SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0039
         (616 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_O65314 Cluster: Actin; n=20; Eukaryota|Rep: Actin - Sch...   185   6e-46
UniRef50_Q96483 Cluster: Actin-51; n=584; Eukaryota|Rep: Actin-5...   183   3e-45
UniRef50_Q4JSC0 Cluster: Actin; n=13; Coelomata|Rep: Actin - Ano...   181   1e-44
UniRef50_P14883 Cluster: Actin-2; n=75; Eukaryota|Rep: Actin-2 -...   179   6e-44
UniRef50_P02581 Cluster: Actin-1; n=1852; Eukaryota|Rep: Actin-1...   164   2e-39
UniRef50_Q0VHZ5 Cluster: Actin deviating protein; n=7; Eukaryota...   155   1e-36
UniRef50_Q7XB26 Cluster: Ubiquitin/actin fusion protein 4; n=1; ...   138   1e-31
UniRef50_A5E2K2 Cluster: Actin; n=5; Saccharomycetales|Rep: Acti...   136   4e-31
UniRef50_Q0VHZ6 Cluster: Actin deviating protein; n=2; Bolivina ...   135   7e-31
UniRef50_UPI0000449751 Cluster: PREDICTED: similar to gamma-acti...   128   1e-28
UniRef50_UPI000065FC19 Cluster: Homolog of Homo sapiens "Actin, ...   126   3e-28
UniRef50_A2DKQ5 Cluster: Actin 58, putative; n=2; Trichomonas va...   126   3e-28
UniRef50_UPI0000F2D825 Cluster: PREDICTED: similar to actin; n=1...   125   7e-28
UniRef50_UPI0000F2D326 Cluster: PREDICTED: similar to actin; n=1...   124   1e-27
UniRef50_UPI0000605B09 Cluster: PREDICTED: similar to actin alph...   120   3e-26
UniRef50_UPI00005A2ACF Cluster: PREDICTED: similar to cytoplasmi...   120   3e-26
UniRef50_UPI00001E426E Cluster: PREDICTED: similar to actin-12; ...   120   3e-26
UniRef50_A4QNT8 Cluster: Si:ch211-241j12.3 protein; n=3; Danio r...   119   6e-26
UniRef50_Q2GY63 Cluster: Putative uncharacterized protein; n=1; ...   118   1e-25
UniRef50_P61163 Cluster: Alpha-centractin; n=356; root|Rep: Alph...   117   3e-25
UniRef50_Q9XZB9 Cluster: Actin; n=1; Sterkiella nova|Rep: Actin ...   115   1e-24
UniRef50_A7QKV4 Cluster: Chromosome chr8 scaffold_115, whole gen...   114   2e-24
UniRef50_Q9DFB8 Cluster: Actin; n=1; Scomberomorus maculatus|Rep...   113   2e-24
UniRef50_Q8MVN5 Cluster: Cardiac actin-like protein; n=1; Bolten...   111   2e-23
UniRef50_Q4CV94 Cluster: Actin 2, putative; n=2; Trypanosoma cru...   111   2e-23
UniRef50_UPI0000E466A7 Cluster: PREDICTED: similar to actin, alp...   110   3e-23
UniRef50_UPI00005864C8 Cluster: PREDICTED: similar to Actin; n=4...   109   4e-23
UniRef50_UPI0000588EB0 Cluster: PREDICTED: similar to actin; n=1...   107   3e-22
UniRef50_A2FRF9 Cluster: Actin family protein; n=1; Trichomonas ...   107   3e-22
UniRef50_P61160 Cluster: Actin-related protein 2; n=96; Eukaryot...   105   1e-21
UniRef50_Q5KB93 Cluster: Actin binding protein, putative; n=3; F...   104   1e-21
UniRef50_Q7M3B0 Cluster: Actin beta; n=1; Sus scrofa domestica|R...   102   8e-21
UniRef50_UPI0000D9A391 Cluster: PREDICTED: actin related protein...   101   1e-20
UniRef50_Q9BYD9 Cluster: Actin-related protein M1; n=12; Theria|...   101   1e-20
UniRef50_Q38F20 Cluster: Actin-like protein 3, putative; n=1; Tr...   100   3e-20
UniRef50_Q8TDY3 Cluster: Actin-related protein T2; n=26; Amniota...   100   5e-20
UniRef50_Q9Y615 Cluster: Actin-like protein 7A; n=11; Mammalia|R...    97   2e-19
UniRef50_A2VD47 Cluster: Zgc:158823 protein; n=3; Eukaryota|Rep:...    97   4e-19
UniRef50_Q0J646 Cluster: Os08g0369300 protein; n=2; Oryza sativa...    97   4e-19
UniRef50_Q55DY5 Cluster: Putative uncharacterized protein; n=1; ...    96   5e-19
UniRef50_Q9Y614 Cluster: Actin-like protein 7B; n=12; Theria|Rep...    96   5e-19
UniRef50_A2YUL5 Cluster: Putative uncharacterized protein; n=1; ...    95   9e-19
UniRef50_Q24C02 Cluster: Actin family protein; n=3; Oligohymenop...    95   1e-18
UniRef50_Q4N681 Cluster: Actin, putative; n=3; Piroplasmida|Rep:...    94   2e-18
UniRef50_P32392 Cluster: Actin-related protein 3; n=27; Eukaryot...    94   2e-18
UniRef50_A2FH22 Cluster: Actin family protein; n=1; Trichomonas ...    93   4e-18
UniRef50_Q4QG59 Cluster: Actin-like protein, putative; n=3; Leis...    93   5e-18
UniRef50_P61158 Cluster: Actin-related protein 3; n=107; Eukaryo...    92   8e-18
UniRef50_A2YQV6 Cluster: Putative uncharacterized protein; n=1; ...    92   1e-17
UniRef50_A5B4L4 Cluster: Putative uncharacterized protein; n=1; ...    91   1e-17
UniRef50_Q55DS6 Cluster: Putative uncharacterized protein; n=1; ...    91   2e-17
UniRef50_Q6BG22 Cluster: Actin, putative; n=2; Paramecium tetrau...    90   3e-17
UniRef50_A2DBN6 Cluster: Actin family protein; n=1; Trichomonas ...    90   3e-17
UniRef50_UPI0001554F81 Cluster: PREDICTED: similar to actin; n=1...    90   4e-17
UniRef50_Q54UQ7 Cluster: Actin-like protein 6A; n=1; Dictyosteli...    89   6e-17
UniRef50_Q4SGD5 Cluster: Chromosome 17 SCAF14597, whole genome s...    89   1e-16
UniRef50_A0CQQ2 Cluster: Chromosome undetermined scaffold_24, wh...    89   1e-16
UniRef50_UPI00006C1719 Cluster: PREDICTED: similar to actin, alp...    87   2e-16
UniRef50_UPI0000449ED3 Cluster: PREDICTED: similar to RIKEN cDNA...    87   4e-16
UniRef50_A0E1S8 Cluster: Chromosome undetermined scaffold_73, wh...    87   4e-16
UniRef50_O96819 Cluster: Actin-related protein; n=5; Trypanosoma...    85   1e-15
UniRef50_Q6X960 Cluster: HSD21; n=13; Theria|Rep: HSD21 - Homo s...    85   2e-15
UniRef50_A7RPC3 Cluster: Predicted protein; n=3; Eumetazoa|Rep: ...    83   4e-15
UniRef50_UPI0000E23780 Cluster: PREDICTED: hypothetical protein ...    83   5e-15
UniRef50_Q8LKR2 Cluster: Actin-related protein 4; n=7; core eudi...    83   5e-15
UniRef50_A7S2B1 Cluster: Predicted protein; n=1; Nematostella ve...    83   5e-15
UniRef50_Q14BL3 Cluster: RIKEN cDNA 4921517D21 gene; n=7; Euther...    81   3e-14
UniRef50_A3BPG0 Cluster: Putative uncharacterized protein; n=3; ...    81   3e-14
UniRef50_UPI00005A3B5D Cluster: PREDICTED: similar to Actin-5C; ...    80   5e-14
UniRef50_Q54JL1 Cluster: Putative uncharacterized protein; n=1; ...    79   8e-14
UniRef50_UPI0000F2DE11 Cluster: PREDICTED: similar to testis-spe...    79   1e-13
UniRef50_Q4QF44 Cluster: Actin-related protein 3, putative; n=3;...    79   1e-13
UniRef50_UPI0000E47BC7 Cluster: PREDICTED: similar to ubiquitin/...    77   3e-13
UniRef50_Q75JT2 Cluster: Similar to Drosophila melanogaster (Fru...    77   3e-13
UniRef50_Q8IS27 Cluster: Actin-related protein 2; n=5; Oligohyme...    77   3e-13
UniRef50_UPI00015B6274 Cluster: PREDICTED: similar to putative m...    75   2e-12
UniRef50_Q5CSX9 Cluster: Actin; n=2; Cryptosporidium|Rep: Actin ...    75   2e-12
UniRef50_Q4DMP2 Cluster: Actin-related protein 2, putative; n=4;...    75   2e-12
UniRef50_UPI0000F2D272 Cluster: PREDICTED: similar to actin; n=1...    72   1e-11
UniRef50_UPI0000EC9F4D Cluster: HSD21.; n=2; Gallus gallus|Rep: ...    71   2e-11
UniRef50_UPI000049A548 Cluster: actin; n=1; Entamoeba histolytic...    71   2e-11
UniRef50_Q9N4N4 Cluster: Putative uncharacterized protein; n=2; ...    70   4e-11
UniRef50_A2DNQ0 Cluster: Actin family protein; n=1; Trichomonas ...    70   5e-11
UniRef50_O96019 Cluster: Actin-like protein 6A; n=63; Eumetazoa|...    70   5e-11
UniRef50_Q19R57 Cluster: Actin-like protein 1; n=2; Trypanosoma ...    69   7e-11
UniRef50_Q7M3Y6 Cluster: Actin homolog fat, testicular; n=3; Deu...    67   3e-10
UniRef50_Q6FRF2 Cluster: Similar to sp|P38696 Saccharomyces cere...    67   3e-10
UniRef50_Q6BG23 Cluster: Actin, putative; n=1; Paramecium tetrau...    66   5e-10
UniRef50_A2ECQ8 Cluster: Actin family protein; n=1; Trichomonas ...    66   6e-10
UniRef50_Q9P7X7 Cluster: Actin-related protein 4; n=1; Schizosac...    64   3e-09
UniRef50_Q9Y7X8 Cluster: Actin-like protein Arp5; n=1; Schizosac...    63   4e-09
UniRef50_Q9H568 Cluster: Actin-like protein 8; n=10; Eutheria|Re...    63   6e-09
UniRef50_Q5C683 Cluster: SJCHGC08418 protein; n=1; Schistosoma j...    62   1e-08
UniRef50_A4RW28 Cluster: Predicted protein; n=2; Ostreococcus|Re...    61   2e-08
UniRef50_Q8IIQ4 Cluster: Actin, putative; n=7; Apicomplexa|Rep: ...    60   3e-08
UniRef50_Q4Q187 Cluster: Actin-like protein, putative; n=3; Leis...    60   3e-08
UniRef50_Q4N7N1 Cluster: Actin, putative; n=2; Theileria|Rep: Ac...    60   3e-08
UniRef50_Q6C061 Cluster: Actin-related protein 4; n=1; Yarrowia ...    60   5e-08
UniRef50_A2DEE0 Cluster: Actin family protein; n=1; Trichomonas ...    59   9e-08
UniRef50_Q5C3R3 Cluster: SJCHGC08022 protein; n=1; Schistosoma j...    58   2e-07
UniRef50_Q19R56 Cluster: Actin-like protein 3; n=4; Trypanosoma ...    58   2e-07
UniRef50_Q9LZY1 Cluster: Actin-like protein; n=4; core eudicotyl...    57   3e-07
UniRef50_A7QZ13 Cluster: Chromosome undetermined scaffold_261, w...    55   1e-06
UniRef50_Q9VEC3 Cluster: Actin-related protein 5; n=1; Drosophil...    55   1e-06
UniRef50_Q9SRK2 Cluster: Putative actin; n=1; Arabidopsis thalia...    55   2e-06
UniRef50_Q8LKR0 Cluster: Actin-related protein 6; n=26; Magnolio...    55   2e-06
UniRef50_UPI0000F2D271 Cluster: PREDICTED: similar to actin-like...    54   2e-06
UniRef50_Q383R8 Cluster: Actin-like protein, putative; n=4; Tryp...    54   2e-06
UniRef50_Q293V2 Cluster: Actin-related protein 5; n=2; Drosophil...    54   2e-06
UniRef50_Q4P303 Cluster: Putative uncharacterized protein; n=1; ...    54   4e-06
UniRef50_Q22WQ4 Cluster: Actin family protein; n=1; Tetrahymena ...    53   6e-06
UniRef50_UPI0000498A93 Cluster: actin; n=1; Entamoeba histolytic...    52   8e-06
UniRef50_Q6C0A9 Cluster: Yarrowia lipolytica chromosome F of str...    52   8e-06
UniRef50_UPI0000E46266 Cluster: PREDICTED: similar to actin; n=1...    52   1e-05
UniRef50_Q5KLG9 Cluster: 53 kDa brg1-associated factor b (Actin-...    52   1e-05
UniRef50_Q0V0G6 Cluster: Putative uncharacterized protein; n=1; ...    52   1e-05
UniRef50_UPI0000D56C2F Cluster: PREDICTED: similar to Actin-57B;...    52   1e-05
UniRef50_Q00UL2 Cluster: Alpha amylase 1; n=3; Ostreococcus|Rep:...    52   1e-05
UniRef50_Q54KZ7 Cluster: Putative uncharacterized protein; n=1; ...    51   2e-05
UniRef50_Q09849 Cluster: Uncharacterized protein C23D3.09; n=1; ...    50   3e-05
UniRef50_UPI0000E4A0BF Cluster: PREDICTED: similar to Actin-rela...    50   4e-05
UniRef50_Q5KAQ4 Cluster: Actin-like protein ARP6; n=1; Filobasid...    50   6e-05
UniRef50_P53946 Cluster: Actin-related protein 5; n=7; Saccharom...    50   6e-05
UniRef50_A2EUM6 Cluster: Actin family protein; n=1; Trichomonas ...    49   8e-05
UniRef50_UPI0000DD7E8B Cluster: PREDICTED: similar to ARP3 actin...    49   1e-04
UniRef50_A6R1X8 Cluster: Putative uncharacterized protein; n=1; ...    41   1e-04
UniRef50_Q8ILM5 Cluster: Actin, putative; n=1; Plasmodium falcip...    48   1e-04
UniRef50_A5K109 Cluster: Actin, putative; n=4; Plasmodium|Rep: A...    48   1e-04
UniRef50_Q9H9F9 Cluster: Actin-related protein 5; n=19; Euteleos...    48   2e-04
UniRef50_Q5CKL2 Cluster: BRG1/brm-associated factor 53A; n=2; Cr...    48   2e-04
UniRef50_Q12406 Cluster: Actin-related protein 7; n=2; Saccharom...    48   2e-04
UniRef50_Q9LHH0 Cluster: Actin-like protein; n=11; Magnoliophyta...    47   3e-04
UniRef50_Q4P2E8 Cluster: Actin-related protein 4; n=1; Ustilago ...    47   3e-04
UniRef50_P80428 Cluster: Actin-related protein 4; n=4; Saccharom...    47   4e-04
UniRef50_A6RD74 Cluster: Putative uncharacterized protein; n=1; ...    46   5e-04
UniRef50_Q17GZ9 Cluster: Actin-related protein 5; n=4; Endoptery...    46   7e-04
UniRef50_UPI0000499930 Cluster: actin; n=1; Entamoeba histolytic...    46   0.001
UniRef50_Q18PR4 Cluster: Actin-related protein; n=1; Porphyra ye...    46   0.001
UniRef50_A1CCH7 Cluster: Chromatin remodeling complex subunit (A...    46   0.001
UniRef50_Q4P4D4 Cluster: Putative uncharacterized protein; n=1; ...    45   0.001
UniRef50_Q6CSB9 Cluster: Actin-related protein 4; n=1; Kluyverom...    45   0.001
UniRef50_UPI0000E80C06 Cluster: PREDICTED: hypothetical protein;...    45   0.002
UniRef50_Q6BIA3 Cluster: CA5059|IPF3691 Candida albicans IPF3691...    45   0.002
UniRef50_Q4YVG6 Cluster: Actin, putative; n=7; Plasmodium|Rep: A...    44   0.003
UniRef50_Q2H0E9 Cluster: Putative uncharacterized protein; n=1; ...    44   0.003
UniRef50_Q6C982 Cluster: Actin-like protein ARP6; n=1; Yarrowia ...    44   0.003
UniRef50_Q7S6X6 Cluster: Actin-like protein arp-6; n=5; Pezizomy...    44   0.003
UniRef50_A4S826 Cluster: Predicted protein; n=1; Ostreococcus lu...    44   0.004
UniRef50_Q7SXV8 Cluster: ARP5 actin-related protein 5 homolog; n...    43   0.007
UniRef50_Q54E71 Cluster: Putative uncharacterized protein; n=1; ...    42   0.009
UniRef50_Q0IFH2 Cluster: Actin; n=4; Endopterygota|Rep: Actin - ...    42   0.009
UniRef50_Q6FMT7 Cluster: Similar to sp|Q12406 Saccharomyces cere...    42   0.012
UniRef50_UPI0000EBF019 Cluster: PREDICTED: similar to ribosomal ...    42   0.015
UniRef50_UPI00004987CF Cluster: actin; n=2; Entamoeba histolytic...    42   0.015
UniRef50_Q7M3Y5 Cluster: Actin; n=1; Aplysia californica|Rep: Ac...    42   0.015
UniRef50_Q9GZN1 Cluster: Actin-related protein 6; n=26; Chordata...    42   0.015
UniRef50_UPI00006CBDF1 Cluster: Actin family protein; n=1; Tetra...    41   0.027
UniRef50_Q7QYV9 Cluster: GLP_164_51431_54055; n=1; Giardia lambl...    41   0.027
UniRef50_A0D9D5 Cluster: Chromosome undetermined scaffold_42, wh...    41   0.027
UniRef50_A7TM96 Cluster: Putative uncharacterized protein; n=1; ...    40   0.036
UniRef50_A3M088 Cluster: Vacuolar targeting, actin-related prote...    40   0.047
UniRef50_UPI0000498FDF Cluster: actin; n=1; Entamoeba histolytic...    40   0.062
UniRef50_Q7QA11 Cluster: ENSANGP00000003921; n=1; Anopheles gamb...    40   0.062
UniRef50_Q6CF37 Cluster: Similar to sp|P53946 Saccharomyces cere...    40   0.062
UniRef50_Q0H7S7 Cluster: Actin; n=29; Sordariomycetes|Rep: Actin...    40   0.062
UniRef50_Q5AXH1 Cluster: Actin-like protein arp6; n=5; Trichocom...    40   0.062
UniRef50_A7EG89 Cluster: Putative uncharacterized protein; n=2; ...    39   0.082
UniRef50_A1C924 Cluster: Actin family protein; n=4; Eurotiomycet...    39   0.082
UniRef50_A4S172 Cluster: Predicted protein; n=3; Ostreococcus|Re...    39   0.11 
UniRef50_Q4WA13 Cluster: Chromatin remodeling complex subunit (A...    39   0.11 
UniRef50_Q0UJ41 Cluster: Putative uncharacterized protein; n=1; ...    39   0.11 
UniRef50_Q9NZ32 Cluster: Actin-related protein 10; n=40; Eumetaz...    39   0.11 
UniRef50_Q4QF49 Cluster: Actin-like protein, putative; n=2; Leis...    38   0.14 
UniRef50_Q6BXN0 Cluster: Actin-related protein 4; n=7; Saccharom...    38   0.14 
UniRef50_P45890 Cluster: Actin-like protein 13E; n=8; Eumetazoa|...    38   0.19 
UniRef50_Q7SHR0 Cluster: Actin-related protein 4; n=16; Pezizomy...    38   0.19 
UniRef50_Q23FF9 Cluster: Actin family protein; n=2; Tetrahymena ...    38   0.25 
UniRef50_A3FQH9 Cluster: Actin-like protein, putative; n=2; Cryp...    38   0.25 
UniRef50_A3FQE6 Cluster: Putative uncharacterized protein; n=2; ...    38   0.25 
UniRef50_A6RD01 Cluster: Putative uncharacterized protein; n=1; ...    38   0.25 
UniRef50_Q09443 Cluster: Actin-like protein C08B11.6; n=2; Caeno...    38   0.25 
UniRef50_UPI00006CC3F4 Cluster: Actin family protein; n=1; Tetra...    37   0.33 
UniRef50_A7TST0 Cluster: Putative uncharacterized protein; n=1; ...    37   0.33 
UniRef50_Q4UGT7 Cluster: Actin-related protein, putative; n=2; T...    37   0.44 
UniRef50_Q19R70 Cluster: Actin-like protein 3; n=4; Leishmania|R...    37   0.44 
UniRef50_A7D8V0 Cluster: Putative uncharacterized protein; n=2; ...    36   0.58 
UniRef50_Q75BT7 Cluster: ACR184Cp; n=1; Eremothecium gossypii|Re...    36   0.77 
UniRef50_Q02B84 Cluster: Putative uncharacterized protein; n=1; ...    35   1.3  
UniRef50_Q19R52 Cluster: ALP5; n=6; Trypanosomatidae|Rep: ALP5 -...    35   1.3  
UniRef50_Q5K9I3 Cluster: Protein-vacuolar targeting-related prot...    35   1.3  
UniRef50_Q5FT07 Cluster: Glycosyltransferase; n=1; Gluconobacter...    35   1.8  
UniRef50_Q8I450 Cluster: Actin-related protein, putative; n=5; P...    35   1.8  
UniRef50_Q9UTQ7 Cluster: SWI/SNF and RSC complex subunit Arp9; n...    35   1.8  
UniRef50_Q7RR61 Cluster: Actin-like 6; n=3; Plasmodium (Vinckeia...    34   2.3  
UniRef50_Q4Q9A1 Cluster: Putative uncharacterized protein; n=3; ...    34   2.3  
UniRef50_A4RLB1 Cluster: Putative uncharacterized protein; n=1; ...    34   2.3  
UniRef50_UPI00015B5EE4 Cluster: PREDICTED: similar to Actin-rela...    34   3.1  
UniRef50_UPI000023E19F Cluster: hypothetical protein FG04383.1; ...    34   3.1  
UniRef50_A7AS14 Cluster: Actin, putative; n=1; Babesia bovis|Rep...    34   3.1  
UniRef50_A5E5Q2 Cluster: Putative uncharacterized protein; n=1; ...    34   3.1  
UniRef50_UPI0000E477BD Cluster: PREDICTED: similar to uncharacte...    33   4.1  
UniRef50_Q5FQJ4 Cluster: GDP-6-deoxy-D-lyxo-4-hexulose reductase...    33   4.1  
UniRef50_A7AQU0 Cluster: Actin-related, putative; n=1; Babesia b...    33   4.1  
UniRef50_A5KAY0 Cluster: Actin-related protein, putative; n=1; P...    33   4.1  
UniRef50_Q4P820 Cluster: Putative uncharacterized protein; n=1; ...    33   4.1  
UniRef50_Q5Z237 Cluster: Putative uncharacterized protein; n=1; ...    33   5.4  
UniRef50_Q8SRZ3 Cluster: ACTIN-RELATED PROTEIN; n=1; Encephalito...    33   5.4  
UniRef50_Q2H309 Cluster: Putative uncharacterized protein; n=1; ...    33   5.4  
UniRef50_Q5ZDG3 Cluster: Putative uncharacterized protein P0493G...    33   7.1  
UniRef50_A2ZT75 Cluster: Putative uncharacterized protein; n=1; ...    33   7.1  
UniRef50_Q4DAD3 Cluster: Putative uncharacterized protein; n=2; ...    33   7.1  
UniRef50_A7AWQ4 Cluster: Actin, putative; n=1; Babesia bovis|Rep...    33   7.1  
UniRef50_A4UCC4 Cluster: Putative uncharacterized protein; n=1; ...    33   7.1  
UniRef50_Q6BML9 Cluster: Actin-like protein ARP6; n=3; Saccharom...    33   7.1  
UniRef50_Q8AXX1 Cluster: Putative gag protein; n=1; Danio rerio|...    32   9.4  
UniRef50_Q5LUD8 Cluster: Putative uncharacterized protein; n=1; ...    32   9.4  
UniRef50_Q1NK22 Cluster: Electron-transferring-flavoprotein dehy...    32   9.4  
UniRef50_Q5BXM4 Cluster: SJCHGC05761 protein; n=1; Schistosoma j...    32   9.4  
UniRef50_Q4D7T4 Cluster: Putative uncharacterized protein; n=2; ...    32   9.4  
UniRef50_Q2PE20 Cluster: CG10067-PB, isoform B; n=1; Drosophila ...    32   9.4  
UniRef50_A6RCR5 Cluster: Predicted protein; n=1; Ajellomyces cap...    32   9.4  
UniRef50_Q0W6D4 Cluster: Putative uncharacterized protein; n=1; ...    32   9.4  

