SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= cesb0001
         (944 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_P62841 Cluster: 40S ribosomal protein S15; n=46; cellul...   107   3e-22
UniRef50_Q9FML6 Cluster: 40S ribosomal protein S15-6; n=9; Eukar...    93   1e-17
UniRef50_Q01855 Cluster: 40S ribosomal protein S15; n=140; Eukar...    89   1e-16
UniRef50_UPI0000DD8522 Cluster: PREDICTED: similar to 40S riboso...    85   2e-15
UniRef50_UPI00006CD29C Cluster: hypothetical protein TTHERM_0026...    73   1e-11
UniRef50_Q7QTT8 Cluster: GLP_191_11250_10813; n=1; Giardia lambl...    64   4e-09
UniRef50_Q6LX07 Cluster: 30S ribosomal protein S19P; n=9; Euryar...    56   1e-06
UniRef50_A2DVD8 Cluster: Ribosomal protein S19, putative; n=1; T...    56   1e-06
UniRef50_A7QFV7 Cluster: Chromosome undetermined scaffold_89, wh...    56   2e-06
UniRef50_Q8ZWL4 Cluster: 30S ribosomal protein S19P; n=7; Archae...    55   3e-06
UniRef50_Q975I5 Cluster: 30S ribosomal protein S19P; n=8; Archae...    48   5e-04
UniRef50_Q00XN5 Cluster: Homology to unknown gene; n=2; Ostreoco...    46   0.001
UniRef50_Q8SRE7 Cluster: RIBOSOMAL PROTEIN S15; n=1; Encephalito...    44   0.007
UniRef50_P94271 Cluster: 30S ribosomal protein S19; n=66; cellul...    42   0.023
UniRef50_Q2QAS7 Cluster: Ribosomal protein S19; n=3; Archaea|Rep...    41   0.053
UniRef50_Q74MZ5 Cluster: 30S ribosomal protein S19P; n=1; Nanoar...    40   0.070
UniRef50_Q9HIR3 Cluster: 30S ribosomal protein S19P; n=8; Euryar...    40   0.092
UniRef50_Q8PV46 Cluster: 30S ribosomal protein S19P; n=9; Archae...    39   0.16 
UniRef50_P15010 Cluster: 30S ribosomal protein S19P; n=5; Euryar...    39   0.21 
UniRef50_A0MNZ0 Cluster: NADPH oxidoreductase; n=1; Bombyx mori|...    38   0.49 
UniRef50_O66435 Cluster: 30S ribosomal protein S19; n=32; Bacter...    37   0.86 
UniRef50_Q3LWF2 Cluster: Ribosomal protein L15; n=1; Bigelowiell...    36   1.1  
UniRef50_A6QU02 Cluster: Predicted protein; n=1; Ajellomyces cap...    36   1.1  
UniRef50_Q9AIN5 Cluster: Ribosomal protein S19; n=1; Candidatus ...    35   2.6  
UniRef50_Q8M1F9 Cluster: Ribosomal protein S19; n=1; Chaetosphae...    35   2.6  
UniRef50_P56808 Cluster: Chloroplast 30S ribosomal protein S19; ...    35   2.6  
UniRef50_Q4URE3 Cluster: 30S ribosomal protein S19; n=18; cellul...    34   6.1  
UniRef50_A1ZR64 Cluster: Mannosyltransferase B; n=1; Microscilla...    33   8.0  
UniRef50_Q8HD74 Cluster: DNA-directed RNA polymerase; n=1; Brass...    33   8.0  
UniRef50_A6BM61 Cluster: Ribosomal protein S19; n=1; Gnetum parv...    33   8.0  

>UniRef50_P62841 Cluster: 40S ribosomal protein S15; n=46; cellular
           organisms|Rep: 40S ribosomal protein S15 - Homo sapiens
           (Human)
          Length = 145

 Score =  107 bits (258), Expect = 3e-22
 Identities = 50/75 (66%), Positives = 61/75 (81%)
 Frame = +2

Query: 458 EQLMELMHXXXXXXXXXGLKRKPMALVKKLRRAKKEAPPNEKPEIVKTHLRNMIIVPEMV 637
           EQLM+L           GL+RK  +L+K+LR+AKKEAPP EKPE+VKTHLR+MII+PEMV
Sbjct: 31  EQLMQLYSARQRRRLNRGLRRKQHSLLKRLRKAKKEAPPMEKPEVVKTHLRDMIILPEMV 90

