits (153), Expect = 1e-09
 Identities = 37/125 (29%), Positives = 61/125 (48%), Gaps = 2/125 (1%)
 Frame = -3

Query: 670 ITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYANTVLSGGTTMYP 491
           I  G ER     A  +P FL +++ G+       I+KC ++ RKD++ + VL GG+    
Sbjct: 201 INFGPERVIASTAYLRPFFLEIDSDGLAVDIKEVIVKCPINFRKDMWTHVVLIGGSAQIK 260

Query: 490 GIADRMQKEITALAPSTMK--IKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDES 317
           G A  +Q+ +  LAP  +K  + +    + + + WIG S  A+        + K +YD  
Sbjct: 261 GFATALQEALVELAPEAVKPEVHVSVAEKPQIASWIGASAYAAAK--PNAAVLKSDYDTE 318

Query: 316 GPSIV 302
           G  IV
Sbjct: 319 GEKIV 323


>UniRef50_Q7RR61 Cluster: Actin-like 6; n=3; Plasmodium
           (Vinckeia)|Rep: Actin-like 6 - Plasmodium yoelii yoelii
          Length = 538

 Score = 65.3 bits (152), Expect = 1e-09
 Identities = 47/157 (29%), Positives = 73/157 (46%), Gaps = 22/157 (14%)
 Frame = -3

Query: 694 YELPDGQVITIGNERFRCPEALFQPSFLGMEAC---------------GIHETTYNSIMK 560
           Y LPDGQ I I        E  F PS L                    GIH T +N +  
Sbjct: 382 YILPDGQNINITKFTNIACEIFFTPSLLNDTTINTHLNNLYTKDKTFEGIHTTLFNMLQN 441

Query: 559 C-DVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALA----PSTMKIKIIAPPE--RKY 401
              ++ ++DL  N +L+G +T++    +R   E   L      +    +++   +  +KY
Sbjct: 442 IKSIEHKQDLINNIILTGSSTLFQNFNERFINEFANLDILNNTNLQNYQVLNNGKEFKKY 501

Query: 400 SVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKC 290
           S W GGSIL+S   F   +++++EY+E G  IV+RKC
Sbjct: 502 SSWKGGSILSSFKNFNSFFVTRKEYEEFGFEIVNRKC 538


>UniRef50_P53946 Cluster: Actin-related protein 5; n=7;
            Saccharomycetales|Rep: Actin-related protein 5 -
            Saccharomyces cerevisiae (Baker's yeast)
          Length = 755

 Score = 64.9 bits (151), Expect = 2e-09
 Identities = 40/146 (27%), Positives = 68/146 (46%), Gaps = 8/146 (5%)
 Frame = -3

Query: 715  GPPLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCD------ 554
            GP    S  + +   + +  ER R PE +FQP+  G +  GI E +   ++K        
Sbjct: 597  GPRPHDSENIHEQHQMHLNVERIRVPEVIFQPTMGGQDQAGICELSETILLKKFGSQPGK 656

Query: 553  -VDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSI 377
                  D+  N +++GG    PG+ +R+ KE T   P+   I +    +     W G + 
Sbjct: 657  LSQTSIDMVNNVLITGGNAKVPGLKERIVKEFTGFLPTGTNITVNMSSDPSLDAWKGMAA 716

Query: 376  LA-SLSTFQQMWISKQEYDESGPSIV 302
            LA +   +++  ISK+EY+E GP  +
Sbjct: 717  LARNEEQYRKTVISKKEYEEYGPEYI 742


>UniRef50_Q8IBQ9 Cluster: Putative uncharacterized protein PF07_0077;
            n=2; Plasmodium|Rep: Putative uncharacterized protein
            PF07_0077 - Plasmodium falciparum (isolate 3D7)
          Length = 1032

 Score = 64.5 bits (150), Expect = 2e-09
 Identities = 38/121 (31%), Positives = 58/121 (47%), Gaps = 1/121 (0%)
 Frame = -3

Query: 673  VITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYANTVLSGGTTMY 494
            VI + NER   PE LF P  + +E C I E  Y  I      I+K   +   +SGG+T +
Sbjct: 900  VINLTNERIGIPEILFNPQDINLEHCSIVELVYRCISLLPKHIQKYFVSQIYISGGSTKF 959

Query: 493  PGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSI-LASLSTFQQMWISKQEYDES 317
                 R+ KE+  + PS   I I +     YS +IG  + L+  S +    I++++Y   
Sbjct: 960  RNFKHRLYKELRQVFPSDWDINIYSHKNSLYSNYIGTYVWLSDPSIYNYNVITREQYFNF 1019

Query: 316  G 314
            G
Sbjct: 1020 G 1020


>UniRef50_Q293V2 Cluster: Actin-related protein 5; n=2; Drosophila
           pseudoobscura|Rep: Actin-related protein 5 - Drosophila
           pseudoobscura (Fruit fly)
          Length = 651

 Score = 64.5 bits (150), Expect = 2e-09
 Identities = 37/131 (28%), Positives = 59/131 (45%)
 Frame = -3

Query: 661 GNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYANTVLSGGTTMYPGIA 482
           G E  R PE LFQPS +G    G+ E     +       ++ +  +  L+GG   + G+ 
Sbjct: 517 GVEDIRVPEILFQPSMIGSPEAGLAELIAFVLKLFTAQEQQRMVEHVYLTGGCAQFRGLK 576

Query: 481 DRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIV 302
           +R+ +E   + P   K  I    +   S W+G  + AS   F Q   ++++Y E G    
Sbjct: 577 ERLAREFLEMRPFQSKFSIYESDDHTLSAWLGACVQASQPNFGQTLTTRKDYQEHG---- 632

Query: 301 HRKCF*THRAS 269
             + F  HRAS
Sbjct: 633 -SEYFREHRAS 642


>UniRef50_Q8MVM8 Cluster: Notochord actin-like protein; n=1;
           Boltenia villosa|Rep: Notochord actin-like protein -
           Boltenia villosa
          Length = 111

 Score = 62.9 bits (146), Expect = 8e-09
 Identities = 29/54 (53%), Positives = 35/54 (64%), Gaps = 1/54 (1%)
 Frame = -3

Query: 691 ELPDGQVITIGNERFRCPEALF-QPSFLGMEACGIHETTYNSIMKCDVDIRKDL 533
           +LPDGQV + GNERFRCPE  F   SF G+E+ G      +SI KC +D  KDL
Sbjct: 58  QLPDGQVFSFGNERFRCPETXFXSXSFXGVESAGXPRNYLHSIXKCXIDXPKDL 111


>UniRef50_Q4UGE2 Cluster: Actin-related protein, putative; n=2;
           Theileria|Rep: Actin-related protein, putative -
           Theileria annulata
          Length = 538

 Score = 62.1 bits (144), Expect = 1e-08
 Identities = 39/139 (28%), Positives = 72/139 (51%), Gaps = 11/139 (7%)
 Frame = -3

Query: 676 QVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYANTVLSGGTTM 497
           Q++ I  E    P+  + P F+ + +          +++ +   R+D++   VL GG + 
Sbjct: 392 QLVGISCEVLFNPQIAYVPKFIDLGSFRGVVPICEDLLRDNSTYRRDIFGQIVLVGGFSG 451

Query: 496 YPGIADRMQKEITALA-----PSTM---KIKII---APPERKYSVWIGGSILASLSTFQQ 350
             G+ +R+  E+   +      ST+   K K +   +    +++ WIG SIL+SL +F +
Sbjct: 452 ASGLQERLTMEMNRASGKSPQESTLSGTKCKFVTFNSKQASRHASWIGASILSSLGSFHK 511

Query: 349 MWISKQEYDESGPSIVHRK 293
            WIS+ EY+E GP+I +RK
Sbjct: 512 CWISRLEYNEHGPNIANRK 530


>UniRef50_Q4QF49 Cluster: Actin-like protein, putative; n=2;
           Leishmania|Rep: Actin-like protein, putative -
           Leishmania major
          Length = 440

 Score = 61.7 bits (143), Expect = 2e-08
 Identities = 33/108 (30%), Positives = 59/108 (54%), Gaps = 6/108 (5%)
 Frame = -3

Query: 592 IHETTYNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKI------ 431
           I E   +++ +CD D+     ++ V+SGG ++  G+  R++ ++     ST  I      
Sbjct: 333 IPELVVDAMKRCDHDLLPTFASHIVVSGGASLLRGLTQRVESDVQTCLASTGGIHSVGSA 392

Query: 430 KIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 287
           ++ A  ER+ + ++GGSI ASL   Q +W++K +Y+E G   V R  F
Sbjct: 393 RVYADVERRDAAFVGGSIWASLPAAQALWVTKADYNEVGSMAVVRGGF 440


>UniRef50_Q6CJF4 Cluster: Actin-like protein ARP6; n=2;
           Saccharomycetaceae|Rep: Actin-like protein ARP6 -
           Kluyveromyces lactis (Yeast) (Candida sphaerica)
          Length = 415

 Score = 61.7 bits (143), Expect = 2e-08
 Identities = 37/125 (29%), Positives = 56/125 (44%), Gaps = 2/125 (1%)
 Frame = -3

Query: 682 DGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYANTVLSGGT 503
           D Q + + +E F  PE  F P    +   GI ET    I  C   +R  L AN V +GG 
Sbjct: 276 DAQTLLLTDEVFSVPETFFHPEIAQILKPGIVETILECINMCPEVVRPLLVANIVCTGGN 335

Query: 502 TMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSV--WIGGSILASLSTFQQMWISKQE 329
              P   +R+Q E+    P     K+ +P E+  S+  W      A+   F+   ++++E
Sbjct: 336 FNIPNFHERLQTELQRQCPIDWSCKVHSPQEKDKSLHGWESMKDFANSDQFRSARVTREE 395

Query: 328 YDESG 314
           Y E G
Sbjct: 396 YLEHG 400


>UniRef50_UPI0000498A93 Cluster: actin; n=1; Entamoeba histolytica
           HM-1:IMSS|Rep: actin - Entamoeba histolytica HM-1:IMSS
          Length = 360

 Score = 60.1 bits (139), Expect = 5e-08
 Identities = 38/138 (27%), Positives = 65/138 (47%), Gaps = 5/138 (3%)
 Frame = -3