>UniRef50_O65314 Cluster: Actin; n=20; Eukaryota|Rep: Actin -
           Scherffelia dubia
          Length = 378

 Score =  185 bits (451), Expect = 6e-46
 Identities = 90/119 (75%), Positives = 94/119 (78%)
 Frame = +3

Query: 237 GTEGLLVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE 416
           G +   VGDEAQSKRGILTLKYPIEHG+V+NWDDMEKIWHHTFYNELRVAPEEHPVLLTE
Sbjct: 51  GQKDAYVGDEAQSKRGILTLKYPIEHGVVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTE 110

Query: 417 APLNPKANREKMTQIMFETFNTPAMYVAIQACSRCTRPVVPPVSCWTSGDGGLPHPCPI 593
           APLNPKANREKMTQIMFETFN PAMYVAIQA                SGD G+ H  PI
Sbjct: 111 APLNPKANREKMTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGD-GVSHTVPI 168



 Score =   99 bits (238), Expect = 4e-20
 Identities = 46/51 (90%), Positives = 48/51 (94%)
 Frame = +1

Query: 100 DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 252
           D EV+ALV DNGSGM KAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKD+
Sbjct: 5   DGEVSALVCDNGSGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDA 55


>UniRef50_Q96483 Cluster: Actin-51; n=584; Eukaryota|Rep: Actin-51 -
           Solanum lycopersicum (Tomato) (Lycopersicon esculentum)
          Length = 336

 Score =  183 bits (445), Expect = 3e-45
 Identities = 89/112 (79%), Positives = 91/112 (81%)
 Frame = +3

Query: 258 GDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 437
           GDEAQSKRGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA
Sbjct: 37  GDEAQSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 96

Query: 438 NREKMTQIMFETFNTPAMYVAIQACSRCTRPVVPPVSCWTSGDGGLPHPCPI 593
           NREKMTQIMFETFN PAMYVAIQA                SGD G+ H  PI
Sbjct: 97  NREKMTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGD-GVSHTVPI 147



 Score = 72.5 bits (170), Expect = 7e-12
 Identities = 32/34 (94%), Positives = 33/34 (97%)
 Frame = +1

Query: 151 AGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 252
           AGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKD+
Sbjct: 1   AGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDA 34


>UniRef50_Q4JSC0 Cluster: Actin; n=13; Coelomata|Rep: Actin -
           Anopheles gambiae (African malaria mosquito)
          Length = 376

 Score =  181 bits (441), Expect = 1e-44
 Identities = 88/119 (73%), Positives = 93/119 (78%)
 Frame = +3

Query: 237 GTEGLLVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE 416
           G +   VGDEAQSKRGILTLKYPIEHGI+TNWDDMEKIWHHTFYNELRVAPEEHPVLLTE
Sbjct: 49  GNKDAYVGDEAQSKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPVLLTE 108

