SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0042
         (619 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_Q23Q43 Cluster: Putative uncharacterized protein; n=1; ...    34   2.4  
UniRef50_Q6ZUR3 Cluster: CDNA FLJ43411 fis, clone OCBBF2021286; ...    33   4.1  
UniRef50_A0CZU7 Cluster: Chromosome undetermined scaffold_32, wh...    33   7.2  
UniRef50_Q15RH1 Cluster: Oligopeptide/dipeptide ABC transporter,...    32   9.5  

>UniRef50_Q23Q43 Cluster: Putative uncharacterized protein; n=1;
            Tetrahymena thermophila SB210|Rep: Putative
            uncharacterized protein - Tetrahymena thermophila SB210
          Length = 3006

 Score = 34.3 bits (75), Expect = 2.4
 Identities = 20/56 (35%), Positives = 33/56 (58%)
 Frame = +2

Query: 233  IMSISVTRRLHGLLLFVNVCFSLIDLLEIRFILSIVRIRLSQSLLDIPAPLITSKS 400
            I  ++V  R H  +L++    S+IDLLE  F  +I R++  +S +D P P+I  +S
Sbjct: 889  IQQLTVNFRSHNKILYL--ANSVIDLLEFFFPETIDRLKKEKSSIDGPKPIILGES 942


>UniRef50_Q6ZUR3 Cluster: CDNA FLJ43411 fis, clone OCBBF2021286;
           n=1; Homo sapiens|Rep: CDNA FLJ43411 fis, clone
           OCBBF2021286 - Homo sapiens (Human)
          Length = 233

 Score = 33.5 bits (73), Expect = 4.1
 Identities = 31/99 (31%), Positives = 47/99 (47%), Gaps = 4/99 (4%)
 Frame = +2

Query: 179 WPFDCRVGHRCPTRRTEVIMS-ISVTRRLHGLLLFVNVCFSLIDLLEIRFILSI-VRIRL 352
           W F  +  +   T+   V +S +  TRRL   LL  N+C SL   L +   LS+ + + L
Sbjct: 74  WLFPWQCDYPALTQSKGVPLSWVKFTRRLLKCLLRGNLCLSLSLSLSLSLSLSLSLSLSL 133

Query: 353 SQ--SLLDIPAPLITSKST*LLQYLKIFFSCRVKYLFSL 463
           SQ  SLL    P   SK+  L++ L    +  + +  SL
Sbjct: 134 SQCISLLSFTFPFFLSKNNVLVEALVTLINQNLPFPVSL 172


>UniRef50_A0CZU7 Cluster: Chromosome undetermined scaffold_32, whole
           genome shotgun sequence; n=4; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_32,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 521

 Score = 32.7 bits (71), Expect = 7.2
 Identities = 15/46 (32%), Positives = 26/46 (56%)
 Frame = -2

Query: 345 IRTILRMNRISKRSMRLKHTLTNNRRPCRRLVTEIDIITSVRRVGH 208
           +RTI+ +   S+  ++++  L+NNRR  R  V ++D    V   GH
Sbjct: 444 LRTIIELRSQSELDLKVQSQLSNNRRQSRLAVNQVDDFDLVPDEGH 489


>UniRef50_Q15RH1 Cluster: Oligopeptide/dipeptide ABC transporter,
           ATPase subunit; n=3; Proteobacteria|Rep:
           Oligopeptide/dipeptide ABC transporter, ATPase subunit -
           Pseudoalteromonas atlantica (strain T6c / BAA-1087)
          Length = 331

 Score = 32.3 bits (70), Expect = 9.5
 Identities = 13/30 (43%), Positives = 17/30 (56%)
 Frame = +2

Query: 176 HWPFDCRVGHRCPTRRTEVIMSISVTRRLH 265
           H P  CR+G RCP  R E +  +   RR+H
Sbjct: 288 HLPIGCRLGPRCPRARRECV-KVPEVRRIH 316


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 574,582,438
Number of Sequences: 1657284
Number of extensions: 11119113
Number of successful extensions: 21171
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 20671
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 21168
length of database: 575,637,011
effective HSP length: 97
effective length of database: 414,880,463
effective search space used: 44807090004
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).