Query: 638 GSIVGIYNGKTFNQV 682
           GS+VG+YNGKTFNQV
Sbjct: 91  GSMVGVYNGKTFNQV 105



 Score = 47.6 bits (108), Expect = 5e-04
 Identities = 21/22 (95%), Positives = 21/22 (95%)
 Frame = +3

Query: 174 KKKRIFRKFTYRGVDLDQLLDM 239
           KKKR FRKFTYRGVDLDQLLDM
Sbjct: 7   KKKRTFRKFTYRGVDLDQLLDM 28


>UniRef50_Q9FML6 Cluster: 40S ribosomal protein S15-6; n=9;
           Eukaryota|Rep: 40S ribosomal protein S15-6 - Arabidopsis
           thaliana (Mouse-ear cress)
          Length = 160

 Score = 92.7 bits (220), Expect = 1e-17
 Identities = 41/60 (68%), Positives = 52/60 (86%), Gaps = 2/60 (3%)
 Frame = +2

Query: 509 GLKRKPMALVKKLRRAKKEAPPNEK--PEIVKTHLRNMIIVPEMVGSIVGIYNGKTFNQV 682
           GLK++P+ L+KKLRRAKKEA    K  PE+VKTHLRNMIIVPEM+GS+VG++NGK FN++
Sbjct: 57  GLKKQPLILIKKLRRAKKEASDENKMKPEVVKTHLRNMIIVPEMIGSVVGVHNGKKFNEI 116


>UniRef50_Q01855 Cluster: 40S ribosomal protein S15; n=140;
           Eukaryota|Rep: 40S ribosomal protein S15 - Saccharomyces
           cerevisiae (Baker's yeast)
          Length = 142

 Score = 89.4 bits (212), Expect = 1e-16
 Identities = 40/58 (68%), Positives = 46/58 (79%)
 Frame = +2

Query: 509 GLKRKPMALVKKLRRAKKEAPPNEKPEIVKTHLRNMIIVPEMVGSIVGIYNGKTFNQV 682
           G+  KP   +KKLR AK  AP NEKP  V+TH+RNMIIVPEM+GS+VGIYNGK FNQV
Sbjct: 48  GMTSKPAGFMKKLRAAKLAAPENEKPAPVRTHMRNMIIVPEMIGSVVGIYNGKAFNQV 105



 Score = 34.3 bits (75), Expect = 4.6
 Identities = 13/21 (61%), Positives = 19/21 (90%)
 Frame = +3

Query: 177 KKRIFRKFTYRGVDLDQLLDM 239
           KKR+F+  +YRGVDL++LL+M
Sbjct: 8   KKRVFKTHSYRGVDLEKLLEM 28


>UniRef50_UPI0000DD8522 Cluster: PREDICTED: similar to 40S ribosomal
           protein S15 (RIG protein); n=2; Homo sapiens|Rep:
           PREDICTED: similar to 40S ribosomal protein S15 (RIG
           protein) - Homo sapiens
          Length = 134

 Score = 85.0 bits (201), Expect = 2e-15
 Identities = 37/58 (63%), Positives = 49/58 (84%)
 Frame = +2

Query: 509 GLKRKPMALVKKLRRAKKEAPPNEKPEIVKTHLRNMIIVPEMVGSIVGIYNGKTFNQV 682
           GL RK  +L+K+LR+AKK APP EKPE+VKTH R+++++P MVGS VG+Y+GKTF QV
Sbjct: 67  GLWRKQRSLLKRLRKAKKGAPPTEKPEVVKTHPRDVLLLPAMVGSTVGVYDGKTFKQV 124



 Score = 39.1 bits (87), Expect = 0.16
 Identities = 17/22 (77%), Positives = 19/22 (86%)
 Frame = +3

Query: 174 KKKRIFRKFTYRGVDLDQLLDM 239
           +KK+ FR FT RGVDLDQLLDM
Sbjct: 20  QKKQTFRNFTQRGVDLDQLLDM 41


>UniRef50_UPI00006CD29C Cluster: hypothetical protein
           TTHERM_00266390; n=1; Tetrahymena thermophila SB210|Rep:
           hypothetical protein TTHERM_00266390 - Tetrahymena
           thermophila SB210
          Length = 144