Query: 417 APLNPKANREKMTQIMFETFNTPAMYVAIQACSRCTRPVVPPVSCWTSGDGGLPHPCPI 593
           APLNPK+NREKMTQIMFETF  PA+YVAIQA                SGD G+ H  PI
Sbjct: 109 APLNPKSNREKMTQIMFETFAAPAVYVAIQAVLSLYASGRTTGVVLDSGD-GVSHTVPI 166



 Score =  107 bits (258), Expect = 2e-22
 Identities = 47/53 (88%), Positives = 50/53 (94%)
 Frame = +1

Query: 94  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 252
           MCD++  ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMG KD+
Sbjct: 1   MCDDDAGALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGNKDA 53


>UniRef50_P14883 Cluster: Actin-2; n=75; Eukaryota|Rep: Actin-2 -
           Plasmodium falciparum
          Length = 376

 Score =  179 bits (435), Expect = 6e-44
 Identities = 86/113 (76%), Positives = 91/113 (80%)
 Frame = +3

Query: 255 VGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPK 434
           VGDEAQ+KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRV+PEEHPVLLTEAPLNPK
Sbjct: 54  VGDEAQNKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVSPEEHPVLLTEAPLNPK 113

Query: 435 ANREKMTQIMFETFNTPAMYVAIQACSRCTRPVVPPVSCWTSGDGGLPHPCPI 593
            NREKMTQIMFETF+ PAMYV+IQA                SGD G+ H  PI
Sbjct: 114 TNREKMTQIMFETFDVPAMYVSIQAILSLYASGRTTGIVLDSGD-GVSHTVPI 165



 Score = 77.8 bits (183), Expect = 2e-13
 Identities = 34/49 (69%), Positives = 40/49 (81%)
 Frame = +1

Query: 103 EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKD 249
           EE  ALVVDNGSGM K+G AGDDAP+ VFPSIVGRP+   +M+GM QK+
Sbjct: 3   EEAVALVVDNGSGMVKSGLAGDDAPKCVFPSIVGRPKMPNIMIGMEQKE 51


>UniRef50_P02581 Cluster: Actin-1; n=1852; Eukaryota|Rep: Actin-1 -
           Glycine max (Soybean)
          Length = 377

 Score =  164 bits (398), Expect = 2e-39
 Identities = 80/119 (67%), Positives = 88/119 (73%)
 Frame = +3

Query: 237 GTEGLLVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE 416
           G +   VGDEAQ +RGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTE
Sbjct: 50  GQKDAYVGDEAQVQRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTE 109

Query: 417 APLNPKANREKMTQIMFETFNTPAMYVAIQACSRCTRPVVPPVSCWTSGDGGLPHPCPI 593
           APLNPK NREKM ++MFETF  PA+ VA+ A                SGD G+ H  PI
Sbjct: 110 APLNPKYNREKMXRVMFETFGAPAVCVAVLAVLSLYASGRTTGIVLDSGD-GVSHTVPI 167



 Score = 85.4 bits (202), Expect = 1e-15
 Identities = 38/50 (76%), Positives = 43/50 (86%)
 Frame = +1

Query: 103 EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 252
           E++  LV DNG+GM KAG AGDDAPRAVFPSIVGRPRH  V+VGMGQKD+
Sbjct: 5   EDIQPLVCDNGTGMVKAGLAGDDAPRAVFPSIVGRPRHTXVVVGMGQKDA 54


>UniRef50_Q0VHZ5 Cluster: Actin deviating protein; n=7;
           Eukaryota|Rep: Actin deviating protein - Bolivina sp.
           isolate 615
          Length = 360

 Score =  155 bits (375), Expect = 1e-36
 Identities = 66/85 (77%), Positives = 77/85 (90%)
 Frame = +3

Query: 255 VGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPK 434
           VGDEAQSKRGIL+L++PI HGI T+WDD+E+IW HTFY ELR+ PEEHP+L+TE PLNPK
Sbjct: 32  VGDEAQSKRGILSLRWPIVHGISTSWDDVEEIWRHTFYQELRIQPEEHPILMTEPPLNPK 91

Query: 435 ANREKMTQIMFETFNTPAMYVAIQA 509
           ANR+KMTQIMFETFNTPA Y AIQ+
Sbjct: 92  ANRQKMTQIMFETFNTPAFYTAIQS 116



 Score = 50.4 bits (115), Expect = 3e-05
 Identities = 22/29 (75%), Positives = 24/29 (82%)
 Frame = +1

Query: 163 GDDAPRAVFPSIVGRPRHQGVMVGMGQKD 249
           GDDAPRAVFP+I GR R  GVMVGM QK+
Sbjct: 1   GDDAPRAVFPAITGRRRRNGVMVGMAQKN 29



 Score = 35.1 bits (77), Expect = 1.3
 Identities = 16/17 (94%), Positives = 17/17 (100%)
 Frame = +2

Query: 506 SVLSLYASGRTTGIVLD 556
           SVLSLYASGRTTGIV+D
Sbjct: 116 SVLSLYASGRTTGIVVD 132


>UniRef50_Q7XB26 Cluster: Ubiquitin/actin fusion protein 4; n=1;
           Bigelowiella natans|Rep: Ubiquitin/actin fusion protein
           4 - Bigelowiella natans (Pedinomonas minutissima)
           (Chlorarachnion sp.(strain CCMP 621))
          Length = 234

 Score =  138 bits (333), Expect = 1e-31
 Identities = 64/99 (64%), Positives = 75/99 (75%)
 Frame = +3

Query: 213 PSGRDGRYGTEGLLVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPE 392
           P  R+   G + + +G    +KRG+L  KY IEHGIVT+WD M KIW HTF NEL+VAPE
Sbjct: 113 PRVRNTMTGKQDVYIGS-VNAKRGVLINKYAIEHGIVTDWDAMLKIWDHTFLNELKVAPE 171

Query: 393 EHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQA 509
           EHPVLLTE PLNPKANREK  ++MFETF TPA Y+AIQA
Sbjct: 172 EHPVLLTEPPLNPKANREKTIKVMFETFKTPATYIAIQA 210



 Score = 56.8 bits (131), Expect = 4e-07
 Identities = 27/44 (61%), Positives = 29/44 (65%)
 Frame = +1

Query: 103 EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVG 234
           EE   LVVDNGS M KAGFAGD APR  FPS+   PR +  M G
Sbjct: 78  EECQPLVVDNGSDMIKAGFAGDGAPRTAFPSVFKVPRVRNTMTG 121



 Score = 33.5 bits (73), Expect = 4.1
 Identities = 15/17 (88%), Positives = 16/17 (94%)
 Frame = +2

Query: 506 SVLSLYASGRTTGIVLD 556
           + LSLYASGRTTGIVLD
Sbjct: 210 AALSLYASGRTTGIVLD 226


>UniRef50_A5E2K2 Cluster: Actin; n=5; Saccharomycetales|Rep: Actin -
           Lodderomyces elongisporus (Yeast) (Saccharomyces
           elongisporus)
          Length = 417

 Score =  136 bits (329), Expect = 4e-31
 Identities = 56/87 (64%), Positives = 69/87 (79%)
 Frame = +3

Query: 249 LLVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLN 428
           L VGD AQ  RG+L L YP+EHGIVT W DME IW H F  +L++ PE+HP+L+TEAPLN
Sbjct: 65  LFVGDAAQKNRGLLRLNYPVEHGIVTKWSDMEIIWDHMFTQDLKIKPEDHPLLITEAPLN 124

Query: 429 PKANREKMTQIMFETFNTPAMYVAIQA 509
           P++NREKM Q+MFE FN P MY++IQA
Sbjct: 125 PRSNREKMCQVMFEQFNVPCMYISIQA 151



 Score = 52.0 bits (119), Expect = 1e-05
 Identities = 22/39 (56%), Positives = 29/39 (74%)
 Frame = +1

Query: 118 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVG 234
           +VVDNG G  KAGFAG++ PR    SI+GRP++Q +M G
Sbjct: 10  VVVDNGLGTLKAGFAGEEKPRTYASSIIGRPKYQKLMAG 48



 Score = 32.3 bits (70), Expect = 9.4
 Identities = 13/17 (76%), Positives = 17/17 (100%)
 Frame = +2

Query: 506 SVLSLYASGRTTGIVLD 556
           +VL+LYASGRTTG+V+D
Sbjct: 151 AVLALYASGRTTGVVVD 167


>UniRef50_Q0VHZ6 Cluster: Actin deviating protein; n=2; Bolivina sp.
           isolate 615|Rep: Actin deviating protein - Bolivina sp.
           isolate 615
          Length = 387

 Score =  135 bits (327), Expect = 7e-31
 Identities = 57/83 (68%), Positives = 68/83 (81%)
 Frame = +3

Query: 255 VGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPK 434
           VGDEAQSKRGIL L +P++ G+V NWDDMEKIWHHT Y+ELRV PEEHP+L+T+ P   K
Sbjct: 32  VGDEAQSKRGILKLMHPMQRGVVKNWDDMEKIWHHTLYHELRVQPEEHPILMTDTPFASK 91

Query: 435 ANREKMTQIMFETFNTPAMYVAI 503
            +REKM QIMFETF+TP  YV +
Sbjct: 92  MDREKMAQIMFETFDTPKFYVTL 114



 Score = 45.2 bits (102), Expect = 0.001
 Identities = 19/28 (67%), Positives = 23/28 (82%)
 Frame = +1

Query: 163 GDDAPRAVFPSIVGRPRHQGVMVGMGQK 246
           G DAPRAVFP+IVG  +H+G+ VGM QK
Sbjct: 1   GVDAPRAVFPTIVGTLKHRGIFVGMAQK 28


>UniRef50_UPI0000449751 Cluster: PREDICTED: similar to gamma-actin;
           n=3; Amniota|Rep: PREDICTED: similar to gamma-actin -
           Gallus gallus
          Length = 377

 Score =  128 bits (308), Expect = 1e-28
 Identities = 59/100 (59%), Positives = 78/100 (78%), Gaps = 6/100 (6%)
 Frame = +3

Query: 255 VGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPK 434
           VG+EAQSKRGIL+L YP+E+G+VT+WD+MEKIW + + +EL V P E PVLLTE PLNP 
Sbjct: 58  VGEEAQSKRGILSLTYPMENGVVTSWDNMEKIWRYLYEHELGVKPSEGPVLLTETPLNPP 117

Query: 435 ANREKMTQIMFETFNTPAMYVAIQ------ACSRCTRPVV 536
           ++REKM ++MFE+F  PA+YVA+Q      AC+R T  V+
Sbjct: 118 SHREKMAELMFESFQVPALYVALQGLAALHACARTTGMVL 157



 Score = 60.1 bits (139), Expect = 4e-08
 Identities = 25/44 (56%), Positives = 33/44 (75%)
 Frame = +1

Query: 118 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKD 249
           +V DNGSG CKAG +G+ APR+V P+IVG P+   VM+GM  +D
Sbjct: 12  VVFDNGSGQCKAGLSGEQAPRSVIPTIVGYPKFTFVMIGMEHRD 55


>UniRef50_UPI000065FC19 Cluster: Homolog of Homo sapiens "Actin,
           cytoplasmic 2; n=1; Takifugu rubripes|Rep: Homolog of
           Homo sapiens "Actin, cytoplasmic 2 - Takifugu rubripes
          Length = 396

 Score =  126 bits (305), Expect = 3e-28
 Identities = 60/113 (53%), Positives = 77/113 (68%)
 Frame = +3

Query: 255 VGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPK 434
           +G EAQ  RG+L LK+PI++GI+ NWD+MEKIWHHTF  ++RV PE+HPVLLTEA +NP 
Sbjct: 48  IGHEAQHMRGVLALKHPIKNGIIQNWDEMEKIWHHTFL-QMRVDPEDHPVLLTEAAMNPL 106

Query: 435 ANREKMTQIMFETFNTPAMYVAIQACSRCTRPVVPPVSCWTSGDGGLPHPCPI 593
            NR +M +IMFE FN P  YVA+QA              + SGD G+ H  P+
Sbjct: 107 ENRRRMVEIMFECFNVPFTYVAMQAVLSLYASGRSTGVVFDSGD-GVSHSVPV 158



 Score = 54.0 bits (124), Expect = 3e-06
 Identities = 20/45 (44%), Positives = 33/45 (73%)
 Frame = +1

Query: 118 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 252
           +V+D GSG  KAGFA +D P  VFP+I+G P+++ +M G  ++++
Sbjct: 2   IVLDTGSGFMKAGFADEDLPNVVFPTIIGMPKYEEIMNGRAERET 46


>UniRef50_A2DKQ5 Cluster: Actin 58, putative; n=2; Trichomonas
           vaginalis G3|Rep: Actin 58, putative - Trichomonas
           vaginalis G3
          Length = 373

 Score =  126 bits (305), Expect = 3e-28
 Identities = 56/105 (53%), Positives = 71/105 (67%)
 Frame = +3

Query: 255 VGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPK 434
           VG EA  K  +L L+ PIE+G ++NWDD+EKIWHHTFYNEL VAPEEHPV+L E P++P+
Sbjct: 52  VGFEAVQKSDLLVLRQPIENGTISNWDDIEKIWHHTFYNELLVAPEEHPVILAEKPMSPR 111

Query: 435 ANREKMTQIMFETFNTPAMYVAIQACSRCTRPVVPPVSCWTSGDG 569
            NREK  Q+MFETFN    Y+ +QA              W +G+G
Sbjct: 112 MNREKKIQMMFETFNVSGFYLGMQAVLALFSIGCTTGVVWDAGEG 156



 Score = 58.0 bits (134), Expect = 2e-07
 Identities = 24/44 (54%), Positives = 34/44 (77%)
 Frame = +1

Query: 118 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKD 249
           +V+DNG+G+ KAGFAG +AP++VFP+I+G P+    MVG   KD
Sbjct: 6   IVIDNGTGLTKAGFAGAEAPKSVFPTIIGSPKSNMQMVGGQNKD 49