Query: 700 KSYELPDGQVITIGNERFRCPEALFQPSFLGM--EACGIHETTYNSIMKCDVDIRKDLYA 527
           K Y LPDG+VI+I        E L  P  +    E  GI +   + +MKC +D R DL+ 
Sbjct: 217 KEYTLPDGKVISINC--CDVIEPLIVPMSIDKKNEMQGIAKMIVDCVMKCPIDCRSDLFG 274

Query: 526 NTVLSGGTTMYPGIADRMQKEITALAP---STMKIKIIAPPERKYSVWIGGSILASLSTF 356
              L G  +   G+  R++ +I  +     +   +K+      +   W G +   +LS+ 
Sbjct: 275 TINLIGAASKLKGMGTRIKNDIIKILKDQGNNAHVKVNVFDNSEVLAWYGAACTGALSSI 334

Query: 355 QQMWISKQEYDESGPSIV 302
            + + +K++YDE+G   V
Sbjct: 335 VERYCTKEQYDENGSFFV 352


>UniRef50_A5BLP0 Cluster: Putative uncharacterized protein; n=1;
           Vitis vinifera|Rep: Putative uncharacterized protein -
           Vitis vinifera (Grape)
          Length = 252

 Score = 59.7 bits (138), Expect = 7e-08
 Identities = 30/63 (47%), Positives = 36/63 (57%)
 Frame = +3

Query: 312 GPDSSYSCFEIHICWKVEREARIDPPIHTEYFLSGGAMILIFIVDGARAVISFCIRSAIP 491
           G   S    + HICWKV R+A IDPPI T   L+GG   LIF++ GA+A  S     AIP
Sbjct: 19  GESESDPLLDTHICWKVPRDADIDPPIQTLCLLAGGVTTLIFMLLGAKAATSLFTLPAIP 78

Query: 492 GYM 500
             M
Sbjct: 79  ENM 81


>UniRef50_UPI0000E477BD Cluster: PREDICTED: similar to
           uncharacterized hypothalamus protein HARP11; n=1;
           Strongylocentrotus purpuratus|Rep: PREDICTED: similar to
           uncharacterized hypothalamus protein HARP11 -
           Strongylocentrotus purpuratus
          Length = 481

 Score = 59.3 bits (137), Expect = 9e-08
 Identities = 39/139 (28%), Positives = 65/139 (46%), Gaps = 10/139 (7%)
 Frame = -3

Query: 712 PPLEKSYELPDGQVITI-GNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKD 536
           P     Y L  G+ +T+ G  R    E LF+   +  E   I     +SI+KC +D+RK 
Sbjct: 298 PAASVDYPLNGGRTLTMDGKSREVACEVLFE---MDNEEQSIATLVLDSILKCPIDMRKP 354

Query: 535 LYANTVLSGGTTMYPGIADRMQKEITALAP--------STMKIKIIAPP-ERKYSVWIGG 383
           L  N V  GGT++ PG + R+  E+  L          +    K+ +PP +  ++ W+GG
Sbjct: 355 LADNLVFIGGTSLLPGFSHRLLAELKLLLTKPKYKQCFAITTFKVHSPPAQANFTAWLGG 414

Query: 382 SILASLSTFQQMWISKQEY 326
           +I  +L       +S+  +
Sbjct: 415 AIFGALEVLSYRSLSRDAF 433


>UniRef50_UPI00006CC3F4 Cluster: Actin family protein; n=1;
           Tetrahymena thermophila SB210|Rep: Actin family protein
           - Tetrahymena thermophila SB210
          Length = 725

 Score = 59.3 bits (137), Expect = 9e-08
 Identities = 33/123 (26%), Positives = 63/123 (51%), Gaps = 2/123 (1%)
 Frame = -3

Query: 670 ITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYANTVLSGGTTMYP 491
           I +  +RFR  EA+FQP  +G++  G+ +     + K   + +  L +N  ++GG ++  
Sbjct: 587 IELSVDRFRGNEAIFQPGIVGVDQSGLSDVITFVLNKFPAETQAKLLSNIRITGGGSVMQ 646

Query: 490 GIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASL--STFQQMWISKQEYDES 317
           G+A RM++++T+       +++    E  +  W+G   +     +     +ISKQEY E 
Sbjct: 647 GLAKRMERDLTSNFKVGSVVQVNLMSEPIFGAWLGMQKVYKQYGNKLNDYFISKQEYFEK 706

Query: 316 GPS 308
           G S
Sbjct: 707 GSS 709


>UniRef50_Q8I450 Cluster: Actin-related protein, putative; n=5;
           Plasmodium|Rep: Actin-related protein, putative -
           Plasmodium falciparum (isolate 3D7)
          Length = 565

 Score = 58.0 bits (134), Expect = 2e-07
 Identities = 44/159 (27%), Positives = 70/159 (44%), Gaps = 24/159 (15%)
 Frame = -3

Query: 694 YELPDGQVITIGNERFRCPEALFQPSFLGMEAC----------------GIHETTYNSIM 563
           Y LPDGQ I I       PE  F PS L                     G  +T ++ + 
Sbjct: 407 YILPDGQNINITKFNNIAPEIFFTPSLLQNSNKLNHHLNNLFTKEDNFQGTPQTLFHLLK 466

Query: 562 KCD-VDIRKDLYANTVLSGGTTMYPGIADRMQKEITALA-----PSTMKIKII--APPER 407
             + +  R  L  N +++G +T+      R +KE   +       +   + I+     ++
Sbjct: 467 NLNSIKYRDSLINNVIITGSSTLLNNFNQRFEKEFNEININQNNTNLPNVHILNSGKSDK 526

Query: 406 KYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKC 290
           +YS W GGSILAS   F   +++++EY E G  I++RKC
Sbjct: 527 QYSSWKGGSILASFKNFNSFFVTRKEYQEYGFEIINRKC 565


>UniRef50_Q54JL1 Cluster: Putative uncharacterized protein; n=1;
           Dictyostelium discoideum AX4|Rep: Putative
           uncharacterized protein - Dictyostelium discoideum AX4
          Length = 414

 Score = 57.6 bits (133), Expect = 3e-07
 Identities = 44/137 (32%), Positives = 72/137 (52%), Gaps = 9/137 (6%)
 Frame = -3

Query: 697 SYELP-DGQVITIG-NERFRCPEALFQP-SFLGMEACG--IHETTYNSIMK---CDVDIR 542
           SY+L   G+ I IG ++R +C E LF+P S   +E     I ++  N+ +    C +DI+
Sbjct: 279 SYQLTGSGKTIEIGEDDRIKCGEYLFKPLSSSSLEGIDNLIMKSINNACLSNVDCSIDIK 338

Query: 541 KDLYANTVLSGGTTMYPGIADRMQKEI-TALAPSTMKIKIIAPPERKYSVWIGGSILASL 365
             L+ N +L GG+T + G  +R++ E+   L   T +   I      YS W+GGS    +
Sbjct: 339 NKLFNNILLCGGSTKFKGFIERLKIELGKKLENCTTQSINIKNNNNDYSSWLGGS---KI 395

Query: 364 STFQQMWISKQEYDESG 314
           S+ +  +IS   Y E+G
Sbjct: 396 SSNKSNFISYDIYQENG 412


>UniRef50_Q9NZ32 Cluster: Actin-related protein 10; n=40;
           Eumetazoa|Rep: Actin-related protein 10 - Homo sapiens
           (Human)
          Length = 417

 Score = 57.6 bits (133), Expect = 3e-07
 Identities = 44/144 (30%), Positives = 68/144 (47%), Gaps = 11/144 (7%)
 Frame = -3

Query: 712 PPLEKSYELPDGQVITI-GNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKD 536
           PP    Y L   +++ I G+ R    E LF+      E   +     +S+++C +D RK 
Sbjct: 242 PPPNVDYPLDGEKILHILGSIRDSVVEILFEQD---NEEQSVATLILDSLIQCPIDTRKQ 298

Query: 535 LYANTVLSGGTTMYPGIADRMQKEITAL--------APSTMKIKIIAPPERKYSV-WIGG 383
           L  N V+ GGT+M PG   R+  EI  L        A  T   +I  PP +   V W+GG
Sbjct: 299 LAENLVVIGGTSMLPGFLHRLLAEIRYLVEKPKYKKALGTKTFRIHTPPAKANCVAWLGG 358

Query: 382 SILASL-STFQQMWISKQEYDESG 314
           +I  +L        +SK+ Y+++G
Sbjct: 359 AIFGALQDILGSRSVSKEYYNQTG 382


>UniRef50_Q4WA13 Cluster: Chromatin remodeling complex subunit
           (Arp5), putative; n=14; Pezizomycotina|Rep: Chromatin
           remodeling complex subunit (Arp5), putative -
           Aspergillus fumigatus (Sartorya fumigata)
          Length = 757

 Score = 57.2 bits (132), Expect = 4e-07
 Identities = 31/125 (24%), Positives = 61/125 (48%), Gaps = 2/125 (1%)
 Frame = -3

Query: 670 ITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMK--CDVDIRKDLYANTVLSGGTTM 497
           I +  ER R PE +F+PS  G++  G+ E     + +   + + +  L  +  L+GG T+
Sbjct: 620 IHLNVERIRVPEVVFKPSIAGIDQAGLLEIAAGIVNQRFSNPEDQAKLLRDVFLTGGNTL 679

Query: 496 YPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDES 317
           + G  +R++ E+ +  P   ++ +    +     W G +  AS S  +   +S++EY E 
Sbjct: 680 FKGFDERIRNELRSYLPVDAQLNVRRASDPVLDAWKGAAQWASGSGLKNHSVSREEYLEK 739

Query: 316 GPSIV 302
           G   +
Sbjct: 740 GSEYI 744


>UniRef50_Q12509 Cluster: Actin-like protein ARP6; n=4;
           Saccharomycetales|Rep: Actin-like protein ARP6 -
           Saccharomyces cerevisiae (Baker's yeast)
          Length = 438

 Score = 57.2 bits (132), Expect = 4e-07
 Identities = 36/135 (26%), Positives = 60/135 (44%), Gaps = 2/135 (1%)
 Frame = -3

Query: 709 PLEKSYELP-DGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDL 533
           P +++  LP D Q+IT+ +E F  PE  F P    +   GI E    S+      +R  +
Sbjct: 290 PRKENVPLPEDAQIITLTDELFTIPETFFHPEISQITKPGIVEAILESLSMLPEIVRPLM 349