 Score = 72.9 bits (171), Expect = 1e-11
 Identities = 34/76 (44%), Positives = 46/76 (60%)
 Frame = +2

Query: 455 SEQLMELMHXXXXXXXXXGLKRKPMALVKKLRRAKKEAPPNEKPEIVKTHLRNMIIVPEM 634
           S++L  L           G+  K    V K+RR+K++ P  EKP  VKTH R+MI++PE+
Sbjct: 35  SDELAALFDAKTRRRVKRGISEKYAKFVNKVRRSKEKCPAGEKPVPVKTHYRSMIVIPEL 94

Query: 635 VGSIVGIYNGKTFNQV 682
           VG IVG+YNGK F  V
Sbjct: 95  VGGIVGVYNGKEFVNV 110


>UniRef50_Q7QTT8 Cluster: GLP_191_11250_10813; n=1; Giardia lamblia
           ATCC 50803|Rep: GLP_191_11250_10813 - Giardia lamblia
           ATCC 50803
          Length = 145

 Score = 64.5 bits (150), Expect = 4e-09
 Identities = 29/55 (52%), Positives = 40/55 (72%)
 Frame = +2

Query: 509 GLKRKPMALVKKLRRAKKEAPPNEKPEIVKTHLRNMIIVPEMVGSIVGIYNGKTF 673
           GL  K +  V KLR  ++ A P++KP+IV+THLR+MII PEM+G  V +YNG+ F
Sbjct: 49  GLSMKHLRFVNKLR-LRRAAQPSQKPKIVRTHLRDMIIFPEMIGMTVSVYNGRQF 102


>UniRef50_Q6LX07 Cluster: 30S ribosomal protein S19P; n=9;
           Euryarchaeota|Rep: 30S ribosomal protein S19P -
           Methanococcus maripaludis
          Length = 161

 Score = 56.4 bits (130), Expect = 1e-06
 Identities = 23/76 (30%), Positives = 43/76 (56%)
 Frame = +2

Query: 458 EQLMELMHXXXXXXXXXGLKRKPMALVKKLRRAKKEAPPNEKPEIVKTHLRNMIIVPEMV 637
           ++ ME++          G+  K   LV K+++A++     +   +++TH R+ +I PEM+
Sbjct: 47  KKFMEIVPSRQRRTMARGITPKQRKLVMKIKKARRLTNRGKDARVIRTHCRDFVITPEMI 106

Query: 638 GSIVGIYNGKTFNQVR 685
           G   GIYNGK F +++
Sbjct: 107 GLTFGIYNGKEFKEIK 122


>UniRef50_A2DVD8 Cluster: Ribosomal protein S19, putative; n=1;
           Trichomonas vaginalis G3|Rep: Ribosomal protein S19,
           putative - Trichomonas vaginalis G3
          Length = 144

 Score = 56.0 bits (129), Expect = 1e-06
 Identities = 24/57 (42%), Positives = 42/57 (73%), Gaps = 2/57 (3%)
 Frame = +2

Query: 521 KPMALVKKLRRAKK--EAPPNEKPEIVKTHLRNMIIVPEMVGSIVGIYNGKTFNQVR 685
           K + L++KL++A++  E     +P +VKTHLR+M+I+PE V +++GIY+G  F +V+
Sbjct: 49  KHVHLIEKLKKARQAVEGQAGVRPPVVKTHLRHMVILPEFVDNVIGIYDGHVFFEVQ 105


>UniRef50_A7QFV7 Cluster: Chromosome undetermined scaffold_89, whole
           genome shotgun sequence; n=1; Vitis vinifera|Rep:
           Chromosome undetermined scaffold_89, whole genome
           shotgun sequence - Vitis vinifera (Grape)
          Length = 319

 Score = 55.6 bits (128), Expect = 2e-06
 Identities = 25/46 (54%), Positives = 33/46 (71%)
 Frame = +2