>UniRef50_UPI0000F2D825 Cluster: PREDICTED: similar to actin; n=1;
           Monodelphis domestica|Rep: PREDICTED: similar to actin -
           Monodelphis domestica
          Length = 416

 Score =  125 bits (302), Expect = 7e-28
 Identities = 52/84 (61%), Positives = 66/84 (78%)
 Frame = +3

Query: 255 VGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPK 434
           +G+E   K   L +KYPIEHGI+ NWDDMEKIWHH+FYN L V PE+HP+L+TE    PK
Sbjct: 98  IGNEVIEKWANLLVKYPIEHGIIVNWDDMEKIWHHSFYNVLHVDPEKHPLLVTEHLFTPK 157

Query: 435 ANREKMTQIMFETFNTPAMYVAIQ 506
           AN+EK+ ++MFE+F  PA+YVAIQ
Sbjct: 158 ANKEKLIEVMFESFRVPALYVAIQ 181



 Score = 42.7 bits (96), Expect = 0.007
 Identities = 19/49 (38%), Positives = 28/49 (57%)
 Frame = +1

Query: 106 EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 252
           E   ++ D GS   K G+ G+ +PR VFPS +G  R Q +  GM  +D+
Sbjct: 48  ESLPVIFDGGSRYFKVGYGGEYSPRFVFPSAIGHYRWQNIKSGMDLRDT 96


>UniRef50_UPI0000F2D326 Cluster: PREDICTED: similar to actin; n=1;
           Monodelphis domestica|Rep: PREDICTED: similar to actin -
           Monodelphis domestica
          Length = 378

 Score =  124 bits (300), Expect = 1e-27
 Identities = 53/84 (63%), Positives = 65/84 (77%)
 Frame = +3

Query: 255 VGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPK 434
           VG EAQ  R ILTL +P++HG+VT+WDDMEKIW H + + LR  P++ PVLLTEAPLNP 
Sbjct: 58  VGQEAQDNRSILTLNHPMQHGVVTSWDDMEKIWEHLYKDGLRETPKQRPVLLTEAPLNPP 117

Query: 435 ANREKMTQIMFETFNTPAMYVAIQ 506
            NR KM +I FETF  PA+YVA+Q
Sbjct: 118 ENRAKMVEIFFETFQVPALYVALQ 141



 Score = 41.9 bits (94), Expect = 0.012
 Identities = 16/47 (34%), Positives = 28/47 (59%)
 Frame = +1

Query: 106 EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQK 246
           ++ + + DNGSG+CK G +G+  PR +  +++G P+    M    QK
Sbjct: 8   KIPSAIFDNGSGLCKVGISGEQNPRFIQATVLGYPQSINSMANTWQK 54


>UniRef50_UPI0000605B09 Cluster: PREDICTED: similar to actin alpha 1
           skeletal muscle protein; n=1; Mus musculus|Rep:
           PREDICTED: similar to actin alpha 1 skeletal muscle
           protein - Mus musculus
          Length = 255

 Score =  120 bits (289), Expect = 3e-26
 Identities = 49/91 (53%), Positives = 68/91 (74%)
 Frame = +3

Query: 237 GTEGLLVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE 416
           G +   +G E Q+ R  L + YPI  G +TNWD++EKIWH++FY+ L++APE+HP+L+TE
Sbjct: 46  GEQDWFIGAETQTNRTELNMYYPISRGAITNWDNVEKIWHYSFYHSLQIAPEQHPILITE 105

Query: 417 APLNPKANREKMTQIMFETFNTPAMYVAIQA 509
           APL  K  + +MTQI+FETFN PA+Y A QA
Sbjct: 106 APLTSKEAKSRMTQILFETFNFPALYTANQA 136



 Score = 57.2 bits (132), Expect = 3e-07
 Identities = 24/48 (50%), Positives = 34/48 (70%)
 Frame = +1

Query: 106 EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKD 249
           E   LV D GSG  K GF+G  AP+AVFP+I+G+ +H  V+ G+G++D
Sbjct: 2   EKTPLVCDYGSGFSKVGFSGTQAPQAVFPTILGKMKHTNVLEGLGEQD 49


>UniRef50_UPI00005A2ACF Cluster: PREDICTED: similar to cytoplasmic
           beta-actin; n=1; Canis lupus familiaris|Rep: PREDICTED:
           similar to cytoplasmic beta-actin - Canis familiaris
          Length = 268

 Score =  120 bits (289), Expect = 3e-26
 Identities = 62/90 (68%), Positives = 69/90 (76%)
 Frame = +3

Query: 237 GTEGLLVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE 416
           G +   + +EAQ K GILT KY IEHGIV NWDDME I HH FYN+L +APEE  +LLTE
Sbjct: 102 GQKDSYIRNEAQRKWGILTFKYCIEHGIVINWDDME-IQHHNFYNKLCMAPEELYILLTE 160

Query: 417 APLNPKANREKMTQIMFETFNTPAMYVAIQ 506
            PLN KA  E MTQIMFETFNTPAMY+AIQ
Sbjct: 161 IPLNLKAKGE-MTQIMFETFNTPAMYLAIQ 189


>UniRef50_UPI00001E426E Cluster: PREDICTED: similar to actin-12;
           n=11; Eutheria|Rep: PREDICTED: similar to actin-12 - Mus
           musculus
          Length = 372

 Score =  120 bits (289), Expect = 3e-26
 Identities = 49/91 (53%), Positives = 68/91 (74%)
 Frame = +3

Query: 237 GTEGLLVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE 416
           G +   +G E Q+ R  L + YPI  G +TNWD++EKIWH++FY+ L++APE+HP+L+TE
Sbjct: 46  GEQDWFIGAETQTNRTELNMYYPISRGAITNWDNVEKIWHYSFYHSLQIAPEQHPILITE 105

Query: 417 APLNPKANREKMTQIMFETFNTPAMYVAIQA 509
           APL  K  + +MTQI+FETFN PA+Y A QA
Sbjct: 106 APLTSKEAKSRMTQILFETFNFPALYTANQA 136



 Score = 57.2 bits (132), Expect = 3e-07
 Identities = 24/48 (50%), Positives = 34/48 (70%)
 Frame = +1

Query: 106 EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKD 249
           E   LV D GSG  K GF+G  AP+AVFP+I+G+ +H  V+ G+G++D
Sbjct: 2   EKTPLVCDYGSGFSKVGFSGTQAPQAVFPTILGKMKHTNVLEGLGEQD 49


>UniRef50_A4QNT8 Cluster: Si:ch211-241j12.3 protein; n=3; Danio
           rerio|Rep: Si:ch211-241j12.3 protein - Danio rerio
           (Zebrafish) (Brachydanio rerio)
          Length = 389

 Score =  119 bits (286), Expect = 6e-26
 Identities = 57/115 (49%), Positives = 74/115 (64%)
 Frame = +3

Query: 249 LLVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLN 428
           L VG +AQ  RG+LTL+YPI HG+V+NWD+ME +W H F   L  APE+HPVLLTEA LN
Sbjct: 69  LYVGHDAQHMRGVLTLRYPIRHGVVSNWDEMEMLWTHAF-QLLSAAPEDHPVLLTEAALN 127

Query: 429 PKANREKMTQIMFETFNTPAMYVAIQACSRCTRPVVPPVSCWTSGDGGLPHPCPI 593
           P  NR++M ++MFE F+ P  +VA+QA                SGD G+ H  P+
Sbjct: 128 PLQNRQRMVELMFEAFSVPLTFVAVQAVLALYASGRTTGVVLDSGD-GVSHSVPV 181



 Score = 54.4 bits (125), Expect = 2e-06
 Identities = 21/37 (56%), Positives = 31/37 (83%)
 Frame = +1

Query: 118 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVM 228
           +V+D+GSG+ KAGFA  D P AVFP+++GRP+++ VM
Sbjct: 25  IVLDSGSGLMKAGFADQDLPAAVFPTVIGRPKYEEVM 61


>UniRef50_Q2GY63 Cluster: Putative uncharacterized protein; n=1;
           Chaetomium globosum|Rep: Putative uncharacterized
           protein - Chaetomium globosum (Soil fungus)
          Length = 350

 Score =  118 bits (284), Expect = 1e-25
 Identities = 51/88 (57%), Positives = 71/88 (80%), Gaps = 1/88 (1%)
 Frame = +3

Query: 249 LLVGDEAQSK-RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPL 425
           + VG +A ++ RG+L ++YP+EHGIVT+WDDMEKIW H  Y+EL+   E+HP+LLTE PL
Sbjct: 54  VFVGKKAAAELRGLLKIRYPLEHGIVTDWDDMEKIWSHV-YSELKCDAEQHPLLLTEPPL 112

Query: 426 NPKANREKMTQIMFETFNTPAMYVAIQA 509
           NP++NR+   QI+FETFN PA++ +IQA
Sbjct: 113 NPRSNRDTAAQILFETFNVPALHTSIQA 140



 Score = 51.6 bits (118), Expect = 1e-05
 Identities = 21/40 (52%), Positives = 30/40 (75%)
 Frame = +1

Query: 115 ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVG 234
           A+V+DNGSG  +AG++G+  P+  FPS VGRP+H  V+ G
Sbjct: 9   AVVLDNGSGNIRAGYSGESEPKVNFPSWVGRPKHLRVLAG 48



 Score = 34.7 bits (76), Expect = 1.8
 Identities = 15/17 (88%), Positives = 17/17 (100%)
 Frame = +2

Query: 506 SVLSLYASGRTTGIVLD 556
           +VLSLYASGRTTG+VLD
Sbjct: 140 AVLSLYASGRTTGVVLD 156


>UniRef50_P61163 Cluster: Alpha-centractin; n=356; root|Rep:
           Alpha-centractin - Homo sapiens (Human)
          Length = 376

 Score =  117 bits (281), Expect = 3e-25
 Identities = 54/121 (44%), Positives = 82/121 (67%), Gaps = 1/121 (0%)
 Frame = +3

Query: 249 LLVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFY-NELRVAPEEHPVLLTEAPL 425
           + +G +A+  RG+L+++YP+EHGIV +W+DME+IW + +  ++L+   EEHPVLLTEAPL
Sbjct: 56  IFIGPKAEEHRGLLSIRYPMEHGIVKDWNDMERIWQYVYSKDQLQTFSEEHPVLLTEAPL 115

Query: 426 NPKANREKMTQIMFETFNTPAMYVAIQACSRCTRPVVPPVSCWTSGDGGLPHPCPILRKG 605
           NP+ NRE+  ++ FETFN PA+++++QA                SGD G+ H  PI  +G
Sbjct: 116 NPRKNRERAAEVFFETFNVPALFISMQAVLSLYATGRTTGVVLDSGD-GVTHAVPIY-EG 173

Query: 606 F 608
           F
Sbjct: 174 F 174



 Score = 58.4 bits (135), Expect = 1e-07
 Identities = 25/44 (56%), Positives = 32/44 (72%)
 Frame = +1

Query: 118 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKD 249
           +V+DNGSG+ KAGFAGD  P+  FP+ VGRP+H  VM G  + D
Sbjct: 12  VVIDNGSGVIKAGFAGDQIPKYCFPNYVGRPKHVRVMAGALEGD 55


>UniRef50_Q9XZB9 Cluster: Actin; n=1; Sterkiella nova|Rep: Actin -
           Oxytricha nova
          Length = 374

 Score =  115 bits (276), Expect = 1e-24
 Identities = 48/101 (47%), Positives = 70/101 (69%), Gaps = 2/101 (1%)
 Frame = +3

Query: 213 PSGRDGRYGTEGL--LVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVA 386
           P  ++   G E     +G++A  KRG+L   YP++HGI+ +WDDMEK+W+H F  EL+V 
Sbjct: 37  PKNQNAIIGVEAKDEFIGEDAYLKRGVLKFSYPVQHGIIKDWDDMEKVWNHLFSYELKVD 96

Query: 387 PEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQA 509
             EHP L++E+PL P+  RE+  Q+MFETFN P++Y+AI A
Sbjct: 97  SSEHPFLISESPLTPEFIREQTVQMMFETFNVPSLYMAISA 137



 Score = 57.6 bits (133), Expect = 2e-07
 Identities = 23/49 (46%), Positives = 33/49 (67%)
 Frame = +1

Query: 103 EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKD 249
           E    +V+DNGSG  KAGF G+D P  V  ++VGRP++Q  ++G+  KD
Sbjct: 2   ESSKTIVIDNGSGFVKAGFVGEDGPSVVLRNLVGRPKNQNAIIGVEAKD 50


>UniRef50_A7QKV4 Cluster: Chromosome chr8 scaffold_115, whole genome
           shotgun sequence; n=1; Vitis vinifera|Rep: Chromosome
           chr8 scaffold_115, whole genome shotgun sequence - Vitis
           vinifera (Grape)
          Length = 431

 Score =  114 bits (274), Expect = 2e-24
 Identities = 56/80 (70%), Positives = 62/80 (77%), Gaps = 1/80 (1%)
 Frame = +3

Query: 255 VGDEAQSKRGILTLKYPIEHGIVTNWDDMEK-IWHHTFYNELRVAPEEHPVLLTEAPLNP 431
           V DEAQSK+ +LTLKYP + GIV NWDD  K IWHHTFY EL VAPE H VLLTE  LN 
Sbjct: 26  VEDEAQSKKDMLTLKYPTKSGIVGNWDDKGKTIWHHTFYIELCVAPEAHLVLLTEVLLNL 85

Query: 432 KANREKMTQIMFETFNTPAM 491
           K N +KMTQ MFETF+TPA+
Sbjct: 86  KVNHDKMTQSMFETFSTPAI 105


>UniRef50_Q9DFB8 Cluster: Actin; n=1; Scomberomorus maculatus|Rep:
           Actin - Scomberomorus maculatus (Spanish mackerel)
          Length = 101

