SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= cesb0002
         (698 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_UPI0000ECD483 Cluster: UPI0000ECD483 related cluster; n...    77   3e-13
UniRef50_Q7RED5 Cluster: Putative uncharacterized protein PY0513...    44   0.004
UniRef50_UPI0000F2EBCE Cluster: PREDICTED: hypothetical protein;...    39   0.10 
UniRef50_A7SUZ6 Cluster: Predicted protein; n=2; Eukaryota|Rep: ...    36   1.3  
UniRef50_A2GSA9 Cluster: Putative uncharacterized protein; n=3; ...    34   2.9  

>UniRef50_UPI0000ECD483 Cluster: UPI0000ECD483 related cluster; n=1;
           Gallus gallus|Rep: UPI0000ECD483 UniRef100 entry -
           Gallus gallus
          Length = 103

 Score = 77.4 bits (182), Expect = 3e-13
 Identities = 42/74 (56%), Positives = 46/74 (62%)
 Frame = +1

Query: 412 GAPTARRTNATXSFLTATILVYXXXXXXXXXXXXRLALQLFLVKIFKVYSFRLRGLVRVP 591
           G P AR  + T SFLTA  L+Y            RLALQ  LVK FKV SF+L+GL RV 
Sbjct: 30  GGPPARSQDPTTSFLTAATLIYAIGAGITAAAGTRLALQWILVKGFKVDSFQLQGLERVL 89

Query: 592 YRYFSSLPPRAGSG 633
           Y YFSSLPPR GSG
Sbjct: 90  YCYFSSLPPRVGSG 103


>UniRef50_Q7RED5 Cluster: Putative uncharacterized protein PY05130;
           n=6; Plasmodium (Vinckeia)|Rep: Putative uncharacterized
           protein PY05130 - Plasmodium yoelii yoelii
          Length = 402

 Score = 44.0 bits (99), Expect = 0.004
 Identities = 18/26 (69%), Positives = 22/26 (84%)
 Frame = +1

Query: 70  GKCFR*CSSCDDPRISPLTSQYECPQ 147
           GKCFR C S ++ RISPLTS+Y+CPQ
Sbjct: 259 GKCFRSCLSPENLRISPLTSEYKCPQ 284


>UniRef50_UPI0000F2EBCE Cluster: PREDICTED: hypothetical protein;
           n=1; Monodelphis domestica|Rep: PREDICTED: hypothetical
           protein - Monodelphis domestica
          Length = 493

 Score = 39.1 bits (87), Expect = 0.10
 Identities = 16/19 (84%), Positives = 17/19 (89%)
 Frame = +3

Query: 576 PRKSPVSIFFVTTSPCREW 632
           PRKSPV +FFVTTSP REW
Sbjct: 24  PRKSPVLLFFVTTSPGREW 42


>UniRef50_A7SUZ6 Cluster: Predicted protein; n=2; Eukaryota|Rep:
          Predicted protein - Nematostella vectensis
          Length = 79

 Score = 35.5 bits (78), Expect = 1.3
 Identities = 16/20 (80%), Positives = 16/20 (80%)
 Frame = -2

Query: 61 FHQSRTKVRGSKAIRYRPSS 2
          F   RTKVRGSK IRYRPSS
Sbjct: 6  FRCQRTKVRGSKTIRYRPSS 25


>UniRef50_A2GSA9 Cluster: Putative uncharacterized protein; n=3;
           Trichomonas vaginalis G3|Rep: Putative uncharacterized
           protein - Trichomonas vaginalis G3
          Length = 76

 Score = 34.3 bits (75), Expect = 2.9
 Identities = 11/13 (84%), Positives = 11/13 (84%)
 Frame = +3

Query: 486 SWNYRGCWHQTCP 524
           SWNYR CWHQT P
Sbjct: 7   SWNYRSCWHQTGP 19



 Score = 32.7 bits (71), Expect = 8.9
 Identities = 15/26 (57%), Positives = 19/26 (73%)
 Frame = +1

Query: 613 PPRAGSG*FARLLPS*DVVAVSQAPS 690
           PP+  SG  +RLL   D+VA+SQAPS
Sbjct: 46  PPKVSSGKVSRLLLPVDIVAISQAPS 71


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 661,620,430
Number of Sequences: 1657284
Number of extensions: 12807988
Number of successful extensions: 28200
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 27398
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 28196
length of database: 575,637,011
effective HSP length: 98
effective length of database: 413,223,179
effective search space used: 55371905986
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).