Query: 545 LRRAKKEAPPNEKPEIVKTHLRNMIIVPEMVGSIVGIYNGKTFNQV 682
           L+   + + P+E P+  + HL NMIIV EM+G IVG+YNGKT NQV
Sbjct: 11  LKTKTRGSIPSENPKQTRIHLYNMIIVLEMIGYIVGVYNGKTLNQV 56


>UniRef50_Q8ZWL4 Cluster: 30S ribosomal protein S19P; n=7;
           Archaea|Rep: 30S ribosomal protein S19P - Pyrobaculum
           aerophilum
          Length = 158

 Score = 54.8 bits (126), Expect = 3e-06
 Identities = 26/72 (36%), Positives = 46/72 (63%)
 Frame = +2

Query: 458 EQLMELMHXXXXXXXXXGLKRKPMALVKKLRRAKKEAPPNEKPEIVKTHLRNMIIVPEMV 637
           ++ ++L+          GLK +   L++K+R+AK+ A   +K  +++TH R+MII+PEMV
Sbjct: 45  DEFIKLLPARQRRSLKRGLKPEHRKLLEKIRKAKRLAAQGKKV-VIRTHCRDMIILPEMV 103

Query: 638 GSIVGIYNGKTF 673
           G  + +YNG T+
Sbjct: 104 GLTIHVYNGITY 115


>UniRef50_Q975I5 Cluster: 30S ribosomal protein S19P; n=8;
           Archaea|Rep: 30S ribosomal protein S19P - Sulfolobus
           tokodaii
          Length = 140

 Score = 47.6 bits (108), Expect = 5e-04
 Identities = 24/72 (33%), Positives = 41/72 (56%)
 Frame = +2

Query: 458 EQLMELMHXXXXXXXXXGLKRKPMALVKKLRRAKKEAPPNEKPEIVKTHLRNMIIVPEMV 637
           ++ ++L+          G   K   L++K+R+  +E    +  + +KTH+R+MII+PEMV
Sbjct: 28  DEFIKLLPSRQRRSLKKGFSDKQRRLLEKIRKYVREG---KYSKTIKTHVRDMIILPEMV 84

Query: 638 GSIVGIYNGKTF 673
           G    +YNGK F
Sbjct: 85  GLKFAVYNGKEF 96


>UniRef50_Q00XN5 Cluster: Homology to unknown gene; n=2;
           Ostreococcus|Rep: Homology to unknown gene -
           Ostreococcus tauri
          Length = 561

 Score = 46.4 bits (105), Expect = 0.001
 Identities = 26/50 (52%), Positives = 30/50 (60%)
 Frame = -3

Query: 687 LRTWLKVFPL*MPTIEPTISGTMIMFLK*VFTISGFSFGGASFLARRSFL 538
           + T L   PL  PT EPTISG M M  + V T+SGFS    + LA RSFL
Sbjct: 47  ISTVLNTLPLYTPTTEPTISGMMGMLRRCVRTVSGFSIPTTAALALRSFL 96


>UniRef50_Q8SRE7 Cluster: RIBOSOMAL PROTEIN S15; n=1;
           Encephalitozoon cuniculi|Rep: RIBOSOMAL PROTEIN S15 -
           Encephalitozoon cuniculi
          Length = 149

 Score = 43.6 bits (98), Expect = 0.007
 Identities = 21/56 (37%), Positives = 34/56 (60%), Gaps = 1/56 (1%)
 Frame = +2

Query: 509 GLKRKPMALVKKLRRAKKEA-PPNEKPEIVKTHLRNMIIVPEMVGSIVGIYNGKTF 673
           GL  + + L+K    AK      + KPE+V+TH R+ II P M+G++VG++ G  +
Sbjct: 51  GLSSREVELIKGCIAAKAACVSSSSKPEMVRTHARSAIIWPAMIGALVGVHVGNGY 106



 Score = 37.1 bits (82), Expect = 0.65
 Identities = 15/27 (55%), Positives = 21/27 (77%)
 Frame = +3

Query: 162 DETLKKKRIFRKFTYRGVDLDQLLDMP 242
           +E  KKKR FR++TYRGV +++L  MP
Sbjct: 6   NEVSKKKRTFRRYTYRGVPVEELEKMP 32