 Score =  113 bits (273), Expect = 2e-24
 Identities = 54/89 (60%), Positives = 64/89 (71%), Gaps = 1/89 (1%)
 Frame = +2

Query: 242 RRT-LSRR*GTEQKRYPDPQIPHRTRNRH*LG*HGEDLASYLLQ*AACRPRGTPSPAH*G 418
           RRT  S   G E+KR+PDP++ HR R+ H LG HGEDLA +LLQ AAC PR  P P   G
Sbjct: 13  RRTPTSDERGPEKKRHPDPEVSHRARHHHQLGRHGEDLAPHLLQRAACGPRRAPHPGDRG 72

Query: 419 SPQPQGQQREDDPDHVRNIQHARHVRRHP 505
             QP+ QQREDDPDHVR++Q  R+VRRHP
Sbjct: 73  PSQPKSQQREDDPDHVRDVQCTRNVRRHP 101


>UniRef50_Q8MVN5 Cluster: Cardiac actin-like protein; n=1; Boltenia
           villosa|Rep: Cardiac actin-like protein - Boltenia
           villosa
          Length = 137

 Score =  111 bits (266), Expect = 2e-23
 Identities = 57/96 (59%), Positives = 63/96 (65%), Gaps = 2/96 (2%)
 Frame = +3

Query: 213 PSG-RDGRYGTEGLLVGDEAQS-KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVA 386
           PSG R GR      ++G   QS  R I   K P+E  I+TNWD  EKIWHHT  NEL VA
Sbjct: 10  PSGVRGGR--DRKTVMGYRTQSIGREICLSKIPLERXIITNWDXQEKIWHHTLNNELEVA 67

Query: 387 PEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMY 494
           PEEHP L T+A  NPKANREKM Q MFE F+ PAMY
Sbjct: 68  PEEHPTLFTKAAWNPKANREKMAQXMFEPFSVPAMY 103


>UniRef50_Q4CV94 Cluster: Actin 2, putative; n=2; Trypanosoma
           cruzi|Rep: Actin 2, putative - Trypanosoma cruzi
          Length = 392

 Score =  111 bits (266), Expect = 2e-23
 Identities = 51/94 (54%), Positives = 68/94 (72%)
 Frame = +3

Query: 228 GRYGTEGLLVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVL 407
           G   ++ + VGDEA  ++G L   YP+EHGIV++WD ME++W H  Y +LRV PE   VL
Sbjct: 49  GSSSSQRVYVGDEALQEKG-LRYFYPMEHGIVSDWDQMERVWRHA-YEQLRVPPERQAVL 106

Query: 408 LTEAPLNPKANREKMTQIMFETFNTPAMYVAIQA 509
           LTEAPLNP +NREKM + +FE+F  PA++V IQA
Sbjct: 107 LTEAPLNPISNREKMAETLFESFGVPALHVQIQA 140



 Score = 48.8 bits (111), Expect = 1e-04
 Identities = 20/34 (58%), Positives = 26/34 (76%)
 Frame = +1

Query: 103 EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVG 204
           +E  A+V+DNGSG  K GFAG++ PR VFPS+ G
Sbjct: 7   DEEPAVVLDNGSGNIKCGFAGEEIPRCVFPSVTG 40


>UniRef50_UPI0000E466A7 Cluster: PREDICTED: similar to actin, alpha
           1, skeletal muscle; n=1; Strongylocentrotus
           purpuratus|Rep: PREDICTED: similar to actin, alpha 1,
           skeletal muscle - Strongylocentrotus purpuratus
          Length = 258

 Score =  110 bits (264), Expect = 3e-23
 Identities = 49/73 (67%), Positives = 57/73 (78%)
 Frame = +3

Query: 240 TEGLLVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEA 419
           T    VGDEAQ KRG+L++KYPIE GIVTNW+DME IWHHTFYNELRV P+E  V  T+ 
Sbjct: 8   TRDHFVGDEAQRKRGLLSIKYPIERGIVTNWEDMETIWHHTFYNELRVDPKELLVFFTDV 67

Query: 420 PLNPKANREKMTQ 458
           P + KA+REK TQ
Sbjct: 68  PKSTKASREKTTQ 80


>UniRef50_UPI00005864C8 Cluster: PREDICTED: similar to Actin; n=4;
           Strongylocentrotus purpuratus|Rep: PREDICTED: similar to
           Actin - Strongylocentrotus purpuratus
          Length = 383

 Score =  109 bits (263), Expect = 4e-23
 Identities = 49/88 (55%), Positives = 59/88 (67%)
 Frame = +3

Query: 237 GTEGLLVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE 416
           G     +G+     R +L + YPIEHGIV +W+DMEKIWH+ F  +L V   EHPVL+TE
Sbjct: 49  GKREAFIGEAIYKHREVLGINYPIEHGIVKDWEDMEKIWHYLFDVDLMVDTTEHPVLMTE 108

Query: 417 APLNPKANREKMTQIMFETFNTPAMYVA 500
            P NP  NR+KM QIMFETF  PA YVA
Sbjct: 109 PPGNPMYNRQKMAQIMFETFQIPAFYVA 136



 Score = 44.0 bits (99), Expect = 0.003
 Identities = 21/42 (50%), Positives = 26/42 (61%)
 Frame = +1

Query: 100 DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGV 225
           D+    +VVDNGSG  +AGFAG    RA FPS +GR +   V
Sbjct: 6   DDGPDPVVVDNGSGTIQAGFAGGKTCRATFPSCIGRSKKSHV 47


>UniRef50_UPI0000588EB0 Cluster: PREDICTED: similar to actin; n=1;
           Strongylocentrotus purpuratus|Rep: PREDICTED: similar to
           actin - Strongylocentrotus purpuratus
          Length = 386

 Score =  107 bits (256), Expect = 3e-22
 Identities = 45/85 (52%), Positives = 64/85 (75%)
 Frame = +3

Query: 255 VGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPK 434
           VG+EAQ++RG+LTL YPIE GI+T WDDME +W HTF +E++  P++   +L++ P NPK
Sbjct: 64  VGEEAQNRRGVLTLTYPIERGIITKWDDMEAVWSHTF-SEIKFNPQDEGAVLSQIPNNPK 122

Query: 435 ANREKMTQIMFETFNTPAMYVAIQA 509
            N+EKM +I FE F +P + +A QA
Sbjct: 123 PNKEKMAEIFFEKFQSPGICLANQA 147



 Score = 52.4 bits (120), Expect = 8e-06
 Identities = 23/37 (62%), Positives = 29/37 (78%)
 Frame = +1

Query: 118 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVM 228
           +V+D+GS   +AGFA +D PR VF SIVGRPRHQ V+
Sbjct: 14  MVIDHGSFEIQAGFAEEDCPRTVFQSIVGRPRHQEVL 50


>UniRef50_A2FRF9 Cluster: Actin family protein; n=1; Trichomonas
           vaginalis G3|Rep: Actin family protein - Trichomonas
           vaginalis G3
          Length = 543

 Score =  107 bits (256), Expect = 3e-22
 Identities = 44/105 (41%), Positives = 65/105 (61%)
 Frame = +3

Query: 255 VGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPK 434
           VG+E  +K  ++ +  PIE+G++ NWDD+EK+WHHT+YNEL V P++HPV++TE     +
Sbjct: 52  VGNEVFTKSDLVDISKPIENGVIVNWDDIEKVWHHTYYNELLVVPDQHPVIITEKQCATQ 111

Query: 435 ANREKMTQIMFETFNTPAMYVAIQACSRCTRPVVPPVSCWTSGDG 569
             REK  Q+ FETFN P  Y  +Q+        +     W  G+G
Sbjct: 112 HAREKTIQMFFETFNVPGYYSGVQSVFALLSCGLTTGIVWDGGEG 156



 Score = 43.2 bits (97), Expect = 0.005
 Identities = 17/39 (43%), Positives = 25/39 (64%)
 Frame = +1

Query: 118 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVG 234
           +V+D GSG  K GFAG   P+  FP++VG P+    ++G
Sbjct: 6   VVIDTGSGFTKVGFAGYYEPKVEFPTVVGVPKDSTALIG 44


>UniRef50_P61160 Cluster: Actin-related protein 2; n=96;
           Eukaryota|Rep: Actin-related protein 2 - Homo sapiens
           (Human)
          Length = 394

 Score =  105 bits (251), Expect = 1e-21
 Identities = 55/128 (42%), Positives = 76/128 (59%), Gaps = 1/128 (0%)
 Frame = +3

Query: 228 GRYGTEGLLVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNE-LRVAPEEHPV 404
           G    + L+VGDEA   R +L + YP+E+GIV NWDDM+ +W +TF  E L +      +
Sbjct: 48  GNIEIKDLMVGDEASELRSMLEVNYPMENGIVRNWDDMKHLWDYTFGPEKLNIDTRNCKI 107

Query: 405 LLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQACSRCTRPVVPPVSCWTSGDGGLPHP 584
           LLTE P+NP  NREK+ ++MFET+    +YVAIQA        +       SGD G+ H 
Sbjct: 108 LLTEPPMNPTKNREKIVEVMFETYQFSGVYVAIQAVLTLYAQGLLTGVVVDSGD-GVTHI 166

Query: 585 CPILRKGF 608
           CP+  +GF
Sbjct: 167 CPVY-EGF 173



 Score = 43.2 bits (97), Expect = 0.005
 Identities = 16/31 (51%), Positives = 23/31 (74%)
 Frame = +1

Query: 118 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRP 210
           +V DNG+G  K G+AG + P  +FP++VGRP
Sbjct: 9   VVCDNGTGFVKCGYAGSNFPEHIFPALVGRP 39


>UniRef50_Q5KB93 Cluster: Actin binding protein, putative; n=3;
           Filobasidiella neoformans|Rep: Actin binding protein,
           putative - Cryptococcus neoformans (Filobasidiella
           neoformans)
          Length = 390

 Score =  104 bits (250), Expect = 1e-21
 Identities = 49/124 (39%), Positives = 73/124 (58%)
 Frame = +3

Query: 222 RDGRYGTEGLLVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHP 401
           R G    + +++GDEA   R  L + +P+EHG+V NW+DM  +W +TF  ++ + P    
Sbjct: 44  RLGTSQLKDIMIGDEAAENRSYLQVTHPMEHGVVKNWEDMRHLWDYTFNEKMHMDPRGKK 103

Query: 402 VLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQACSRCTRPVVPPVSCWTSGDGGLPH 581
           +LLTE P+NPKANR+KM ++MFE +    +YVAIQA        +       SGD G+ H
Sbjct: 104 ILLTEPPMNPKANRQKMCEVMFEEYGFGGVYVAIQAVLTLYAQGLQTGVVVDSGD-GVTH 162

Query: 582 PCPI 593
             P+
Sbjct: 163 IVPV 166



 Score = 47.2 bits (107), Expect = 3e-04
 Identities = 21/31 (67%), Positives = 24/31 (77%)
 Frame = +1

Query: 118 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRP 210
           LVVDNG+G  K G+AG + P  VFPSIVGRP
Sbjct: 7   LVVDNGTGFVKCGWAGSNFPDYVFPSIVGRP 37


>UniRef50_Q7M3B0 Cluster: Actin beta; n=1; Sus scrofa domestica|Rep:
           Actin beta - Sus scrofa domestica (domestic pig)
          Length = 195

 Score =  102 bits (244), Expect = 8e-21
 Identities = 52/70 (74%), Positives = 52/70 (74%)
 Frame = +3

Query: 300 YPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN 479
           YPIEHGIVTNWDDMEKIWHHTFYNELRVAPEE                  MTQIMFETFN
Sbjct: 21  YPIEHGIVTNWDDMEKIWHHTFYNELRVAPEE------------------MTQIMFETFN 62

Query: 480 TPAMYVAIQA 509
           TPAMYVAIQA
Sbjct: 63  TPAMYVAIQA 72



 Score = 46.4 bits (105), Expect = 5e-04
 Identities = 20/20 (100%), Positives = 20/20 (100%)
 Frame = +1

Query: 151 AGFAGDDAPRAVFPSIVGRP 210
           AGFAGDDAPRAVFPSIVGRP
Sbjct: 1   AGFAGDDAPRAVFPSIVGRP 20


>UniRef50_UPI0000D9A391 Cluster: PREDICTED: actin related protein M1
           isoform 1; n=1; Macaca mulatta|Rep: PREDICTED: actin
           related protein M1 isoform 1 - Macaca mulatta
          Length = 319

 Score =  101 bits (243), Expect = 1e-20
 Identities = 46/103 (44%), Positives = 67/103 (65%)
 Frame = +3

Query: 201 GKAPPSGRDGRYGTEGLLVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELR 380
           G+A    R    G E L VGD+AQ  R  L++ YP+E G++T+WDDME +W H +   L+
Sbjct: 99  GRAKGQSRAAPGGLE-LCVGDQAQDWRSSLSISYPVERGLITSWDDMEIMWKHIYDYNLK 157

Query: 381 VAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQA 509
           + P + PVL+TE  LNP ANR+++ ++ FE    PA Y++IQA
Sbjct: 158 LKPCDGPVLITEPALNPLANRQQIVEVFFEHLGVPAFYMSIQA 200



 Score = 44.4 bits (100), Expect = 0.002
 Identities = 17/34 (50%), Positives = 26/34 (76%)
 Frame = +1

Query: 118 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQ 219
           +V+DNGSG+ KAG AG   P+ ++P+I+GR + Q
Sbjct: 71  VVIDNGSGVIKAGLAGSREPQFIYPNIIGRAKGQ 104


>UniRef50_Q9BYD9 Cluster: Actin-related protein M1; n=12;
           Theria|Rep: Actin-related protein M1 - Homo sapiens
           (Human)
          Length = 372

 Score =  101 bits (242), Expect = 1e-20
 Identities = 46/103 (44%), Positives = 68/103 (66%)
 Frame = +3

Query: 201 GKAPPSGRDGRYGTEGLLVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELR 380
           G+A    R  + G E L VGD+AQ  R  L + YP+E G++T+W+DME +W H +   L+
Sbjct: 36  GRAKGQSRAAQGGLE-LCVGDQAQDWRSSLFISYPVERGLITSWEDMEIMWKHIYDYNLK 94