Query: 532 YANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPP-ERKYSVWIGGSILASLSTF 356
             N V +GG    P  A R+  E+    P+     +  P  +     W   S  A   ++
Sbjct: 350 VGNIVCTGGNFNLPNFAQRLAAELQRQLPTDWTCHVSVPEGDCALFGWEVMSQFAKTDSY 409

Query: 355 QQMWISKQEYDESGP 311
           ++  ++++EY E GP
Sbjct: 410 RKARVTREEYYEHGP 424


>UniRef50_UPI00015B5EE4 Cluster: PREDICTED: similar to Actin-related
           protein 10 homolog (S. cerevisiae); n=1; Nasonia
           vitripennis|Rep: PREDICTED: similar to Actin-related
           protein 10 homolog (S. cerevisiae) - Nasonia vitripennis
          Length = 373

 Score = 56.4 bits (130), Expect = 7e-07
 Identities = 33/94 (35%), Positives = 52/94 (55%), Gaps = 9/94 (9%)
 Frame = -3

Query: 574 NSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTM---KIKI------I 422
           ++++KC VD R+ L  N +L GGTTM  G A R++ E+  L  S +   K+K+       
Sbjct: 259 DALIKCPVDTRRQLAENILLIGGTTMAKGFASRLKSELLHLVNSELYAEKLKVRTFKFHS 318

Query: 421 APPERKYSVWIGGSILASLSTFQQMWISKQEYDE 320
           AP +  Y+ W+GG+I   ++      ISK+ Y E
Sbjct: 319 APSKPNYTAWLGGAIF-GIADLPSRCISKENYLE 351


>UniRef50_Q4Q2G7 Cluster: Actin-like protein, putative; n=3;
           Leishmania|Rep: Actin-like protein, putative -
           Leishmania major
          Length = 423

 Score = 56.0 bits (129), Expect = 9e-07
 Identities = 36/139 (25%), Positives = 70/139 (50%), Gaps = 4/139 (2%)
 Frame = -3

Query: 691 ELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYANT-VL 515
           + PDG  + +   +   P  +F  S  G E   +   T  ++ K  +D    L+    +L
Sbjct: 287 QAPDGARVHLDERKAALPFEVFF-SAAGDEKRNV--ATLMAMCKRQMDPEWQLHTVPHLL 343

Query: 514 SGGTTMYPGIADRMQKEITALAPSTMKIK---IIAPPERKYSVWIGGSILASLSTFQQMW 344
           +G  ++ PG  DR+ +E+ A   S  + +   ++   +     W+G S+ AS S+F+ +W
Sbjct: 344 AGAGSLVPGFRDRVVEELKAQDSSYFRYERDGVLNMAQTADGAWVGASMAASSSSFEPLW 403

Query: 343 ISKQEYDESGPSIVHRKCF 287
           +++ E+ E G S+++RK F
Sbjct: 404 VTRGEWAEEGASVLYRKLF 422


>UniRef50_Q5K9I3 Cluster: Protein-vacuolar targeting-related
           protein, putative; n=1; Filobasidiella neoformans|Rep:
           Protein-vacuolar targeting-related protein, putative -
           Cryptococcus neoformans (Filobasidiella neoformans)
          Length = 724

 Score = 56.0 bits (129), Expect = 9e-07
 Identities = 30/117 (25%), Positives = 56/117 (47%), Gaps = 3/117 (2%)
 Frame = -3

Query: 655 ERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADR 476
           ER R PE  FQPS +G++  G+ E     +     + RK L     ++GG    P +  +
Sbjct: 594 ERIRVPEVWFQPSIVGLDTAGVGEVAGWILNGFGEEERKRLMQGIFVTGGGANIPNLIPK 653

Query: 475 MQKEITALAPSTMKIKIIAP---PERKYSVWIGGSILASLSTFQQMWISKQEYDESG 314
           ++  +T + P    +K+++     + +   W G +  ++    +Q  ++K EYDE G
Sbjct: 654 LRHVLTPILPFRAPLKVVSSLDGGDPRLEAWRGMAQWSATEEAKQAMVTKAEYDEHG 710


>UniRef50_Q6CF37 Cluster: Similar to sp|P53946 Saccharomyces
           cerevisiae YNL059c ARP5Actin- related protein; n=1;
           Yarrowia lipolytica|Rep: Similar to sp|P53946
           Saccharomyces cerevisiae YNL059c ARP5Actin- related
           protein - Yarrowia lipolytica (Candida lipolytica)
          Length = 724

 Score = 55.6 bits (128), Expect = 1e-06
 Identities = 27/124 (21%), Positives = 58/124 (46%), Gaps = 1/124 (0%)
 Frame = -3

Query: 655 ERFRCPEALFQPSFLGMEACGIHETTYNSIMK-CDVDIRKDLYANTVLSGGTTMYPGIAD 479
           ER R PE LFQP+  G++  G+ E   + + K    +    +  +  ++GG +  P    
Sbjct: 595 ERIRVPEVLFQPTIAGIDQAGVAEVCGDILTKRFPSETASVMLKDVFVTGGYSQVPNFDA 654

Query: 478 RMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVH 299
           R+  E+ +L P+   +++ +    +   W+G +  +    ++   +++  Y+E GP  + 
Sbjct: 655 RLTAELRSLLPAGSPLQVRSAAHPETDAWMGMAKWSKTDDYKNSRVTRAMYEEMGPDYIK 714

Query: 298 RKCF 287
              F
Sbjct: 715 EHAF 718


>UniRef50_A4RYY1 Cluster: Predicted protein; n=2; Ostreococcus|Rep:
           Predicted protein - Ostreococcus lucimarinus CCE9901
          Length = 358

 Score = 55.2 bits (127), Expect = 2e-06
 Identities = 32/142 (22%), Positives = 66/142 (46%), Gaps = 6/142 (4%)
 Frame = -3

Query: 703 EKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYAN 524
           ++++ +PDG  + + NE + C EA+            I +     + KC  ++R+ +  +
Sbjct: 225 QETFAMPDGSALKLTNELYECGEAVMP----------IVDDVCECVQKCSSELRRFVLDS 274

Query: 523 TVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPER------KYSVWIGGSILASLS 362
             + G  +   G+  R+  E+T+  P ++   ++  PE        ++ W G ++ A   
Sbjct: 275 VFVHGVASKVSGLDARLFHELTSSLPPSLTPTMVNIPEYMPETTWSHAPWTGAAMAAKTI 334

Query: 361 TFQQMWISKQEYDESGPSIVHR 296
                +ISK +Y ++GP I HR
Sbjct: 335 FASNQYISKSDYTDNGPPIAHR 356


>UniRef50_A2FYS8 Cluster: Actin family protein; n=1; Trichomonas
           vaginalis G3|Rep: Actin family protein - Trichomonas
           vaginalis G3
          Length = 306

 Score = 54.4 bits (125), Expect = 3e-06
 Identities = 31/101 (30%), Positives = 49/101 (48%), Gaps = 4/101 (3%)
 Frame = -3

Query: 661 GNERFRCPEALFQPSFLG--MEACGIHETTYNSIMKCDVDIRKDLYANTVLSGGTTMYPG 488
           G E     E+ F P F+   +E+ G+H   +NS+ K  VD R  L  N V+ GG     G
Sbjct: 198 GQELLNAGESYFIPFFINENLESDGLHNDIFNSVKKSPVDYRAKLCENIVVYGGGANMKG 257

Query: 487 IADRMQKEITALAPSTM--KIKIIAPPERKYSVWIGGSILA 371
           +  R++KE+  + P     K+K+    +  Y  W+  S+ A
Sbjct: 258 LQARLEKEVKGVVPPATKDKVKVKVVDKPAYYSWLCLSVYA 298


>UniRef50_A1C924 Cluster: Actin family protein; n=4;
           Eurotiomycetidae|Rep: Actin family protein - Aspergillus
           clavatus
          Length = 436

 Score = 54.4 bits (125), Expect = 3e-06
 Identities = 23/69 (33%), Positives = 38/69 (55%)
 Frame = -3

Query: 673 VITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYANTVLSGGTTMY 494
           V+ +GNERF  PE LF P  +GM+  GI +    S+      +     AN ++ GG ++ 
Sbjct: 336 VLLLGNERFTVPEILFTPGDIGMKQAGIPDIILQSLSVLPTGLHPSFLANVLVVGGNSLI 395

Query: 493 PGIADRMQK 467
           PG  +R+++
Sbjct: 396 PGFLERLKR 404


>UniRef50_Q5DCN1 Cluster: SJCHGC08895 protein; n=1; Schistosoma
           japonicum|Rep: SJCHGC08895 protein - Schistosoma
           japonicum (Blood fluke)
          Length = 226

 Score = 54.0 bits (124), Expect = 4e-06
 Identities = 31/96 (32%), Positives = 49/96 (51%), Gaps = 10/96 (10%)
 Frame = -3

Query: 571 SIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALA--PSTMKIKII-------- 422
           SIM   +DIR+ L  N VL GGTTM PG   R+ +E+ +    P  +K++ +        
Sbjct: 107 SIMLAPIDIRRKLAENIVLIGGTTMLPGFVPRLMEELNSHVELPEFLKLQALKGFFKFHN 166

Query: 421 APPERKYSVWIGGSILASLSTFQQMWISKQEYDESG 314
            P E  Y  W+GG+I  +L       +++  + E+G
Sbjct: 167 PPAEANYVGWLGGAIFGALECLPGRSLNRSSFLENG 202


>UniRef50_A6R1X8 Cluster: Putative uncharacterized protein; n=1;
           Ajellomyces capsulatus NAm1|Rep: Putative
           uncharacterized protein - Ajellomyces capsulatus NAm1
          Length = 444

 Score = 54.0 bits (124), Expect = 4e-06
 Identities = 35/96 (36%), Positives = 49/96 (51%), Gaps = 10/96 (10%)
 Frame = -3

Query: 700 KSYELPDGQVITIGNERFRCPEALF---------QPSFLGMEACG-IHETTYNSIMKCDV 551
           + +E PDG     G ER+R  E+LF         +P F    A   I E   NS+ + DV
Sbjct: 323 RPFEFPDGYNQVFGAERYRVVESLFDAQAAIPDTEPEFPAPTAAQTIPELIRNSLSQVDV 382