>UniRef50_P94271 Cluster: 30S ribosomal protein S19; n=66; cellular
           organisms|Rep: 30S ribosomal protein S19 - Borrelia
           burgdorferi (Lyme disease spirochete)
          Length = 92

 Score = 41.9 bits (94), Expect = 0.023
 Identities = 20/54 (37%), Positives = 33/54 (61%)
 Frame = +2

Query: 512 LKRKPMALVKKLRRAKKEAPPNEKPEIVKTHLRNMIIVPEMVGSIVGIYNGKTF 673
           +K+ P  + K L +    +  +EK  ++KT+ R+  I+PEMV   + +YNGKTF
Sbjct: 5   IKKGPF-IEKSLYQKVLSSFGSEKRVVIKTYSRSSTIIPEMVSLTISVYNGKTF 57


>UniRef50_Q2QAS7 Cluster: Ribosomal protein S19; n=3; Archaea|Rep:
           Ribosomal protein S19 - uncultured marine group II
           euryarchaeote HF70_59C08
          Length = 173

 Score = 40.7 bits (91), Expect = 0.053
 Identities = 16/36 (44%), Positives = 26/36 (72%), Gaps = 1/36 (2%)
 Frame = +2

Query: 578 EKP-EIVKTHLRNMIIVPEMVGSIVGIYNGKTFNQV 682
           E P + +KTH R++ I+PEMVG  +G+++G+ F  V
Sbjct: 98  ENPGKTIKTHCRSLYILPEMVGRTIGVHDGRAFKMV 133


>UniRef50_Q74MZ5 Cluster: 30S ribosomal protein S19P; n=1;
           Nanoarchaeum equitans|Rep: 30S ribosomal protein S19P -
           Nanoarchaeum equitans
          Length = 140

 Score = 40.3 bits (90), Expect = 0.070
 Identities = 24/51 (47%), Positives = 32/51 (62%)
 Frame = +2

Query: 533 LVKKLRRAKKEAPPNEKPEIVKTHLRNMIIVPEMVGSIVGIYNGKTFNQVR 685
           L KK+  AK+     +KP  +KTH RN II+P MVG  V +YNGK +  V+
Sbjct: 55  LFKKILLAKEGK--YKKP--IKTHARNTIILPFMVGVTVHVYNGKEYVPVQ 101


>UniRef50_Q9HIR3 Cluster: 30S ribosomal protein S19P; n=8;
           Euryarchaeota|Rep: 30S ribosomal protein S19P -
           Thermoplasma acidophilum
          Length = 151

 Score = 39.9 bits (89), Expect = 0.092
 Identities = 16/29 (55%), Positives = 23/29 (79%)
 Frame = +2

Query: 587 EIVKTHLRNMIIVPEMVGSIVGIYNGKTF 673
           E VKTH+R++II+P  VG IV +YNG ++
Sbjct: 80  EDVKTHVRDVIILPNYVGKIVEVYNGNSY 108


>UniRef50_Q8PV46 Cluster: 30S ribosomal protein S19P; n=9;
           Archaea|Rep: 30S ribosomal protein S19P - Methanosarcina
           mazei (Methanosarcina frisia)
          Length = 136

 Score = 39.1 bits (87), Expect = 0.16
 Identities = 15/30 (50%), Positives = 23/30 (76%)
 Frame = +2

Query: 593 VKTHLRNMIIVPEMVGSIVGIYNGKTFNQV 682
           ++TH R+MII+PEM+G  + ++NGK F  V
Sbjct: 67  IRTHHRDMIILPEMIGIAIEVHNGKEFVNV 96


>UniRef50_P15010 Cluster: 30S ribosomal protein S19P; n=5;
           Euryarchaeota|Rep: 30S ribosomal protein S19P -
           Halobacterium salinarium (Halobacterium halobium)
          Length = 140

 Score = 38.7 bits (86), Expect = 0.21
 Identities = 21/75 (28%), Positives = 36/75 (48%)
 Frame = +2

Query: 458 EQLMELMHXXXXXXXXXGLKRKPMALVKKLRRAKKEAPPNEKPEIVKTHLRNMIIVPEMV 637
           E + EL+          GL  +   ++ + R +  E   N     ++THLR+M ++PE V
Sbjct: 29  EDVAELLPARQRRTITRGLSEEHHKVLAEARESGTEETANNP---IRTHLRDMPVLPEFV 85