Query: 381 VAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQA 509
           + P + PVL+TE  LNP ANR+++T++ FE    PA Y++IQA
Sbjct: 95  LKPCDGPVLITEPALNPLANRQQITEMFFEHLGVPAFYMSIQA 137



 Score = 44.4 bits (100), Expect = 0.002
 Identities = 18/34 (52%), Positives = 26/34 (76%)
 Frame = +1

Query: 118 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQ 219
           +V+DNGSGM KAG AG   P+ ++P+I+GR + Q
Sbjct: 8   VVIDNGSGMIKAGVAGCREPQFIYPNIIGRAKGQ 41


>UniRef50_Q38F20 Cluster: Actin-like protein 3, putative; n=1;
           Trypanosoma brucei|Rep: Actin-like protein 3, putative -
           Trypanosoma brucei
          Length = 416

 Score =  100 bits (239), Expect = 3e-20
 Identities = 43/84 (51%), Positives = 55/84 (65%)
 Frame = +3

Query: 255 VGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPK 434
           VGDEA +      L +PI+HGIV +WD ME+IW H  Y  LRV PEEH  +LTE P NP 
Sbjct: 54  VGDEALAHSSSCNLYHPIKHGIVEDWDKMERIWQHCVYKYLRVDPEEHGFILTEPPANPP 113

Query: 435 ANREKMTQIMFETFNTPAMYVAIQ 506
            NRE   ++MFETF    +++A+Q
Sbjct: 114 ENREHTAEVMFETFGVKQLHIAVQ 137



 Score = 32.7 bits (71), Expect = 7.1
 Identities = 11/26 (42%), Positives = 19/26 (73%)
 Frame = +1

Query: 118 LVVDNGSGMCKAGFAGDDAPRAVFPS 195
           +V+DNG+G  K G+AG++ P  + P+
Sbjct: 6   VVIDNGTGYTKMGYAGNEEPTYIIPT 31


>UniRef50_Q8TDY3 Cluster: Actin-related protein T2; n=26;
           Amniota|Rep: Actin-related protein T2 - Homo sapiens
           (Human)
          Length = 377

 Score = 99.5 bits (237), Expect = 5e-20
 Identities = 43/85 (50%), Positives = 57/85 (67%)
 Frame = +3

Query: 255 VGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPK 434
           VG+EA  K+  L L  P E G++T WDD+E++W H F  EL V P + P+L TE  LNP+
Sbjct: 58  VGEEALYKQEALQLHSPFERGLITGWDDVERLWKHLFEWELGVKPSDQPLLATEPSLNPR 117

Query: 435 ANREKMTQIMFETFNTPAMYVAIQA 509
            NREKM ++MFE F  PA Y++ QA
Sbjct: 118 ENREKMAEVMFENFGVPAFYLSDQA 142



 Score = 44.0 bits (99), Expect = 0.003
 Identities = 20/44 (45%), Positives = 26/44 (59%)
 Frame = +1

Query: 115 ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQK 246
           A++ DNGSG CKAG +G+  PR +  SIVG  + Q       QK
Sbjct: 11  AVIFDNGSGFCKAGLSGEFGPRHMVSSIVGHLKFQAPSAEANQK 54


>UniRef50_Q9Y615 Cluster: Actin-like protein 7A; n=11; Mammalia|Rep:
           Actin-like protein 7A - Homo sapiens (Human)
          Length = 435

 Score = 97.5 bits (232), Expect = 2e-19
 Identities = 39/85 (45%), Positives = 59/85 (69%)
 Frame = +3

Query: 255 VGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPK 434
           VG E  +    L L  P+ HGI+ +WD ++ IW + F  E+++APEEH VL+++ PL+P 
Sbjct: 118 VGQELNNTNVHLKLVNPLRHGIIVDWDTVQDIWEYLFRQEMKIAPEEHAVLVSDPPLSPH 177

Query: 435 ANREKMTQIMFETFNTPAMYVAIQA 509
            NREK  +++FE FNTPAM++A Q+
Sbjct: 178 TNREKYAEMLFEAFNTPAMHIAYQS 202



 Score = 39.1 bits (87), Expect = 0.082
 Identities = 19/50 (38%), Positives = 27/50 (54%)
 Frame = +1

Query: 103 EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 252
           E   A+VVD G+G CK GFAG   P     + VG+P  +    G  +K++
Sbjct: 67  EVTKAVVVDLGTGYCKCGFAGLPRPTHKISTTVGKPYMETAKTGDNRKET 116


>UniRef50_A2VD47 Cluster: Zgc:158823 protein; n=3; Eukaryota|Rep:
           Zgc:158823 protein - Danio rerio (Zebrafish)
           (Brachydanio rerio)
          Length = 334

 Score = 96.7 bits (230), Expect = 4e-19
 Identities = 43/85 (50%), Positives = 55/85 (64%)
 Frame = +3

Query: 255 VGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPK 434
           +GDEA  K    T K+PI HGI+ +WD MEK      +  LR  PE+H  L+TE PLN  
Sbjct: 63  IGDEAIDKPNYAT-KWPIRHGIIEDWDFMEKFMEQVIFKYLRAEPEDHNFLMTEPPLNTP 121

Query: 435 ANREKMTQIMFETFNTPAMYVAIQA 509
            NRE + +IMFETFN P +Y+A+QA
Sbjct: 122 ENREYLAEIMFETFNVPGLYIAVQA 146


>UniRef50_Q0J646 Cluster: Os08g0369300 protein; n=2; Oryza sativa
           (japonica cultivar-group)|Rep: Os08g0369300 protein -
           Oryza sativa subsp. japonica (Rice)
          Length = 495

 Score = 96.7 bits (230), Expect = 4e-19
 Identities = 49/122 (40%), Positives = 70/122 (57%)
 Frame = +3

Query: 249 LLVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLN 428
           ++VG      R  L + YP+ +GIV +WDDM  IW H FY+EL+V P E  +LLT+ PLN
Sbjct: 53  IVVGAACADLRHQLDVSYPVTNGIVQSWDDMGHIWDHAFYSELKVDPSECKILLTDPPLN 112

Query: 429 PKANREKMTQIMFETFNTPAMYVAIQACSRCTRPVVPPVSCWTSGDGGLPHPCPILRKGF 608
           P  NREKM + MFE +N   +++ +QA        +       SGD G+ H  P++  GF
Sbjct: 113 PVKNREKMIETMFEKYNFAGVFIQVQAVLSLYAQGLLTGLVIDSGD-GVTHVVPVV-DGF 170

Query: 609 RH 614
            +
Sbjct: 171 SY 172



 Score = 45.6 bits (103), Expect = 0.001
 Identities = 18/31 (58%), Positives = 24/31 (77%)
 Frame = +1

Query: 118 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRP 210
           +V DNG+G  K GFAG++ P +VFP +VGRP
Sbjct: 7   VVCDNGTGYVKCGFAGENFPTSVFPCVVGRP 37


>UniRef50_Q55DY5 Cluster: Putative uncharacterized protein; n=1;
           Dictyostelium discoideum AX4|Rep: Putative
           uncharacterized protein - Dictyostelium discoideum AX4
          Length = 355

 Score = 96.3 bits (229), Expect = 5e-19
 Identities = 45/96 (46%), Positives = 61/96 (63%)
 Frame = +3

Query: 219 GRDGRYGTEGLLVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEH 398
           G   + G   L  G EA ++     L YPI++GIV NW+DMEK   +TFY +LRV P+ H
Sbjct: 34  GHPNKQGDTKLFYGKEAVARFSTSKLVYPIKNGIVCNWEDMEKFIENTFYYKLRVEPQYH 93

Query: 399 PVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQ 506
            VLLTE  +N K NR KM +IMFET++ P++ +  Q
Sbjct: 94  SVLLTETTMNTKENRNKMAEIMFETYDIPSIKIENQ 129



 Score = 35.1 bits (77), Expect = 1.3
 Identities = 15/35 (42%), Positives = 20/35 (57%)
 Frame = +1

Query: 118 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQG 222
           +++D GSG  K GF G+  P     +IVG P  QG
Sbjct: 6   IIIDFGSGWTKCGFEGEVTPSVECLTIVGHPNKQG 40


>UniRef50_Q9Y614 Cluster: Actin-like protein 7B; n=12; Theria|Rep:
           Actin-like protein 7B - Homo sapiens (Human)
          Length = 415

 Score = 96.3 bits (229), Expect = 5e-19
 Identities = 43/103 (41%), Positives = 63/103 (61%)
 Frame = +3

Query: 201 GKAPPSGRDGRYGTEGLLVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELR 380
           GK  P   D     +  LVG E  +    L L  P++HGIV +WD ++ IW + F   ++
Sbjct: 80  GKRCPEAADAGDTRKWTLVGHELLNTEAPLKLVNPLKHGIVVDWDCVQDIWEYIFRTAMK 139

Query: 381 VAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQA 509
           + PEEH VL+++ PL+P +NREK  ++MFETF  PAM+V  Q+
Sbjct: 140 ILPEEHAVLVSDPPLSPSSNREKYAELMFETFGIPAMHVTSQS 182



 Score = 33.9 bits (74), Expect = 3.1
 Identities = 13/34 (38%), Positives = 21/34 (61%)
 Frame = +1

Query: 106 EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGR 207
           ++ A+++D GS  CK G+AG+  P     S VG+
Sbjct: 48  KIKAVIIDLGSQYCKCGYAGEPRPTYFISSTVGK 81


>UniRef50_A2YUL5 Cluster: Putative uncharacterized protein; n=1;
           Oryza sativa (indica cultivar-group)|Rep: Putative
           uncharacterized protein - Oryza sativa subsp. indica
           (Rice)
          Length = 367

 Score = 95.5 bits (227), Expect = 9e-19
 Identities = 41/87 (47%), Positives = 57/87 (65%)
 Frame = +3

Query: 249 LLVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLN 428
           ++VG      R  L + YP+ +GIV +WDDM  IW H FY+EL+V P E  +LLT+ PLN
Sbjct: 53  IVVGAACADLRHQLDVSYPVTNGIVQSWDDMGHIWDHAFYSELKVDPSECKILLTDPPLN 112

Query: 429 PKANREKMTQIMFETFNTPAMYVAIQA 509
           P  NREKM + MFE +N   +++ +QA
Sbjct: 113 PVKNREKMIETMFEKYNFAGVFIQVQA 139



 Score = 45.6 bits (103), Expect = 0.001
 Identities = 18/31 (58%), Positives = 24/31 (77%)
 Frame = +1

Query: 118 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRP 210
           +V DNG+G  K GFAG++ P +VFP +VGRP
Sbjct: 7   VVCDNGTGYVKCGFAGENFPTSVFPCVVGRP 37


>UniRef50_Q24C02 Cluster: Actin family protein; n=3;
           Oligohymenophorea|Rep: Actin family protein -
           Tetrahymena thermophila SB210
          Length = 398

 Score = 95.1 bits (226), Expect = 1e-18
 Identities = 39/84 (46%), Positives = 63/84 (75%)
 Frame = +3

Query: 255 VGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPK 434
           +G+ +  +RG+L L+YPI HGI+ NW+DM+ IW +  Y+EL+V+ +E+PVLLTE  +NP 
Sbjct: 59  LGNISDEQRGLLKLQYPINHGIIQNWNDMDLIWKYC-YSELKVSAKEYPVLLTEPAINPI 117

Query: 435 ANREKMTQIMFETFNTPAMYVAIQ 506
            ++ ++ Q  FE FN PA+++A+Q
Sbjct: 118 NHKFRVAQQFFENFNAPALFIAVQ 141



 Score = 45.6 bits (103), Expect = 0.001
 Identities = 19/44 (43%), Positives = 30/44 (68%)
 Frame = +1

Query: 118 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKD 249
           +V+DNGSG+ +AG AG+D  +  F S +GRP+++ V+    Q D
Sbjct: 13  VVIDNGSGIIRAGIAGEDKAKLQFDSYIGRPKYKMVLPTNTQSD 56


>UniRef50_Q4N681 Cluster: Actin, putative; n=3; Piroplasmida|Rep:
           Actin, putative - Theileria parva
          Length = 380

 Score = 94.3 bits (224), Expect = 2e-18
 Identities = 38/66 (57%), Positives = 49/66 (74%)
 Frame = +3

Query: 303 PIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNT 482
           P++HGIV NW   E +W HTF NEL+++ EEHPVLLTE PL PK +RE   Q+ FE+F  
Sbjct: 75  PVQHGIVRNWALAESVWRHTFTNELKISQEEHPVLLTEPPLTPKLHRELCCQLFFESFGV 134

Query: 483 PAMYVA 500
           PA+Y+A
Sbjct: 135 PALYLA 140



 Score = 43.2 bits (97), Expect = 0.005
 Identities = 20/49 (40%), Positives = 29/49 (59%), Gaps = 3/49 (6%)
 Frame = +1

Query: 103 EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIV---GRPRHQGVMVGMG 240
           +E  AL++D GS + KAGFAG + P+  FP++V   G       +VG G
Sbjct: 3   DETLALIIDTGSAVTKAGFAGSETPKVRFPTLVAIDGNQESDDPLVGNG 51


>UniRef50_P32392 Cluster: Actin-related protein 3; n=27;
           Eukaryota|Rep: Actin-related protein 3 - Drosophila
           melanogaster (Fruit fly)
          Length = 418

 Score = 94.3 bits (224), Expect = 2e-18
 Identities = 42/85 (49%), Positives = 55/85 (64%)
 Frame = +3

Query: 255 VGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPK 434
           +GDEA    G  ++KYP+ HG+V +WD ME+      +  LR  PE+H  LLTE PLN  
Sbjct: 62  IGDEAFDATGY-SIKYPVRHGLVEDWDLMERFLEQCVFKYLRAEPEDHYFLLTEPPLNTP 120