Query: 550 DIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPS 443
           DIR  L AN V++G T++  G  DR+  E+  + PS
Sbjct: 383 DIRPHLLANVVVTGATSLLYGFNDRLNFELMNMFPS 418


>UniRef50_A7PBZ0 Cluster: Chromosome chr2 scaffold_11, whole genome
           shotgun sequence; n=1; Vitis vinifera|Rep: Chromosome
           chr2 scaffold_11, whole genome shotgun sequence - Vitis
           vinifera (Grape)
          Length = 403

 Score = 53.2 bits (122), Expect = 6e-06
 Identities = 23/43 (53%), Positives = 28/43 (65%)
 Frame = +3

Query: 312 GPDSSYSCFEIHICWKVEREARIDPPIHTEYFLSGGAMILIFI 440
           G +   S  +IHICW + R+A IDPPI   YFL+GG  IL FI
Sbjct: 11  GKNEGDSPLDIHICWNMLRDANIDPPIQALYFLAGGVTILTFI 53


>UniRef50_A5K6H6 Cluster: Actin-like protein, putative; n=2;
           Plasmodium|Rep: Actin-like protein, putative -
           Plasmodium vivax
          Length = 599

 Score = 53.2 bits (122), Expect = 6e-06
 Identities = 30/102 (29%), Positives = 52/102 (50%), Gaps = 8/102 (7%)
 Frame = -3

Query: 577 YNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAP-----STMKIKIIAPP 413
           Y++I KC +D RK+L+ N  L+GG+++  G  +R+Q E+          S + I + A  
Sbjct: 489 YDTIQKCPIDTRKELFENIYLTGGSSIIRGFRERLQNELYDFVKRKNFYSNVCINVHAMR 548

Query: 412 ER---KYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHR 296
            R   KY+ + G      L  +    I++ +Y E G S++ R
Sbjct: 549 RRTLQKYATYSGAHYFLELFDYHNYKITRGDYQEYGDSVLER 590


>UniRef50_Q3M0X1 Cluster: Actin-like protein 1-1; n=3; Paramecium
           tetraurelia|Rep: Actin-like protein 1-1 - Paramecium
           tetraurelia
          Length = 658

 Score = 52.8 bits (121), Expect = 8e-06
 Identities = 36/121 (29%), Positives = 57/121 (47%), Gaps = 2/121 (1%)
 Frame = -3

Query: 670 ITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYANTVLSGGTTMYP 491
           + +  +R RC E  FQPS +G+E  G+     + I      + K L  N +L+GG     
Sbjct: 527 VPLSVDRVRCQEIYFQPSLIGVEQQGL----VDMIKLSSKGLDKLLLQNIILTGGGAKTQ 582

Query: 490 GIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILAS--LSTFQQMWISKQEYDES 317
           GI  R+QK++ +     + IKI   P   +  W+G    A+   +   Q  IS  +Y+E 
Sbjct: 583 GIMQRLQKDLISEYDCPIAIKIATDP--VFGTWLGMKNFANKHSNMLSQFSISIDDYNEI 640

Query: 316 G 314
           G
Sbjct: 641 G 641


>UniRef50_A3FQH9 Cluster: Actin-like protein, putative; n=2;
           Cryptosporidium|Rep: Actin-like protein, putative -
           Cryptosporidium parvum Iowa II
          Length = 367

 Score = 52.8 bits (121), Expect = 8e-06
 Identities = 30/93 (32%), Positives = 49/93 (52%), Gaps = 1/93 (1%)
 Frame = -3

Query: 703 EKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYAN 524
           E S      ++I + +ER   PE LF PS  G    GI +    SI+     +++ L  N
Sbjct: 263 ESSVNCDPSRIIKLYSERITVPELLFSPSNGGYNFTGIADMVSESILSSPKHLQELLANN 322

Query: 523 TVLSGGTTMYPGIADRMQKEITALAPS-TMKIK 428
            +L GG+T +     R+ KE+++L PS ++K+K
Sbjct: 323 ILLIGGSTKFRNFEARLNKELSSLLPSVSLKLK 355


>UniRef50_A2DKB8 Cluster: Actin family protein; n=1; Trichomonas
           vaginalis G3|Rep: Actin family protein - Trichomonas
           vaginalis G3
          Length = 372

 Score = 52.8 bits (121), Expect = 8e-06
 Identities = 29/105 (27%), Positives = 53/105 (50%)
 Frame = -3

Query: 607 MEACGIHETTYNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIK 428
           +E+    E    SI   D+  R +L+ N +L+GGT+   G+ +R+  E+T L P   K +
Sbjct: 258 IESLSAAEIIAKSIEASDLPARGELWKNIILTGGTSKLKGLKERLLNELTELNPLNAKPR 317

Query: 427 IIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRK 293
           +  P +   S W G ++ A     ++ W+  ++Y ++ P  V  K
Sbjct: 318 MYFPEDPITSCWKGEALSAKFDA-EENWLFAEQY-KADPKAVFEK 360


>UniRef50_A6RD01 Cluster: Putative uncharacterized protein; n=1;
           Ajellomyces capsulatus NAm1|Rep: Putative
           uncharacterized protein - Ajellomyces capsulatus NAm1
          Length = 762

 Score = 52.0 bits (119), Expect = 1e-05
 Identities = 35/120 (29%), Positives = 57/120 (47%), Gaps = 6/120 (5%)
 Frame = -3

Query: 655 ERFRCPEALFQPSFL-GMEACGIHETTYNSIMK---CDVDIRKDLYANTVLSGGTTMYPG 488
           ER R PE +FQPS + G++  G+ E   + + +        R  L  +  ++GG +++ G
Sbjct: 626 ERIRVPETVFQPSAIAGLDQAGLVEIAADIVNQQRFSSGQERARLLRDVFITGGNSLFKG 685

Query: 487 IADRMQKEITALAPSTMK--IKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESG 314
             +R   E  +L P  M   +K+          W G +  AS S FQ   +S+QE+ E G
Sbjct: 686 FDERFATEFRSLLPVEMGSVLKVRRAGNAVLDAWKGAAEWASGSEFQNASVSRQEWLEKG 745


>UniRef50_A3M088 Cluster: Vacuolar targeting, actin-related protein;
            n=5; Saccharomycetales|Rep: Vacuolar targeting,
            actin-related protein - Pichia stipitis (Yeast)
          Length = 775

 Score = 52.0 bits (119), Expect = 1e-05
 Identities = 33/129 (25%), Positives = 56/129 (43%), Gaps = 6/129 (4%)
 Frame = -3

Query: 670  ITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKC------DVDIRKDLYANTVLSG 509
            I +  ER R PE LFQP   G++  GI E + + + +       +     +L  +  ++G
Sbjct: 636  IHVNVERIRVPEILFQPHIAGLDQAGISEISSDLLNRSFGSSFYEGGDSLNLIRDVFVTG 695

Query: 508  GTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQE 329
            G    P    R+  + T+  P    I++    +     W G    AS    +  +ISK +
Sbjct: 696  GLAHLPNFTTRVTNDFTSFLPVGAPIRVRTARDPIGDSWRGMQKWASSEECENSYISKAD 755

Query: 328  YDESGPSIV 302
            Y+E GP  +
Sbjct: 756  YEEYGPEYI 764


>UniRef50_Q5DA98 Cluster: SJCHGC09502 protein; n=1; Schistosoma
           japonicum|Rep: SJCHGC09502 protein - Schistosoma
           japonicum (Blood fluke)
          Length = 216

 Score = 51.2 bits (117), Expect = 2e-05
 Identities = 38/129 (29%), Positives = 57/129 (44%), Gaps = 10/129 (7%)
 Frame = -3

Query: 670 ITIGNERFRCPEALFQPSFLGMEACGIHE-------TTYNSIMKCDVDIRKDLYANTVLS 512
           I +  E  R  E LFQPSF+G    G+ +        T   +   D    + +Y    L+
Sbjct: 74  IHVDTELMRSHEVLFQPSFMGSPEAGLSDCLEYVLRDTTRLLGSSDPGFPQIIY----LT 129

Query: 511 GGTTMYPGIADRMQKEITALAPSTMK---IKIIAPPERKYSVWIGGSILASLSTFQQMWI 341
           GG    PG+ADR++ +I  L P   K   I+II   +     W G     +    +Q + 
Sbjct: 130 GGVAALPGLADRIRCDIRPLLPVGSKWDNIEIIVAADPHLDAWHGARHFVNSPYVEQYYT 189

Query: 340 SKQEYDESG 314
           +KQ Y+E G
Sbjct: 190 TKQMYEEYG 198


>UniRef50_A0BG81 Cluster: Chromosome undetermined scaffold_105,
           whole genome shotgun sequence; n=1; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_105,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 386

 Score = 51.2 bits (117), Expect = 2e-05
 Identities = 32/119 (26%), Positives = 53/119 (44%)
 Frame = -3

Query: 670 ITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYANTVLSGGTTMYP 491
           +T+  ER   PE LF+P+ +G+   G  ET ++S+     DI+     N  +SGG + + 
Sbjct: 260 LTLDKERITIPEILFRPTEIGLAQKGPTETFFDSLSTIHKDIQGYFAENIYISGGNSFFS 319

Query: 490 GIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESG 314
              +R+  EI         + +    +   SV+ G       + FQ    +K EY E G
Sbjct: 320 SFHNRLSNEIRQNCSVDWNVNLTHLDDID-SVFQGSLHFNRSTEFQNACFTKAEYQEKG 377


>UniRef50_Q5CS19 Cluster: Actin-like protein; n=2;
           Cryptosporidium|Rep: Actin-like protein -
           Cryptosporidium parvum Iowa II
          Length = 418

 Score = 49.6 bits (113), Expect = 8e-05
 Identities = 32/114 (28%), Positives = 58/114 (50%), Gaps = 1/114 (0%)
 Frame = -3

Query: 691 ELPDGQVITIGNERFRCPE-ALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYANTVL 515
           +L + + I +  ERF+  E   F+P  +G+E+  I E     I KC +D R  L  N  L
Sbjct: 297 KLNNSKSIFLEEERFQVTENVFFKPYKIGIESPSICEAILKVINKCPLDTRTLLMENIFL 356