Query: 638 GSIVGIYNGKTFNQV 682
           G    +Y G+ F +V
Sbjct: 86  GLTFAVYTGQEFERV 100


>UniRef50_A0MNZ0 Cluster: NADPH oxidoreductase; n=1; Bombyx
           mori|Rep: NADPH oxidoreductase - Bombyx mori (Silk moth)
          Length = 191

 Score = 37.5 bits (83), Expect = 0.49
 Identities = 17/19 (89%), Positives = 18/19 (94%)
 Frame = -3

Query: 933 FLLLRCVDELTAHLMLSGY 877
           FLLLR VDELTAHL+LSGY
Sbjct: 154 FLLLRWVDELTAHLVLSGY 172


>UniRef50_O66435 Cluster: 30S ribosomal protein S19; n=32;
           Bacteria|Rep: 30S ribosomal protein S19 - Aquifex
           aeolicus
          Length = 219

 Score = 36.7 bits (81), Expect = 0.86
 Identities = 18/48 (37%), Positives = 29/48 (60%)
 Frame = +2

Query: 551 RAKKEAPPNEKPEIVKTHLRNMIIVPEMVGSIVGIYNGKTFNQVRKSQ 694
           R +K     E+ ++V+T+ R   I+PE VG  + ++NGKTF  V  +Q
Sbjct: 143 RIRKMNETGER-KVVRTYSRATTIIPEFVGHTIAVHNGKTFVPVYITQ 189


>UniRef50_Q3LWF2 Cluster: Ribosomal protein L15; n=1; Bigelowiella
           natans|Rep: Ribosomal protein L15 - Bigelowiella natans
           (Pedinomonas minutissima) (Chlorarachnion sp.(strain
           CCMP 621))
          Length = 151

 Score = 36.3 bits (80), Expect = 1.1
 Identities = 12/36 (33%), Positives = 23/36 (63%)
 Frame = +2

Query: 593 VKTHLRNMIIVPEMVGSIVGIYNGKTFNQVRKSQIL 700
           +KTH+RN II P M+   + +YNG +++ +    ++
Sbjct: 82  LKTHVRNCIITPSMINKKIYVYNGNSYSYIELQTLM 117


>UniRef50_A6QU02 Cluster: Predicted protein; n=1; Ajellomyces
           capsulatus NAm1|Rep: Predicted protein - Ajellomyces
           capsulatus NAm1
          Length = 144

 Score = 36.3 bits (80), Expect = 1.1
 Identities = 15/38 (39%), Positives = 22/38 (57%)
 Frame = +2

Query: 569 PPNEKPEIVKTHLRNMIIVPEMVGSIVGIYNGKTFNQV 682
           PP      +KT  R+  I+P  VG    ++NGKT+N+V
Sbjct: 2   PPPPGTPAIKTQARSATILPNFVGLKFAVHNGKTYNEV 39


>UniRef50_Q9AIN5 Cluster: Ribosomal protein S19; n=1; Candidatus
           Carsonella ruddii|Rep: Ribosomal protein S19 -
           Carsonella ruddii
          Length = 88

 Score = 35.1 bits (77), Expect = 2.6
 Identities = 14/29 (48%), Positives = 21/29 (72%)
 Frame = +2

Query: 596 KTHLRNMIIVPEMVGSIVGIYNGKTFNQV 682
           KT  RN  I+P+M+G  + ++NGK FN+V
Sbjct: 25  KTWSRNSTIIPKMIGLNIFVHNGKKFNKV 53


>UniRef50_Q8M1F9 Cluster: Ribosomal protein S19; n=1;
           Chaetosphaeridium globosum|Rep: Ribosomal protein S19 -
           Chaetosphaeridium globosum
          Length = 114

 Score = 35.1 bits (77), Expect = 2.6
 Identities = 18/53 (33%), Positives = 30/53 (56%), Gaps = 2/53 (3%)
 Frame = +2

Query: 521 KPMALVKKLRR--AKKEAPPNEKPEIVKTHLRNMIIVPEMVGSIVGIYNGKTF 673
           +PM    +L+R  + ++A   +   + K   R   I+P+ VG+IV +YNGK F
Sbjct: 23  RPMGEDTRLKREGSTEQAFVTKSSSLQKIWSRRSCILPQFVGNIVSVYNGKNF 75