Query: 435 ANREKMTQIMFETFNTPAMYVAIQA 509
            NRE   +IMFETFN P +Y+A+QA
Sbjct: 121 ENREYTAEIMFETFNVPGLYIAVQA 145



 Score = 32.7 bits (71), Expect = 7.1
 Identities = 13/29 (44%), Positives = 19/29 (65%)
 Frame = +1

Query: 115 ALVVDNGSGMCKAGFAGDDAPRAVFPSIV 201
           A V+D G+G  K GFAG+  P+ + PS +
Sbjct: 7   ACVIDVGTGYSKLGFAGNKEPQFIIPSAI 35


>UniRef50_A2FH22 Cluster: Actin family protein; n=1; Trichomonas
           vaginalis G3|Rep: Actin family protein - Trichomonas
           vaginalis G3
          Length = 390

 Score = 93.5 bits (222), Expect = 4e-18
 Identities = 42/87 (48%), Positives = 57/87 (65%)
 Frame = +3

Query: 249 LLVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLN 428
           ++V DE    R  L L  P+EHGIV NW+D   +  + F  +L++  E+HP+L+TEAPLN
Sbjct: 52  IMVCDETYPVRQYLDLTLPVEHGIVKNWEDEALVLDYVFKEKLKIRNEDHPLLITEAPLN 111

Query: 429 PKANREKMTQIMFETFNTPAMYVAIQA 509
           PK NR+KM +I FE FN P + V  QA
Sbjct: 112 PKDNRKKMCEIFFEQFNFPRLQVCPQA 138


>UniRef50_Q4QG59 Cluster: Actin-like protein, putative; n=3;
           Leishmania|Rep: Actin-like protein, putative -
           Leishmania major
          Length = 483

 Score = 93.1 bits (221), Expect = 5e-18
 Identities = 39/81 (48%), Positives = 57/81 (70%)
 Frame = +3

Query: 255 VGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPK 434
           VG+EA  K+GIL + +PI +G + +W D+EK+W H F+NELRV+PE H  LLT+    P 
Sbjct: 56  VGEEALLKQGILDVHHPIRNGFINDWGDVEKLWSHLFFNELRVSPETHCFLLTQPVNTPA 115

Query: 435 ANREKMTQIMFETFNTPAMYV 497
           A RE+  +IM ETF+  ++Y+
Sbjct: 116 AQRERTLEIMMETFHAHSLYL 136



 Score = 45.2 bits (102), Expect = 0.001
 Identities = 19/46 (41%), Positives = 29/46 (63%)
 Frame = +1

Query: 112 AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKD 249
           AA+V+D GS   +AGF G+  PR   P++VG PRH+ + +  G  +
Sbjct: 8   AAVVLDCGSFHSRAGFGGEKGPRLDVPTLVGYPRHRSIAMAAGMNE 53


>UniRef50_P61158 Cluster: Actin-related protein 3; n=107;
           Eukaryota|Rep: Actin-related protein 3 - Homo sapiens
           (Human)
          Length = 418

 Score = 92.3 bits (219), Expect = 8e-18
 Identities = 43/85 (50%), Positives = 54/85 (63%)
 Frame = +3

Query: 255 VGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPK 434
           +GDEA  K    T K+PI HGIV +WD ME+      +  LR  PE+H  LLTE PLN  
Sbjct: 62  IGDEAIEKPTYAT-KWPIRHGIVEDWDLMERFMEQVIFKYLRAEPEDHYFLLTEPPLNTP 120

Query: 435 ANREKMTQIMFETFNTPAMYVAIQA 509
            NRE   +IMFE+FN P +Y+A+QA
Sbjct: 121 ENREYTAEIMFESFNVPGLYIAVQA 145


>UniRef50_A2YQV6 Cluster: Putative uncharacterized protein; n=1;
           Oryza sativa (indica cultivar-group)|Rep: Putative
           uncharacterized protein - Oryza sativa subsp. indica
           (Rice)
          Length = 581

 Score = 91.9 bits (218), Expect = 1e-17
 Identities = 41/88 (46%), Positives = 58/88 (65%), Gaps = 3/88 (3%)
 Frame = +3

Query: 255 VGDEAQS---KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPL 425
           +GDEA S     G+ T K+PI HG V +WD ME+ W    +N LR  PEEH  LLT++P+
Sbjct: 371 MGDEALSLFKSSGLYTRKHPINHGQVDDWDTMERFWQQCIFNYLRCNPEEHYFLLTDSPV 430

Query: 426 NPKANREKMTQIMFETFNTPAMYVAIQA 509
           +   +RE   +IMFETFN P +Y+++Q+
Sbjct: 431 STPESRECAGEIMFETFNVPGLYISVQS 458


>UniRef50_A5B4L4 Cluster: Putative uncharacterized protein; n=1;
           Vitis vinifera|Rep: Putative uncharacterized protein -
           Vitis vinifera (Grape)
          Length = 571

 Score = 91.5 bits (217), Expect = 1e-17
 Identities = 42/87 (48%), Positives = 54/87 (62%), Gaps = 3/87 (3%)
 Frame = +3

Query: 255 VGDEAQSKR---GILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPL 425
           +GDEA ++        L YPI HG V NWD ME+ W    +N LR  PE+H  LLTE+PL
Sbjct: 127 IGDEAIARSRNSSTYNLSYPIVHGQVDNWDAMERFWQQCIFNYLRCDPEDHYFLLTESPL 186

Query: 426 NPKANREKMTQIMFETFNTPAMYVAIQ 506
               +RE   +IMFETFN P +Y+A+Q
Sbjct: 187 TAPESREYTGEIMFETFNVPGLYIAVQ 213


>UniRef50_Q55DS6 Cluster: Putative uncharacterized protein; n=1;
           Dictyostelium discoideum AX4|Rep: Putative
           uncharacterized protein - Dictyostelium discoideum AX4
          Length = 392

 Score = 91.1 bits (216), Expect = 2e-17
 Identities = 34/87 (39%), Positives = 64/87 (73%)
 Frame = +3

Query: 249 LLVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLN 428
           +  G E ++++  +++K+PIE G + NWDDMEK+ +++F+  L ++ +E+P+L+T++P N
Sbjct: 61  IFAGHEVETQKTNISIKHPIERGSIINWDDMEKLLNYSFHQVLNISCDEYPILITDSPFN 120

Query: 429 PKANREKMTQIMFETFNTPAMYVAIQA 509
            K NRE++TQ++FET+N+    V  +A
Sbjct: 121 SKMNRERLTQLLFETYNSKLASVTNRA 147



 Score = 41.1 bits (92), Expect = 0.020
 Identities = 19/51 (37%), Positives = 33/51 (64%), Gaps = 2/51 (3%)
 Frame = +1

Query: 100 DEEVA-ALVVDNGSGMCKAGFAGDD-APRAVFPSIVGRPRHQGVMVGMGQK 246
           +EE+  ++++D GSG  K GF+ ++  PR  FP+I+GR ++  V+ G   K
Sbjct: 8   NEEIRNSVIIDCGSGFTKVGFSNEELTPRNEFPTIIGRTKYYEVLYGAPNK 58


>UniRef50_Q6BG22 Cluster: Actin, putative; n=2; Paramecium
           tetraurelia|Rep: Actin, putative - Paramecium
           tetraurelia
          Length = 370

 Score = 90.2 bits (214), Expect = 3e-17
 Identities = 37/85 (43%), Positives = 59/85 (69%)
 Frame = +3

Query: 252 LVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNP 431
           L+G++ +  +      YPI++G + +W+ +E+IW + F  +L+++P  HPVLLTEAP N 
Sbjct: 47  LIGNQIEENQYNNQPCYPIQNGQIMDWESIEQIWRYIFEVQLKISPSNHPVLLTEAPCNS 106

Query: 432 KANREKMTQIMFETFNTPAMYVAIQ 506
           K N+EKMTQIMFE F  P ++++ Q
Sbjct: 107 KINQEKMTQIMFENFEVPFLHISNQ 131


>UniRef50_A2DBN6 Cluster: Actin family protein; n=1; Trichomonas
           vaginalis G3|Rep: Actin family protein - Trichomonas
           vaginalis G3
          Length = 373

 Score = 90.2 bits (214), Expect = 3e-17
 Identities = 42/96 (43%), Positives = 55/96 (57%)
 Frame = +3

Query: 213 PSGRDGRYGTEGLLVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPE 392
           P  +     T+ + VG E   +   L LK PI   +++N D++E  W H F  EL +   
Sbjct: 39  PQDKAAAIATKDIYVGSEVFEQSKNLNLKCPISDRVISNIDEIEVFWQHIFSKELNINTS 98

Query: 393 EHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVA 500
           EHPVL+TE+P N K  REK+TQIM ETF  PA Y A
Sbjct: 99  EHPVLMTESPQNTKIMREKVTQIMMETFKVPAYYTA 134



 Score = 40.7 bits (91), Expect = 0.027
 Identities = 14/34 (41%), Positives = 24/34 (70%)
 Frame = +1

Query: 106 EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGR 207
           EV+ +V+D G+   +AGF GD  P+ + P+++GR
Sbjct: 2   EVSTIVIDTGAYSTRAGFGGDSDPQCILPTVIGR 35


>UniRef50_UPI0001554F81 Cluster: PREDICTED: similar to actin; n=1;
           Ornithorhynchus anatinus|Rep: PREDICTED: similar to
           actin - Ornithorhynchus anatinus
          Length = 376

 Score = 89.8 bits (213), Expect = 4e-17
 Identities = 36/73 (49%), Positives = 54/73 (73%)
 Frame = +3

Query: 288 LTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMF 467
           L L +P+  G+VT+WD+ME++W + F  +L   P +HPVLLTE+P N  A+R+K+ QIMF
Sbjct: 67  LALTFPVTRGVVTDWDEMERLWGYVF-QKLHARPTKHPVLLTESPKNRAADRDKLLQIMF 125

Query: 468 ETFNTPAMYVAIQ 506
           ETFN P+ ++ +Q
Sbjct: 126 ETFNVPSTFLGVQ 138



 Score = 51.6 bits (118), Expect = 1e-05
 Identities = 20/32 (62%), Positives = 27/32 (84%)
 Frame = +1

Query: 109 VAALVVDNGSGMCKAGFAGDDAPRAVFPSIVG 204
           +  LV+DNG+G+CKAGFAGD+AP+ V P+ VG
Sbjct: 1   MTTLVIDNGTGLCKAGFAGDNAPKLVVPTAVG 32


>UniRef50_Q54UQ7 Cluster: Actin-like protein 6A; n=1; Dictyostelium
           discoideum AX4|Rep: Actin-like protein 6A -
           Dictyostelium discoideum AX4
          Length = 440

 Score = 89.4 bits (212), Expect = 6e-17
 Identities = 35/69 (50%), Positives = 50/69 (72%)
 Frame = +3

Query: 303 PIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNT 482
           P+  G++ NWD ME+IW+HTFY  L + P EHP+LL E   N +A REK+T+IMFE ++ 
Sbjct: 86  PLSDGLIKNWDAMEQIWNHTFYERLHINPIEHPILLAEPTYNTRAIREKVTEIMFEKYHA 145

Query: 483 PAMYVAIQA 509
           PA+++A  A
Sbjct: 146 PALFIAKNA 154



 Score = 44.4 bits (100), Expect = 0.002
 Identities = 19/50 (38%), Positives = 35/50 (70%), Gaps = 1/50 (2%)
 Frame = +1

Query: 103 EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRP-RHQGVMVGMGQKD 249
           ++V+A+V+D G+   K G+AG+D+P+AVFP+ +G   +++   VG G  +
Sbjct: 5   DDVSAIVIDVGTFSTKGGYAGEDSPKAVFPTDIGVVYKNENETVGTGDSE 54


>UniRef50_Q4SGD5 Cluster: Chromosome 17 SCAF14597, whole genome
           shotgun sequence; n=1; Tetraodon nigroviridis|Rep:
           Chromosome 17 SCAF14597, whole genome shotgun sequence -
           Tetraodon nigroviridis (Green puffer)
          Length = 425

 Score = 88.6 bits (210), Expect = 1e-16
 Identities = 45/108 (41%), Positives = 65/108 (60%), Gaps = 1/108 (0%)
 Frame = +3

Query: 288 LTLKYPIEHGIVTNWDDMEKIWHHTFYNE-LRVAPEEHPVLLTEAPLNPKANREKMTQIM 464
           + + YP+E+GIV NWDDM+ +W +TF  E L +      +LLTE P+NP  NREK+ ++M
Sbjct: 52  IKVNYPMENGIVRNWDDMKHLWDYTFGPEKLNIDSRNCKILLTEPPMNPTKNREKIIEVM 111

Query: 465 FETFNTPAMYVAIQACSRCTRPVVPPVSCWTSGDGGLPHPCPILRKGF 608
           FET+    +Y+AIQA        +       SGD G+ H CP+  +GF
Sbjct: 112 FETYQFAGVYIAIQAVLTLYAQGLLTGVVVDSGD-GVTHICPVY-EGF 157



 Score = 43.2 bits (97), Expect = 0.005
 Identities = 16/31 (51%), Positives = 23/31 (74%)
 Frame = +1

Query: 118 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRP 210
           +V DNG+G  K G+AG + P  +FP++VGRP
Sbjct: 9   VVCDNGTGFVKCGYAGSNFPEHIFPALVGRP 39


>UniRef50_A0CQQ2 Cluster: Chromosome undetermined scaffold_24, whole
           genome shotgun sequence; n=7; Oligohymenophorea|Rep:
           Chromosome undetermined scaffold_24, whole genome
           shotgun sequence - Paramecium tetraurelia
          Length = 869

 Score = 88.6 bits (210), Expect = 1e-16
 Identities = 37/85 (43%), Positives = 54/85 (63%)
 Frame = +3

Query: 255 VGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPK 434
           +G EA        + YP++ GIV NWD MEK WH + ++ LR  P+E   +LTE P+NP 
Sbjct: 65  IGYEAYDYTKSHNIFYPMKSGIVENWDLMEKFWHRSIFDYLRAEPDETTFILTEPPMNPP 124