Query: 514 SGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQ 353
           +G ++++ G+  R+Q  +T L   + K++       KY  ++    +  +STF+
Sbjct: 357 TGRSSLFIGLPQRIQVNLTQLFLDS-KLRGDTNRLNKYKFYVNDDPMRDVSTFK 409


>UniRef50_Q5AP59 Cluster: Actin-like protein ARP6; n=2;
           Saccharomycetales|Rep: Actin-like protein ARP6 - Candida
           albicans (Yeast)
          Length = 446

 Score = 49.2 bits (112), Expect = 1e-04
 Identities = 45/147 (30%), Positives = 63/147 (42%), Gaps = 19/147 (12%)
 Frame = -3

Query: 697 SYELP-DGQVITIGNERFRCPEALFQPSFL--------------GMEACGIHETTYNSIM 563
           S +LP D QV+ + +ERF  PE  F P  +                    + +    SIM
Sbjct: 287 SQKLPNDTQVLKLYDERFTVPETYFHPEIIFDNNRTTASSSLLNNAPFKNLTDLIVESIM 346

Query: 562 KCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPP---ERKYSVW 392
            C    +  L AN  LSGG+T  P    R+  E+    PS  K+ I        R    W
Sbjct: 347 ACPSITQPLLSANICLSGGSTNIPNFKTRLIGELRKELPSNWKVNIFDKQYDINRDELSW 406

Query: 391 IGGSILASLS-TFQQMWISKQEYDESG 314
            GG  L++ S   Q++ ISK++Y E G
Sbjct: 407 YGGINLSNESELLQEISISKKDYFEHG 433


>UniRef50_Q6GLD2 Cluster: Novel protein similar to actin-related
           protein 8; n=2; Tetrapoda|Rep: Novel protein similar to
           actin-related protein 8 - Xenopus tropicalis (Western
           clawed frog) (Silurana tropicalis)
          Length = 659

 Score = 48.4 bits (110), Expect = 2e-04
 Identities = 35/137 (25%), Positives = 66/137 (48%), Gaps = 14/137 (10%)
 Frame = -3

Query: 661 GNERFRCPEALFQ-----PSFLGMEACGIHETTYNSIMKC-DVDIRKDLYANTVLSGGTT 500
           GN+    P A+F        F G +A G+ +   +SI  C   D +K +Y + ++ GG  
Sbjct: 519 GNDSEEPPAAMFSRKTAVSQFEG-KALGLDKAILHSIDCCASDDTKKKMYGSVLVVGGGL 577

Query: 499 MYPGIADRMQKEITALAPSTMK-----IKIIAPP---ERKYSVWIGGSILASLSTFQQMW 344
           M+      +Q  I    P + +     +++I  P   + +  VW GG++LA L T Q++W
Sbjct: 578 MFHRAQQFLQHRILNKMPPSFRRVVDNVEVITRPKDMDPRLIVWKGGALLACLDTTQELW 637

Query: 343 ISKQEYDESGPSIVHRK 293
           + ++E+   G  ++  +
Sbjct: 638 VYQREWQRFGVRMLRER 654


>UniRef50_Q4QF44 Cluster: Actin-related protein 3, putative; n=3;
           Leishmania|Rep: Actin-related protein 3, putative -
           Leishmania major
          Length = 405

 Score = 48.4 bits (110), Expect = 2e-04
 Identities = 36/149 (24%), Positives = 66/149 (44%), Gaps = 24/149 (16%)
 Frame = -3

Query: 670 ITIGNERFRCPEALFQPSFLG------MEAC-GIHETTYNSIMKCDVDIRKDLYANTVLS 512
           I +G ERF  PE +FQP  L         AC G+     +++  C +D R+ L AN ++S
Sbjct: 254 IDVGYERFLAPETMFQPDLLAAPSAVTASACGGLPAVIDSAVWSCPMDGRRPLCANIIVS 313

Query: 511 GGTTMYPGIADRM---------QKEITALAPS--------TMKIKIIAPPERKYSVWIGG 383
           GG   +   A R+         ++    +A S          ++ +    +  ++VW G 
Sbjct: 314 GGNARFAHFAKRLNHALQRALDERSAAVMAASGGTLCRQVKYEVNVRDHSQATHAVWRGA 373

Query: 382 SILASLSTFQQMWISKQEYDESGPSIVHR 296
           S  A+   +    ++++ Y E G S++ +
Sbjct: 374 SAFAASPEYATAAVAREAYMECGASVMRQ 402


>UniRef50_A7AQB8 Cluster: Actin-related protein, putative; n=1;
           Babesia bovis|Rep: Actin-related protein, putative -
           Babesia bovis
          Length = 463

 Score = 48.4 bits (110), Expect = 2e-04
 Identities = 34/132 (25%), Positives = 59/132 (44%), Gaps = 4/132 (3%)
 Frame = -3

Query: 673 VITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIR-KDLYANTVLSGGTTM 497
           +I   NE    P   F     G++  G+   +Y +  +    +   D     +LSGGTT 
Sbjct: 333 IIPSRNEHEMIPLGQFLNGLTGLD--GLLAESYGAARQLVSSVCIPDAIKTVILSGGTTR 390

Query: 496 YPGIADRMQKEITALAPSTMK--IKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYD 323
           +  +   +++      P         +   E++YS +IG SILAS   F+ + I++++  
Sbjct: 391 HSAVLPLLERRFANRMPDVESPLFMSVGGDEQQYSSFIGASILASFGMFESLCITREDCQ 450

Query: 322 ESG-PSIVHRKC 290
           E G   I+ RKC
Sbjct: 451 EHGLERILQRKC 462


>UniRef50_Q9GYR2 Cluster: Putative uncharacterized protein; n=2;
           Caenorhabditis|Rep: Putative uncharacterized protein -
           Caenorhabditis elegans
          Length = 305

 Score = 47.6 bits (108), Expect = 3e-04
 Identities = 28/91 (30%), Positives = 51/91 (56%), Gaps = 10/91 (10%)
 Frame = -3

Query: 568 IMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITAL-APSTMKIKIIAP----PERK 404
           + KC +D+RK L+ N +L+GG +  PG+  R+++EI  +   +  KI +I       E K
Sbjct: 198 VSKCPIDLRKKLFPNILLTGGVSTIPGLMKRLEQEIQVIDEKNNSKIAVIVKFYQFSEIK 257

Query: 403 ----YSVWIGGSILASL-STFQQMWISKQEY 326
               +  W+G S+L SL  T ++  ++ +E+
Sbjct: 258 NTPLFVSWLGASLLGSLRETIERKSLTLEEW 288


>UniRef50_Q8I345 Cluster: Actin-like protein, putative; n=3;
           Plasmodium|Rep: Actin-like protein, putative -
           Plasmodium falciparum (isolate 3D7)
          Length = 543

 Score = 47.6 bits (108), Expect = 3e-04
 Identities = 24/102 (23%), Positives = 51/102 (50%), Gaps = 8/102 (7%)
 Frame = -3

Query: 577 YNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALA-------PSTMKIKIIA 419
           YN+I  C +D RK+L  N  L+GG+++  G   R++ E+  L         + +++ +  
Sbjct: 433 YNTIQNCPIDYRKELLRNIYLTGGSSIIRGFRQRLENELYELINNINFYNKACVQVHLFK 492

Query: 418 PP-ERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHR 296
               +KY+++ G      +  +    +++Q+Y E G  I+ +
Sbjct: 493 RKLLQKYAIYSGSHYFLEIFNYDYYSVTRQDYQEEGERILEK 534


>UniRef50_Q54BW9 Cluster: Putative uncharacterized protein; n=1;
           Dictyostelium discoideum AX4|Rep: Putative
           uncharacterized protein - Dictyostelium discoideum AX4
          Length = 41

 Score = 47.6 bits (108), Expect = 3e-04
 Identities = 23/36 (63%), Positives = 27/36 (75%), Gaps = 1/36 (2%)
 Frame = -3

Query: 682 DGQVITIGNERFRCPEALFQPSFLGM-EACGIHETT 578
           DGQ + IGNERFRC E LFQPS L + E+ GIHE +
Sbjct: 5   DGQNLIIGNERFRCSEVLFQPSILLINESPGIHEAS 40


>UniRef50_Q4YVG6 Cluster: Actin, putative; n=7; Plasmodium|Rep:
           Actin, putative - Plasmodium berghei
          Length = 505

 Score = 47.6 bits (108), Expect = 3e-04
 Identities = 26/81 (32%), Positives = 45/81 (55%), Gaps = 4/81 (4%)
 Frame = -3

Query: 520 VLSGGTTMYPGIADRMQKEIT---ALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQ 350
           +++G +TM+      ++  I     +     KI      +RKY+ +IG SIL+SL +F Q
Sbjct: 424 IVTGESTMFHNFVGLLKSYIPYIDTIKGKATKIIYSKGADRKYNTFIGASILSSLGSFPQ 483

Query: 349 MWISKQEYDESG-PSIVHRKC 290
             ++K EY+E G  +I+ +KC
Sbjct: 484 FCMTKSEYEEHGAKNIIEKKC 504


>UniRef50_UPI0000D55EE2 Cluster: PREDICTED: similar to actin-related
           protein 10 homolog; n=2; Endopterygota|Rep: PREDICTED:
           similar to actin-related protein 10 homolog - Tribolium
           castaneum
          Length = 370

 Score = 46.8 bits (106), Expect = 5e-04
 Identities = 33/135 (24%), Positives = 62/135 (45%), Gaps = 9/135 (6%)
 Frame = -3

Query: 703 EKSYELPDGQVITI-GNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYA 527
           E  Y +    +ITI G  R +  E L+       +   +     ++I+K D+ +R  L  
Sbjct: 221 EVKYPIGGSDIITISGKVREKVYEILYDED---NDHLSLSTMILDAILKVDMHLRNQLAE 277

Query: 526 NTVLSGGTTMYPG----IADRMQKEITALAPSTMKIKII---APP-ERKYSVWIGGSILA 371
           N +L GG+ M PG    + D + K++       ++IK     +PP +  Y+ W+GG I  
Sbjct: 278 NILLIGGSVMAPGFKARLKDELHKQLKYERYKKLRIKTFKFHSPPCKENYAAWLGGGIYG 337

