SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= cesb0003
         (841 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_Q2L0Z7 Cluster: Putative fimbrial usher precursor; n=1;...    33   6.8  
UniRef50_Q2NF92 Cluster: Partially conserved hypothetical membra...    33   6.8  

>UniRef50_Q2L0Z7 Cluster: Putative fimbrial usher precursor; n=1;
           Bordetella avium 197N|Rep: Putative fimbrial usher
           precursor - Bordetella avium (strain 197N)
          Length = 840

 Score = 33.5 bits (73), Expect = 6.8
 Identities = 20/49 (40%), Positives = 29/49 (59%), Gaps = 2/49 (4%)
 Frame = -3

Query: 695 IYT*RNHEY*IRTDKMIKMRLSLTFSY*GQSKIN--YNNTTFQLLLSNY 555
           +YT R HEY +   + I  R S++F+Y G +  N  YN+T  QL  S+Y
Sbjct: 496 LYT-RQHEYQLSLSQRIANRASISFNYYGVTYRNAPYNSTFSQLSFSSY 543


>UniRef50_Q2NF92 Cluster: Partially conserved hypothetical
           membrane-spanning protein; n=1; Methanosphaera
           stadtmanae DSM 3091|Rep: Partially conserved
           hypothetical membrane-spanning protein - Methanosphaera
           stadtmanae (strain DSM 3091)
          Length = 976

 Score = 33.5 bits (73), Expect = 6.8
 Identities = 15/30 (50%), Positives = 20/30 (66%)
 Frame = -3

Query: 632 SLTFSY*GQSKINYNNTTFQLLLSNYFFSF 543
           ++T  Y G SK+N N TT +L L NY FS+
Sbjct: 643 NITVVYSGNSKLNANTTTSKLRLYNYVFSY 672


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 607,292,240
Number of Sequences: 1657284
Number of extensions: 9597165
Number of successful extensions: 17207
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 16713
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 17200
length of database: 575,637,011
effective HSP length: 100
effective length of database: 409,908,611
effective search space used: 73373641369
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).