>UniRef50_P56808 Cluster: Chloroplast 30S ribosomal protein S19;
           n=326; cellular organisms|Rep: Chloroplast 30S ribosomal
           protein S19 - Arabidopsis thaliana (Mouse-ear cress)
          Length = 92

 Score = 35.1 bits (77), Expect = 2.6
 Identities = 19/52 (36%), Positives = 28/52 (53%)
 Frame = +2

Query: 512 LKRKPMALVKKLRRAKKEAPPNEKPEIVKTHLRNMIIVPEMVGSIVGIYNGK 667
           LK+ P      LR+ +K     EK EI+ T  R   I+P M+G  + I+NG+
Sbjct: 5   LKKNPFVAKHLLRKIEKLNTKAEK-EIIITWSRASTIIPTMIGHTIAIHNGR 55


>UniRef50_Q4URE3 Cluster: 30S ribosomal protein S19; n=18; cellular
           organisms|Rep: 30S ribosomal protein S19 - Xanthomonas
           campestris pv. campestris (strain 8004)
          Length = 89

 Score = 33.9 bits (74), Expect = 6.1
 Identities = 19/52 (36%), Positives = 31/52 (59%)
 Frame = +2

Query: 512 LKRKPMALVKKLRRAKKEAPPNEKPEIVKTHLRNMIIVPEMVGSIVGIYNGK 667
           LK+ P  +   L +  + A  ++KP  +KT  R  +I+PEMVG  + ++NGK
Sbjct: 5   LKKGPF-VDHHLAKKVESAAGSKKP--IKTWSRRSMILPEMVGITIAVHNGK 53


>UniRef50_A1ZR64 Cluster: Mannosyltransferase B; n=1; Microscilla
           marina ATCC 23134|Rep: Mannosyltransferase B -
           Microscilla marina ATCC 23134
          Length = 358

 Score = 33.5 bits (73), Expect = 8.0
 Identities = 16/39 (41%), Positives = 23/39 (58%)
 Frame = +2

Query: 95  YVKNLKTVLFKKSEQLCLCFSGRRNPQEKAYFQEVHLPG 211
           Y+KNL   L K+ EQLCL  + + +   K +F   H+PG
Sbjct: 22  YIKNLSKQLLKQ-EQLCLTGAYKASRFRKTHFMRQHIPG 59


>UniRef50_Q8HD74 Cluster: DNA-directed RNA polymerase; n=1; Brassica
           napus|Rep: DNA-directed RNA polymerase - Brassica napus
           (Rape)
          Length = 1078

 Score = 33.5 bits (73), Expect = 8.0
 Identities = 18/45 (40%), Positives = 27/45 (60%)
 Frame = +2

Query: 14  NIS*FYLN*LKESHILLQILSVLYRQQYVKNLKTVLFKKSEQLCL 148
           NI  FYL+  K+   +L+ILS L RQ+++ N   + F K  +L L
Sbjct: 367 NIDRFYLSFRKDPSNMLEILSFLQRQKFLINKSMLKFIKDNRLAL 411


>UniRef50_A6BM61 Cluster: Ribosomal protein S19; n=1; Gnetum
           parvifolium|Rep: Ribosomal protein S19 - Gnetum
           parvifolium
          Length = 115

 Score = 33.5 bits (73), Expect = 8.0
 Identities = 18/45 (40%), Positives = 27/45 (60%)
 Frame = +2

Query: 533 LVKKLRRAKKEAPPNEKPEIVKTHLRNMIIVPEMVGSIVGIYNGK 667
           L+ K+ + K+    N+K +I+ T  R   IVPEMVG    ++NGK
Sbjct: 31  LLTKIEKLKR----NKKQKIIITWSRASTIVPEMVGYTFAVHNGK 71


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 806,586,540
Number of Sequences: 1657284
Number of extensions: 14511202
Number of successful extensions: 30860
Number of sequences better than 10.0: 30
Number of HSP's better than 10.0 without gapping: 29627
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 30845
length of database: 575,637,011
effective HSP length: 101
effective length of database: 408,251,327
effective search space used: 86957532651
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).