Query: 370 SLSTFQQMWISKQEY 326
           +        +++++Y
Sbjct: 338 ATEVLGMKALTREKY 352


>UniRef50_Q9H981 Cluster: Actin-related protein 8; n=33;
           Deuterostomia|Rep: Actin-related protein 8 - Homo
           sapiens (Human)
          Length = 624

 Score = 46.8 bits (106), Expect = 5e-04
 Identities = 28/113 (24%), Positives = 57/113 (50%), Gaps = 9/113 (7%)
 Frame = -3

Query: 604 EACGIHETTYNSIMKCDVD-IRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMK-- 434
           +A G+ +   +SI  C  D  +K +Y++ ++ GG  M+    + +Q  I    P + +  
Sbjct: 507 KALGLDKAILHSIDCCSSDDTKKKMYSSILVVGGGLMFHKAQEFLQHRILNKMPPSFRRI 566

Query: 433 ---IKIIAPP---ERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRK 293
              + +I  P   + +   W GG++LA L T Q++WI ++E+   G  ++  +
Sbjct: 567 IENVDVITRPKDMDPRLIAWKGGAVLACLDTTQELWIYQREWQRFGVRMLRER 619


>UniRef50_Q6BML9 Cluster: Actin-like protein ARP6; n=3;
           Saccharomycetaceae|Rep: Actin-like protein ARP6 -
           Debaryomyces hansenii (Yeast) (Torulaspora hansenii)
          Length = 409

 Score = 46.8 bits (106), Expect = 5e-04
 Identities = 34/136 (25%), Positives = 55/136 (40%), Gaps = 13/136 (9%)
 Frame = -3

Query: 682 DGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNS------------IMKCDVDIRK 539
           D Q + + +ERF  PE+ + P  +         T  N+            IM C    + 
Sbjct: 261 DVQSLALIDERFTIPESFYHPEIIFDNTTSSTSTIQNASFKNITDLVVECIMSCPKVTQP 320

Query: 538 DLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPER-KYSVWIGGSILASLS 362
            L  N +  GG T  PG  DR++ E+    P    +++         + W GG+ L +  
Sbjct: 321 LLLGNIITVGGNTNLPGFTDRLRHELVKELPIDWHVQVKETEHNPDEASWFGGAQLTNDE 380

Query: 361 TFQQMWISKQEYDESG 314
               + ISK++Y E G
Sbjct: 381 IINNISISKKDYFEHG 396


>UniRef50_Q4P820 Cluster: Putative uncharacterized protein; n=1;
           Ustilago maydis|Rep: Putative uncharacterized protein -
           Ustilago maydis (Smut fungus)
          Length = 724

 Score = 45.2 bits (102), Expect = 0.002
 Identities = 30/110 (27%), Positives = 54/110 (49%), Gaps = 7/110 (6%)
 Frame = -3

Query: 712 PPLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDV-DIRKD 536
           P  +K  +  D Q +T+  ERF   E LF P  LG++   + E   +SI      D+   
Sbjct: 498 PCTDKEEDDHDLQTLTLATERFSIIENLFNPGSLGLDQKPLPELILDSITSVSTSDLPSA 557

Query: 535 ------LYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERK 404
                 +++N VL+GG      ++ R+  E+ +LAP+ + ++I    +R+
Sbjct: 558 RTAADMMWSNIVLAGGLANTVNMSRRLNNELASLAPADVPLRIWPDEQRE 607


>UniRef50_Q9LSW2 Cluster: Actin-like protein; n=4;
           Magnoliophyta|Rep: Actin-like protein - Arabidopsis
           thaliana (Mouse-ear cress)
          Length = 596

 Score = 44.8 bits (101), Expect = 0.002
 Identities = 25/102 (24%), Positives = 51/102 (50%), Gaps = 5/102 (4%)
 Frame = -3

Query: 604 EACGIHETTYNSIMKCD-VDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIK 428
           E  G+ E   +SI+    +D+R+ L+++  L GG  +  G+   +++ +    P T  I 
Sbjct: 470 EKIGLAEAITSSILSAGRIDLRRKLFSSIQLIGGAGLTKGLVAAVEERVLHAIPPTEAID 529

Query: 427 II----APPERKYSVWIGGSILASLSTFQQMWISKQEYDESG 314
            +    +  E ++  W GG+IL  L   ++ WI + ++  +G
Sbjct: 530 TVQVLPSRTEPQFVTWKGGAILGILDFGREAWIERHQWMVNG 571


>UniRef50_Q4DEE4 Cluster: Actin-like protein, putative; n=4;
           Trypanosoma|Rep: Actin-like protein, putative -
           Trypanosoma cruzi
          Length = 372

 Score = 44.8 bits (101), Expect = 0.002
 Identities = 35/135 (25%), Positives = 61/135 (45%), Gaps = 4/135 (2%)
 Frame = -3

Query: 685 PDGQVITIG-NERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYANTVLSG 509
           PDG  +T+  + R    E LF P   G     + E   +   + D +  +    + V  G
Sbjct: 238 PDGNSVTVSASARTEPYEMLFSPP-TGF-GVSLAELLVSCKKRLDPEWLQQAVPH-VFCG 294

Query: 508 GTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSV---WIGGSILASLSTFQQMWIS 338
           GT+  PG  DR+ KE         + +         +V   W G S+ A+ S+F  +W++
Sbjct: 295 GTSQAPGFCDRIIKEAQKKDSCYFRYEKEGSFHVFGAVDGAWTGASLAAASSSFASLWVT 354

Query: 337 KQEYDESGPSIVHRK 293
           + + +E G S+++RK
Sbjct: 355 RADLEEEGDSVLYRK 369


>UniRef50_Q9US07 Cluster: Probable actin-related protein 8; n=1;
           Schizosaccharomyces pombe|Rep: Probable actin-related
           protein 8 - Schizosaccharomyces pombe (Fission yeast)
          Length = 620

 Score = 44.4 bits (100), Expect = 0.003
 Identities = 20/86 (23%), Positives = 42/86 (48%), Gaps = 3/86 (3%)
 Frame = -3

Query: 541 KDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPP---ERKYSVWIGGSILA 371
           K+LY++ ++ GG   +PG A  +++ I +   +   I +I PP   + ++  W G  I  
Sbjct: 527 KNLYSSILIVGGAGQFPGFAHLLEERIHSKRANIPTISVIPPPRSMDAQFVAWKGACIYN 586

Query: 370 SLSTFQQMWISKQEYDESGPSIVHRK 293
            +    ++WI   ++   G  ++  K
Sbjct: 587 RIRIVSELWIKNSDWKMLGSRVLQYK 612


>UniRef50_UPI000155CE00 Cluster: PREDICTED: similar to aprataxin;
           n=1; Ornithorhynchus anatinus|Rep: PREDICTED: similar to
           aprataxin - Ornithorhynchus anatinus
          Length = 408

 Score = 43.6 bits (98), Expect = 0.005
 Identities = 23/68 (33%), Positives = 36/68 (52%)
 Frame = -3

Query: 700 KSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYANT 521
           + Y LP GQVI++  ERF   E  F  S  G +  G+H  T + + +     +K+L +  
Sbjct: 327 RDYSLPAGQVISVDPERFPSAEMFFSSSPTGPKRPGLHALTPSCLNRFVPSCQKNLTSKR 386

Query: 520 VLSGGTTM 497
           + SG TT+
Sbjct: 387 LCSGRTTL 394


>UniRef50_Q54JY2 Cluster: Putative uncharacterized protein; n=1;
           Dictyostelium discoideum AX4|Rep: Putative
           uncharacterized protein - Dictyostelium discoideum AX4
          Length = 475

 Score = 43.2 bits (97), Expect = 0.007
 Identities = 32/108 (29%), Positives = 49/108 (45%), Gaps = 14/108 (12%)
 Frame = -3

Query: 607 MEACGIHETTYNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADR----MQKEITALAPST 440
           +E   I  T  N+++KC+ D RK L  N +L GGTTM  G   R    + +++     S 
Sbjct: 303 LEEGNIATTILNTLLKCEHDQRKPLSHNILLLGGTTMLAGFKKRLVLELHRQLKMNENSI 362

Query: 439 MKIKIIA----------PPERKYSVWIGGSILASLSTFQQMWISKQEY 326
            + ++            P E  Y  W+GGSILA+        I+ + Y
Sbjct: 363 YRNELFGLIGHFQFINHPFENNYLSWLGGSILANALEHVHSKITLESY 410


>UniRef50_A7RKL9 Cluster: Predicted protein; n=1; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 588

 Score = 43.2 bits (97), Expect = 0.007
 Identities = 25/109 (22%), Positives = 55/109 (50%), Gaps = 9/109 (8%)
 Frame = -3

Query: 592 IHETTYNSIMKCDV-DIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMK-----I 431
           + +    SI  C   D ++ +Y++ +L GG   + G A  +Q  + +  P   +     +
Sbjct: 472 LDQAIITSIECCSTEDTKRKMYSSILLIGGGFNFNGAAGVLQARVQSKLPQYFRKMVDQV 531

Query: 430 KIIAPPER---KYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRK 293
           ++ A P+    +   W GG+IL+ L + Q++W++++E++  G   +  K
Sbjct: 532 EVTAKPKEMDPRTVAWKGGAILSILDSAQELWLTEREWNVIGVRALREK 580


>UniRef50_Q0IEG8 Cluster: Actin-related protein 8; n=5;
           Endopterygota|Rep: Actin-related protein 8 - Aedes
           aegypti (Yellowfever mosquito)
          Length = 562

 Score = 42.7 bits (96), Expect = 0.009
 Identities = 24/112 (21%), Positives = 55/112 (49%), Gaps = 6/112 (5%)
 Frame = -3

Query: 610 GMEACGIHETTYNSIMKCDVD-IRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMK 434
           G +  GI +    SI +C  D +++ +Y   ++ GG   + GI++ +Q  +    P   +
Sbjct: 446 GGQMIGIDQAVLQSIERCPNDELKRKMYGCILVVGGGMKFTGISNWLQNRVALKIPLMYR 505

Query: 433 IK--IIAPP---ERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRK 293
            +  I+      + + + W G +I++ L +  ++W+++ E+   G  I+  K
Sbjct: 506 SEHNIVTSSKDIDAEITAWKGAAIMSCLESAAELWLTEAEWTRYGLRILREK 557


