SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0044
         (613 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_P40463 Cluster: Protein VHS2; n=3; Saccharomyces cerevi...    33   5.3  
UniRef50_Q013C0 Cluster: FTSH1_SYNY3 Cell division protein ftsH ...    33   7.1  

>UniRef50_P40463 Cluster: Protein VHS2; n=3; Saccharomyces
           cerevisiae|Rep: Protein VHS2 - Saccharomyces cerevisiae
           (Baker's yeast)
          Length = 436

 Score = 33.1 bits (72), Expect = 5.3
 Identities = 17/41 (41%), Positives = 23/41 (56%), Gaps = 1/41 (2%)
 Frame = -1

Query: 193 CSIINDVTTGIPDVEILYKAR-SEVTAYNCLASVECLHSQS 74
           CSI+ D TTG+ DV+++Y  R S +     L     L SQS
Sbjct: 137 CSIVTDDTTGLDDVDMVYSRRPSTIGLDRALGRTRSLSSQS 177


>UniRef50_Q013C0 Cluster: FTSH1_SYNY3 Cell division protein ftsH
           homolog 1 dbj|BAA10230.1| cell division prot; n=2;
           Ostreococcus|Rep: FTSH1_SYNY3 Cell division protein ftsH
           homolog 1 dbj|BAA10230.1| cell division prot -
           Ostreococcus tauri
          Length = 891

 Score = 32.7 bits (71), Expect = 7.1
 Identities = 15/41 (36%), Positives = 23/41 (56%)
 Frame = +3

Query: 306 RPSRCEAAERGRRTRSNCDSRVDRGRPHTRSNSRPTVTAWV 428
           RPS  +A+ R RR R +  S +DR  P+  +N+   V  +V
Sbjct: 26  RPSASDASARARRERPSSASSLDRATPYVEANAVDVVDPYV 66


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 550,172,837
Number of Sequences: 1657284
Number of extensions: 10216116
Number of successful extensions: 23900
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 23257
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 23891
length of database: 575,637,011
effective HSP length: 97
effective length of database: 414,880,463
effective search space used: 43977329078
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).