>UniRef50_Q4QCJ2 Cluster: Actin-like protein, putative; n=4;
           Leishmania|Rep: Actin-like protein, putative -
           Leishmania major
          Length = 585

 Score = 41.9 bits (94), Expect = 0.015
 Identities = 25/85 (29%), Positives = 41/85 (48%), Gaps = 6/85 (7%)
 Frame = -3

Query: 676 QVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVD------IRKDLYANTVL 515
           Q + +  ERF  PE LF P+ +G+   G+ +     I +  +       +R  L  N  +
Sbjct: 382 QHLLLCQERFLIPELLFTPADVGINQQGVAQAITEGIFQRGLLQHLTKLLRPLLLHNVCV 441

Query: 514 SGGTTMYPGIADRMQKEITALAPST 440
            GGT   P   DR++ E+ A+AP +
Sbjct: 442 YGGTASQPNFRDRLEAEVAAVAPQS 466


>UniRef50_Q25665 Cluster: Actin; n=1; Procambarus clarkii|Rep: Actin
           - Procambarus clarkii (Red swamp crayfish)
          Length = 61

 Score = 41.9 bits (94), Expect = 0.015
 Identities = 22/42 (52%), Positives = 26/42 (61%)
 Frame = -1

Query: 711 PPSRSLTNFPTVRSSLSETKDSVAQRLSSNPRSWVWKLAAST 586
           PP  S T+ PTV+SS S T  SV  +LSS+  SWVW L   T
Sbjct: 20  PPWTSPTSSPTVKSSPSATSVSVLLKLSSSLPSWVWNLLVFT 61


>UniRef50_Q8SS30 Cluster: ACTIN-LIKE 53kDa PROTEIN; n=1;
           Encephalitozoon cuniculi|Rep: ACTIN-LIKE 53kDa PROTEIN -
           Encephalitozoon cuniculi
          Length = 341

 Score = 41.9 bits (94), Expect = 0.015
 Identities = 26/86 (30%), Positives = 45/86 (52%)
 Frame = -3

Query: 550 DIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILA 371
           DIR  L  N ++ GG     G+   + +E+    P   K K+I    R +S + GGS++ 
Sbjct: 249 DIRPLLSGNILIGGGVGGARGLEGLICEELGRERPR-WKAKVIVERSR-FSTFQGGSVIG 306

Query: 370 SLSTFQQMWISKQEYDESGPSIVHRK 293
           S+ + + + I  ++Y+E G  I+ RK
Sbjct: 307 SMGSAKGLHIGARDYEEYGEGILDRK 332


>UniRef50_A1C6E4 Cluster: Chromatin remodeling complex subunit
           (Arp8), putative; n=8; Pezizomycotina|Rep: Chromatin
           remodeling complex subunit (Arp8), putative -
           Aspergillus clavatus
          Length = 721

 Score = 41.9 bits (94), Expect = 0.015
 Identities = 23/88 (26%), Positives = 40/88 (45%), Gaps = 4/88 (4%)
 Frame = -3

Query: 541 KDLYANTVLSGGTTMYPGIADRMQKEITALAPS-TMKIKIIAPP---ERKYSVWIGGSIL 374
           +D     ++ GG ++  G    +++ +  L P    +I +  PP   + +  VW G S+ 
Sbjct: 630 RDFLGGIMVVGGGSLVNGFHSFLEERLQTLRPGFANEIMVGTPPRDLDPQVVVWKGASVF 689

Query: 373 ASLSTFQQMWISKQEYDESGPSIVHRKC 290
             LS     WI + EYD  G  ++  KC
Sbjct: 690 GKLSGTNDSWIGQLEYDRLGHRLMAYKC 717


>UniRef50_Q75BT7 Cluster: ACR184Cp; n=1; Eremothecium gossypii|Rep:
           ACR184Cp - Ashbya gossypii (Yeast) (Eremothecium
           gossypii)
          Length = 401

 Score = 41.1 bits (92), Expect = 0.027
 Identities = 25/81 (30%), Positives = 41/81 (50%), Gaps = 4/81 (4%)
 Frame = -3

Query: 547 IRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPP---ERKYSVWIGGSI 377
           I   L  N V+ GGT++  G+  R+  +++   P   K+   A P   +R+   W GG  
Sbjct: 319 IHAALLTNVVIIGGTSLLQGLEQRLVNDLSLQFPQ-YKLSTYATPAHVDRQLQSWQGGVN 377

Query: 376 LASLSTFQQ-MWISKQEYDES 317
           +  L  ++   W++KQEY ES
Sbjct: 378 MCHLPDWKLGSWVTKQEYLES 398


>UniRef50_A3FQE6 Cluster: Putative uncharacterized protein; n=2;
           Cryptosporidium|Rep: Putative uncharacterized protein -
           Cryptosporidium parvum Iowa II
          Length = 396

 Score = 40.7 bits (91), Expect = 0.035
 Identities = 29/107 (27%), Positives = 50/107 (46%), Gaps = 3/107 (2%)
 Frame = -3

Query: 703 EKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYAN 524
           E  + LPDG VI   + R   P  LF+         GI +   NSI +   +I K++ + 
Sbjct: 288 ENEFHLPDGNVIDTTSIRNSIPNLLFKSGNSNQGYPGIVQMVINSITETS-NINKEISSI 346

Query: 523 T---VLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVW 392
           T   +L+GGTT+  G   ++ + I    PS +    ++  +  Y ++
Sbjct: 347 TSSIILAGGTTLINGFDAKLHQGIIDQRPSVIFNNSVSFLKSNYKIY 393


>UniRef50_Q7SBR8 Cluster: Putative uncharacterized protein
           NCU06238.1; n=4; Sordariomycetes|Rep: Putative
           uncharacterized protein NCU06238.1 - Neurospora crassa
          Length = 748

 Score = 40.7 bits (91), Expect = 0.035
 Identities = 25/101 (24%), Positives = 47/101 (46%), Gaps = 4/101 (3%)
 Frame = -3

Query: 583 TTYNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERK 404
           T+  +  K D    ++L  + ++ GG    P  A  +++++ A  P   +  +++   R+
Sbjct: 644 TSIQNAAKGDEKKVRELMGSIMVIGGGAKIPHFAPYLEEKLKARRPDLSERILVSRSARE 703

Query: 403 YS----VWIGGSILASLSTFQQMWISKQEYDESGPSIVHRK 293
                 VW G S+ A LST    WI+  EY   G  +++ K
Sbjct: 704 MDEQVVVWKGASVFAKLST-NDSWITNYEYKMLGSRVIYHK 743


>UniRef50_A7NX50 Cluster: Chromosome chr5 scaffold_2, whole genome
           shotgun sequence; n=1; Vitis vinifera|Rep: Chromosome
           chr5 scaffold_2, whole genome shotgun sequence - Vitis
           vinifera (Grape)
          Length = 602

 Score = 40.3 bits (90), Expect = 0.046
 Identities = 23/102 (22%), Positives = 48/102 (47%), Gaps = 5/102 (4%)
 Frame = -3

Query: 604 EACGIHETTYNSIMKCD-VDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIK 428
           E  G+ E   +SI+    +D+++ L+ +  L GG  +  G+   +++ +    PS   I 
Sbjct: 476 EKVGLAEAITSSILSTGRIDLQRKLFCSMQLIGGVALTSGLISAVEERVLHAIPSNEAID 535

Query: 427 IIAPPERK----YSVWIGGSILASLSTFQQMWISKQEYDESG 314
            +   + +    +  W GG+IL  L   +  WI ++++   G
Sbjct: 536 TVEVLQSRTNPTFVSWKGGAILGILDFGRDAWIHREDWIRRG 577


>UniRef50_Q1DZC3 Cluster: Putative uncharacterized protein; n=2;
           Eurotiomycetidae|Rep: Putative uncharacterized protein -
           Coccidioides immitis
          Length = 648

 Score = 40.3 bits (90), Expect = 0.046
 Identities = 20/87 (22%), Positives = 35/87 (40%), Gaps = 4/87 (4%)
 Frame = -3

Query: 538 DLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYS----VWIGGSILA 371
           D     ++ GG ++  G    +++ + A  P      ++  P R+       W G S+  
Sbjct: 558 DFLGGILVIGGGSLISGFHSFLEERLQAKHPEHSNSVLVGAPPRELDPQVVAWKGASVFG 617

Query: 370 SLSTFQQMWISKQEYDESGPSIVHRKC 290
            L+     WI   EYD  G  ++  KC
Sbjct: 618 KLNATNDSWIGSLEYDRLGSRVMTYKC 644


>UniRef50_UPI0000499D03 Cluster: actin; n=1; Entamoeba histolytica
           HM-1:IMSS|Rep: actin - Entamoeba histolytica HM-1:IMSS
          Length = 338

 Score = 39.5 bits (88), Expect = 0.081
 Identities = 32/132 (24%), Positives = 54/132 (40%)
 Frame = -3

Query: 694 YELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYANTVL 515
           Y     QVI IGNERF   E LF+          I      SI  C V ++  +  +  +
Sbjct: 218 YSSNKDQVIDIGNERFYSTEILFKGK------TSITSALTKSI--CTVSMKNKILRDICV 269

Query: 514 SGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISK 335
            GG +   G  +R+Q    ++  +  +   I      +S   G +I +   +F+    S 
Sbjct: 270 CGGNSFIHGFIERIQHNADSIQNNFFRTYSINTLHESFS---GANIYSGFPSFKYQLFSI 326

Query: 334 QEYDESGPSIVH 299
            +Y+E G  + +
Sbjct: 327 SKYEEEGTYVFY 338


>UniRef50_A2DVJ3 Cluster: Actin family protein; n=1; Trichomonas
           vaginalis G3|Rep: Actin family protein - Trichomonas
           vaginalis G3
          Length = 394

 Score = 39.5 bits (88), Expect = 0.081
 Identities = 26/93 (27%), Positives = 42/93 (45%), Gaps = 4/93 (4%)
 Frame = -3

Query: 544 RKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPER----KYSVWIGGSI 377
           +K L++N V  GG +   G   ++          T   K+  P        + VW GGSI
Sbjct: 303 KKALWSNIVTCGGFSTIEGFQAKILDAFKY--DKTFNRKVHFPMHEIVAGDFCVWTGGSI 360

Query: 376 LASLSTFQQMWISKQEYDESGPSIVHRKCF*TH 278
           L+S   F +  +SK +Y + G  ++  KC  +H
Sbjct: 361 LSSSPVFDRYLVSKADYADYGEELLKIKCEPSH 393


>UniRef50_Q5KH55 Cluster: Putative uncharacterized protein; n=2;
           Filobasidiella neoformans|Rep: Putative uncharacterized
           protein - Cryptococcus neoformans (Filobasidiella
           neoformans)
          Length = 613

 Score = 39.1 bits (87), Expect = 0.11
 Identities = 26/100 (26%), Positives = 47/100 (47%), Gaps = 2/100 (2%)
 Frame = -3

Query: 706 LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYA 527
           +E S ++  G +I  G  R R  E LF+      E   I     N+++K  +D+R  + +
Sbjct: 358 VEGSSQMGYGTIIVPGWIRERAAEVLFEDDEEN-EGESIVTVLLNTVLKLPIDLRPSILS 416

Query: 526 NTVLSGGTTMYPGIADRMQKEI--TALAPSTMKIKIIAPP 413
           + +++GG+   PG   R++  +  + L PS        PP
Sbjct: 417 SILITGGSASLPGFIPRLRISLLQSLLPPSQSSDDTPVPP 456


>UniRef50_Q4P230 Cluster: Putative uncharacterized protein; n=1;
           Ustilago maydis|Rep: Putative uncharacterized protein -
           Ustilago maydis (Smut fungus)
          Length = 692

 Score = 39.1 bits (87), Expect = 0.11
 Identities = 21/73 (28%), Positives = 39/73 (53%)
 Frame = -3

Query: 679 GQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYANTVLSGGTT 500
           G +   G  R R  E LF+      +   + + T +++ K  +D+R+ +  N ++SGGT 
Sbjct: 419 GVIAIPGWVRERAAELLFEQGT--QDDPSLIDMTVSAMSKLPIDLRRVMCENILVSGGTA 476

Query: 499 MYPGIADRMQKEI 461
           M PG A+R + ++
Sbjct: 477 MLPGFANRFRTQL 489


>UniRef50_A7QJ11 Cluster: Chromosome chr2 scaffold_105, whole genome
           shotgun sequence; n=1; Vitis vinifera|Rep: Chromosome
           chr2 scaffold_105, whole genome shotgun sequence - Vitis
           vinifera (Grape)
          Length = 52

 Score = 38.7 bits (86), Expect = 0.14
 Identities = 17/37 (45%), Positives = 25/37 (67%)
 Frame = -3

Query: 406 KYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHR 296
           K +   G  +L  + + + MWISK+EYDESG S+VH+
Sbjct: 15  KENTVFGLEVLYWIHSARLMWISKEEYDESGSSLVHQ 51


>UniRef50_Q4UIK3 Cluster: Actin, putative; n=2; Theileria|Rep:
           Actin, putative - Theileria annulata
          Length = 468

 Score = 38.7 bits (86), Expect = 0.14
 Identities = 22/95 (23%), Positives = 47/95 (49%), Gaps = 6/95 (6%)
 Frame = -3

Query: 556 DVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALA-----PSTMKIKIIAPPERKYSVW 392
           D ++ + +    V+SGG T +P +   +++++          S  ++  +   E+++S +
Sbjct: 373 DSEVNRVVLDQLVVSGGCTRHPAVVPILERDVEEYLRKKKLESGPRLVAVGGNEQQFSSY 432

Query: 391 IGGSILASLSTFQQMWISKQEYDESG-PSIVHRKC 290
           IG SIL+SL  F    ++  +  E G    + R+C
Sbjct: 433 IGASILSSLGAFTSFCVNLADVQELGLQRALQRRC 467


>UniRef50_Q2H0E9 Cluster: Putative uncharacterized protein; n=1;
           Chaetomium globosum|Rep: Putative uncharacterized
           protein - Chaetomium globosum (Soil fungus)
          Length = 656

 Score = 37.9 bits (84), Expect = 0.25
 Identities = 17/75 (22%), Positives = 37/75 (49%)
 Frame = -3

Query: 538 DLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLST 359
           D   +  L+GG  ++ G  +R+++ +TAL P+   + +    +     W G +  A    
Sbjct: 568 DFLRDVFLTGGNVLFEGFDERLRRGLTALLPAGAPLALRRADDAVLDAWRGAAGWAGTEE 627

Query: 358 FQQMWISKQEYDESG 314
            ++  +S++E+ E G
Sbjct: 628 ARRARVSREEWLEKG 642


>UniRef50_Q9VWE8 Cluster: CG12235-PA; n=4; Diptera|Rep: CG12235-PA -
           Drosophila melanogaster (Fruit fly)
          Length = 378

 Score = 37.5 bits (83), Expect = 0.33
 Identities = 23/96 (23%), Positives = 47/96 (48%), Gaps = 11/96 (11%)
 Frame = -3

Query: 571 SIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPST----------MKIKII 422
           SI+ C +D+R+ L  +  L GG +M  G+  R+++E+  L              ++ K  
Sbjct: 266 SILDCTLDVRRALVESVFLVGGGSMVQGLLARLRQELQHLLTEDPFYAERFHGELQFKFF 325

Query: 421 -APPERKYSVWIGGSILASLSTFQQMWISKQEYDES 317
            A  ++ ++ W+GG++  +    Q   + K+ Y +S
Sbjct: 326 NAVGKQNFTAWLGGALCGATDLIQTRSLVKETYLKS 361


>UniRef50_Q7QU75 Cluster: GLP_226_21952_22986; n=1; Giardia lamblia
           ATCC 50803|Rep: GLP_226_21952_22986 - Giardia lamblia
           ATCC 50803
          Length = 344

 Score = 37.5 bits (83), Expect = 0.33
 Identities = 31/134 (23%), Positives = 55/134 (41%)
 Frame = -3

Query: 703 EKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYAN 524
           E+  +LP G  IT+  E F   E++ Q S L        ET      +   +I       
Sbjct: 218 EEEIKLPCGHTITLNQELFGIAESMLQQSKLSTLILTTLETPSIGYHQSKGNIP------ 271

Query: 523 TVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMW 344
            ++ GG      +  R+Q++++       K  + +  +   +VW GG+    + T     
Sbjct: 272 VIIVGGLARLSNLTRRIQQDLSG------KATVQSTDDAINAVWQGGASFVGIETLGDFL 325

Query: 343 ISKQEYDESGPSIV 302
           I++   DE GP I+
Sbjct: 326 ITRALLDEQGPEIL 339


>UniRef50_A7EPN9 Cluster: Putative uncharacterized protein; n=1;
           Sclerotinia sclerotiorum 1980|Rep: Putative
           uncharacterized protein - Sclerotinia sclerotiorum 1980
          Length = 768

 Score = 37.1 bits (82), Expect = 0.43
 Identities = 22/101 (21%), Positives = 43/101 (42%), Gaps = 4/101 (3%)
 Frame = -3

Query: 583 TTYNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERK 404
           T+     K D    +D Y   +L GG    PG    ++ ++    P   +  ++    R+
Sbjct: 664 TSITHAAKHDDKKARDFYGGIMLIGGGAKTPGFGPFLEDKLRKKRPDLAERILVGTSPRE 723

Query: 403 YS----VWIGGSILASLSTFQQMWISKQEYDESGPSIVHRK 293
                 VW G S+ A +    + WI ++E++  G  ++ +K
Sbjct: 724 MDGQVVVWKGASVFARMK-MHESWIGQKEFEMLGARVLSQK 763


>UniRef50_Q5KMC1 Cluster: Nucleus protein, putative; n=1;
           Filobasidiella neoformans|Rep: Nucleus protein, putative
           - Cryptococcus neoformans (Filobasidiella neoformans)
          Length = 779

 Score = 36.7 bits (81), Expect = 0.57
 Identities = 24/95 (25%), Positives = 46/95 (48%), Gaps = 9/95 (9%)
 Frame = -3

Query: 571 SIMKCDVDIR-KDLYANTVLSGGTTMYPG----IADRMQKEITALA-PSTMKIKIIAPPE 410
           S+  C  + + + L  + +L GG++   G    I+DR+   +     P   ++ I+ PP 
Sbjct: 674 SLSLCGTENKIRTLSHSILLIGGSSSIKGLPAFISDRLPPLLKQRGVPGNGEVTIVPPPR 733

Query: 409 R---KYSVWIGGSILASLSTFQQMWISKQEYDESG 314
               +Y  W GGS++ ++     MWI + E++  G
Sbjct: 734 GLNPRYVSWKGGSVMCNIEGLGDMWIRRDEWEALG 768


>UniRef50_A7P2E9 Cluster: Chromosome chr1 scaffold_5, whole genome
           shotgun sequence; n=1; Vitis vinifera|Rep: Chromosome
           chr1 scaffold_5, whole genome shotgun sequence - Vitis
           vinifera (Grape)
          Length = 1122

 Score = 35.9 bits (79), Expect = 1.00
 Identities = 16/27 (59%), Positives = 19/27 (70%), Gaps = 1/27 (3%)
 Frame = +2

Query: 386 TDPYGVLPLWRSNDLNLHCRW-GESCD 463
           +DPYGVL  W S +L+ HC W G SCD
Sbjct: 50  SDPYGVLSSWSSENLD-HCSWAGISCD 75


>UniRef50_Q7M3Y5 Cluster: Actin; n=1; Aplysia californica|Rep: Actin
           - Aplysia californica (California sea hare)
          Length = 92

 Score = 35.9 bits (79), Expect = 1.00
 Identities = 16/18 (88%), Positives = 17/18 (94%)
 Frame = -3

Query: 466 EITALAPSTMKIKIIAPP 413
           +ITALAP TMKIKIIAPP
Sbjct: 75  QITALAPPTMKIKIIAPP 92


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 732,710,350
Number of Sequences: 1657284
Number of extensions: 15507998
Number of successful extensions: 47172
Number of sequences better than 10.0: 277
Number of HSP's better than 10.0 without gapping: 44883
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 46973
length of database: 575,637,011
effective HSP length: 98
effective length of database: 413,223,179
effective search space used: 57851245060
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).