Query: 435 ANREKMTQIMFETFNTPAMYVAIQA 509
            NRE + +I FETFN   +++++QA
Sbjct: 125 ENRENIAEIFFETFNAKGLHISVQA 149


>UniRef50_UPI00006C1719 Cluster: PREDICTED: similar to actin, alpha
           2, smooth muscle, aorta; n=3; Homo/Pan/Gorilla
           group|Rep: PREDICTED: similar to actin, alpha 2, smooth
           muscle, aorta - Homo sapiens
          Length = 183

 Score = 87.4 bits (207), Expect = 2e-16
 Identities = 39/51 (76%), Positives = 43/51 (84%)
 Frame = +3

Query: 237 GTEGLLVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAP 389
           G +   VGDEAQSK GILTLKYPIE G+VTN DDMEKIWHHTFYN+LR+ P
Sbjct: 2   GQKDSYVGDEAQSKYGILTLKYPIEQGMVTNRDDMEKIWHHTFYNKLRLHP 52


>UniRef50_UPI0000449ED3 Cluster: PREDICTED: similar to RIKEN cDNA
           4921517D21 gene; n=2; Gallus gallus|Rep: PREDICTED:
           similar to RIKEN cDNA 4921517D21 gene - Gallus gallus
          Length = 321

 Score = 86.6 bits (205), Expect = 4e-16
 Identities = 35/64 (54%), Positives = 48/64 (75%)
 Frame = +3

Query: 306 IEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTP 485
           + HG+VT+WD +E++WH  FY+EL V PEE  VL T+APL+P  NREKM +++FE F  P
Sbjct: 48  LTHGVVTDWDRLEELWHRIFYHELAVCPEELAVLATDAPLSPIINREKMAELLFEGFGVP 107

Query: 486 AMYV 497
           A+ V
Sbjct: 108 AVLV 111



 Score = 37.1 bits (82), Expect = 0.33
 Identities = 14/31 (45%), Positives = 23/31 (74%)
 Frame = +1

Query: 103 EEVAALVVDNGSGMCKAGFAGDDAPRAVFPS 195
           +++ A+V+D G G  ++G AGD+ PR+V PS
Sbjct: 10  KDLCAVVIDTGMGHTRSGLAGDERPRSVAPS 40


>UniRef50_A0E1S8 Cluster: Chromosome undetermined scaffold_73, whole
           genome shotgun sequence; n=1; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_73,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 383

 Score = 86.6 bits (205), Expect = 4e-16
 Identities = 40/85 (47%), Positives = 56/85 (65%), Gaps = 1/85 (1%)
 Frame = +3

Query: 258 GDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPE-EHPVLLTEAPLNPK 434
           G+EA +K   L+LKYPI+ GI+ +WD +  I     +N+  +  E EHP+LLTE P+NP 
Sbjct: 56  GEEAMAKANALSLKYPIQRGIINDWDGIIYINMILIWNQFGIMQESEHPILLTEVPINPN 115

Query: 435 ANREKMTQIMFETFNTPAMYVAIQA 509
           ANREK  QI+FETF  P + +  +A
Sbjct: 116 ANREKTMQILFETFQAPLISLVNKA 140



 Score = 39.9 bits (89), Expect = 0.047
 Identities = 17/32 (53%), Positives = 22/32 (68%)
 Frame = +1

Query: 118 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPR 213
           +V+DNGS   KAGF G  AP    P++VGRP+
Sbjct: 11  IVIDNGSYELKAGFQGHYAPSCRIPTVVGRPK 42


>UniRef50_O96819 Cluster: Actin-related protein; n=5;
           Trypanosoma|Rep: Actin-related protein - Trypanosoma
           brucei
          Length = 433

 Score = 85.0 bits (201), Expect = 1e-15
 Identities = 34/81 (41%), Positives = 56/81 (69%)
 Frame = +3

Query: 255 VGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPK 434
           +GD A +KRG+LT+  PIE G V +W++MEK+W H  Y+ELRV PE H  ++ ++   P 
Sbjct: 57  IGDVALAKRGMLTVSSPIESGRVVSWENMEKLWGHVMYSELRVRPESHCFIVPQSVNTPA 116

Query: 435 ANREKMTQIMFETFNTPAMYV 497
           + +EK  ++M ETF+  ++++
Sbjct: 117 SQKEKTLELMMETFHVHSLFL 137



 Score = 49.2 bits (112), Expect = 8e-05
 Identities = 23/53 (43%), Positives = 33/53 (62%), Gaps = 1/53 (1%)
 Frame = +1

Query: 94  MCDEEVAALVV-DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKD 249
           +C  E A +V+ D GS   +AG+A D APR   P++VG PR++GV V  G  +
Sbjct: 2   VCSTERAPVVILDGGSHHLRAGYASDGAPRLDIPALVGHPRNRGVAVAAGMNE 54


>UniRef50_Q6X960 Cluster: HSD21; n=13; Theria|Rep: HSD21 - Homo
           sapiens (Human)
          Length = 416

 Score = 84.6 bits (200), Expect = 2e-15
 Identities = 35/74 (47%), Positives = 50/74 (67%)
 Frame = +3

Query: 288 LTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMF 467
           LTL  P+  GIV +WD  E IW H   ++LRVA  +HP+L ++ P +P  NREK+ ++ F
Sbjct: 108 LTLVQPLRSGIVVDWDAAELIWRHLLEHDLRVATHDHPLLSSDPPFSPATNREKLVEVAF 167

Query: 468 ETFNTPAMYVAIQA 509
           E+  +PAMYVA Q+
Sbjct: 168 ESLRSPAMYVASQS 181



 Score = 35.5 bits (78), Expect = 1.0
 Identities = 14/33 (42%), Positives = 21/33 (63%)
 Frame = +1

Query: 106 EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVG 204
           +  A+V+D G+G CK GFAG  +P     +I+G
Sbjct: 48  KTGAVVIDMGTGTCKVGFAGQASPTYTVATILG 80


>UniRef50_A7RPC3 Cluster: Predicted protein; n=3; Eumetazoa|Rep:
           Predicted protein - Nematostella vectensis
          Length = 64

 Score = 83.4 bits (197), Expect = 4e-15
 Identities = 38/46 (82%), Positives = 40/46 (86%)
 Frame = +1

Query: 115 ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 252
           ALV+D GS M K GFAGDDAP+ VFP IVGRPRHQGVMVGMGQKDS
Sbjct: 1   ALVIDVGSHMWKVGFAGDDAPKGVFPPIVGRPRHQGVMVGMGQKDS 46


>UniRef50_UPI0000E23780 Cluster: PREDICTED: hypothetical protein
           isoform 2; n=2; Amniota|Rep: PREDICTED: hypothetical
           protein isoform 2 - Pan troglodytes
          Length = 179

 Score = 83.0 bits (196), Expect = 5e-15
 Identities = 41/84 (48%), Positives = 52/84 (61%)
 Frame = -3

Query: 506 LDGDVHGGRVECFEHDXXXXXXXXXXXXXXXXEQDWVFLGGDTQLIVEGMMPNLLHVIPV 327
           LDG VHG  VE  +HD                +QD V LG  TQL+VEG++P+LLHV+PV
Sbjct: 37  LDGHVHGWGVEGLKHDLGHLLVVGLGVQGCLGQQDGVLLGSHTQLVVEGVVPDLLHVVPV 96

Query: 326 SDDSVFDGVFEGQDTSFALCLISY 255
            DD+V  GV +GQD S AL LI++
Sbjct: 97  GDDAVLHGVLQGQDASLALGLIAH 120



 Score = 46.8 bits (106), Expect = 4e-04
 Identities = 23/54 (42%), Positives = 29/54 (53%)
 Frame = -2

Query: 243 LSHTDHHALMAGPSHDRGEHGARSIISCETGLAHTGAIVYYQRGNFFVAHLELV 82
           L H  HHAL+ G  HD  E     II+C+ GLAH  A+V    G   + H EL+
Sbjct: 125 LMHAPHHALVPGAPHDGREDSPGGIITCKAGLAHARAVVNDGHGGIII-HGELI 177


>UniRef50_Q8LKR2 Cluster: Actin-related protein 4; n=7; core
           eudicotyledons|Rep: Actin-related protein 4 -
           Arabidopsis thaliana (Mouse-ear cress)
          Length = 442

 Score = 83.0 bits (196), Expect = 5e-15
 Identities = 37/85 (43%), Positives = 56/85 (65%), Gaps = 1/85 (1%)
 Frame = +3

Query: 249 LLVGDEAQS-KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPL 425
           L VG +A S +R  + +  PI+ GIV++WD ++ IW H F + L + P EHP+LL E PL
Sbjct: 76  LYVGSQAMSYRRDHMEVLSPIKDGIVSDWDLVDNIWEHAFKSCLMIDPTEHPMLLAEPPL 135

Query: 426 NPKANREKMTQIMFETFNTPAMYVA 500
           N +  REK  ++MFE +  PA+++A
Sbjct: 136 NTQQQREKAAELMFEKYKVPALFMA 160



 Score = 56.8 bits (131), Expect = 4e-07
 Identities = 23/34 (67%), Positives = 31/34 (91%)
 Frame = +1

Query: 103 EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVG 204
           +EV+A+VVD GS  CKAG+AG+DAP+AVFPS++G
Sbjct: 6   DEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSVIG 39


>UniRef50_A7S2B1 Cluster: Predicted protein; n=1; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 265

 Score = 83.0 bits (196), Expect = 5e-15
 Identities = 35/83 (42%), Positives = 52/83 (62%)
 Frame = +3

Query: 258 GDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 437
           GD A +K G++ L YP+    +  W D+  +W +  Y+EL +   EHP ++TE   N   
Sbjct: 52  GDAAVAKSGVMHLSYPMHADKLETWTDVVDLWEYLLYDELDIGEGEHPFIVTEIAKNHPK 111

Query: 438 NREKMTQIMFETFNTPAMYVAIQ 506
           NREK+T+I+FE F+ PAMY+A Q
Sbjct: 112 NREKLTEILFEQFSAPAMYLADQ 134



 Score = 49.6 bits (113), Expect = 6e-05
 Identities = 19/40 (47%), Positives = 29/40 (72%)
 Frame = +1

Query: 115 ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVG 234
           A+V+DNG G+ K GFAGD  PR + P++VG P+   +++G
Sbjct: 1   AIVLDNGCGISKIGFAGDRVPRIIQPAVVGNPQRFSMLIG 40


>UniRef50_Q14BL3 Cluster: RIKEN cDNA 4921517D21 gene; n=7;
            Eutheria|Rep: RIKEN cDNA 4921517D21 gene - Mus musculus
            (Mouse)
          Length = 1207

 Score = 80.6 bits (190), Expect = 3e-14
 Identities = 31/68 (45%), Positives = 49/68 (72%)
 Frame = +3

Query: 306  IEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTP 485
            +  G+V++WD +E +W H FY +L+V PEE  VL+ ++P++P+ NREK+ +I+FE F+ P
Sbjct: 914  LNRGVVSDWDALEVLWQHLFYCKLKVQPEEMAVLVADSPISPRTNREKVAEILFERFHVP 973

Query: 486  AMYVAIQA 509
            AM    QA
Sbjct: 974  AMQTVHQA 981


>UniRef50_A3BPG0 Cluster: Putative uncharacterized protein; n=3;
           Oryza sativa|Rep: Putative uncharacterized protein -
           Oryza sativa subsp. japonica (Rice)
          Length = 467

 Score = 80.6 bits (190), Expect = 3e-14
 Identities = 37/101 (36%), Positives = 56/101 (55%)
 Frame = +3

Query: 207 APPSGRDGRYGTEGLLVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVA 386
           A P   D       L VG E + +R  + +  P++ G VT+WD ++ IW+H F   L + 
Sbjct: 90  AKPMDVDKAKTKRKLYVGQELEFRRDHMEVISPMKDGTVTDWDIVDNIWNHAFRQRLLIN 149

Query: 387 PEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQA 509
           PEEHP+L+ E   N    REK  ++MFE +  PA+++A  A
Sbjct: 150 PEEHPMLIAEPSTNTGQQREKAAELMFEKYKVPALFLAKNA 190



 Score = 52.0 bits (119), Expect = 1e-05
 Identities = 21/32 (65%), Positives = 28/32 (87%)
 Frame = +1

Query: 103 EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSI 198
           +EV+A+V+D GS  CKAG+AGDD P+AVFPS+
Sbjct: 5   DEVSAIVIDVGSYSCKAGYAGDDTPKAVFPSL 36


>UniRef50_UPI00005A3B5D Cluster: PREDICTED: similar to Actin-5C; n=3;
            Laurasiatheria|Rep: PREDICTED: similar to Actin-5C -
            Canis familiaris
          Length = 1248

 Score = 79.8 bits (188), Expect = 5e-14
 Identities = 33/71 (46%), Positives = 49/71 (69%), Gaps = 1/71 (1%)
 Frame = +3

Query: 300  YPI-EHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETF 476
            YP+   G+V++WD +E +W H FY  L V PEE  VL+ ++P++P+ NREK+ +I+FE F
Sbjct: 952  YPVLNRGVVSDWDALEVLWQHLFYCRLGVRPEELAVLVADSPISPRTNREKVAEILFERF 1011

Query: 477  NTPAMYVAIQA 509
            + PAM    QA
Sbjct: 1012 HVPAMQTVHQA 1022



 Score = 33.5 bits (73), Expect = 4.1
 Identities = 15/38 (39%), Positives = 24/38 (63%)
 Frame = +1

Query: 103  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRH 216
            +++AA+V+D G+G  K G A +D   +V PS V   +H
Sbjct: 897  QDMAAVVIDTGTGFTKCGLAREDHVLSVLPSRVQLLQH 934



 Score = 33.1 bits (72), Expect = 5.4
 Identities = 18/39 (46%), Positives = 24/39 (61%)
 Frame = +2

Query: 500  HPSVLSLYASGRTTGIVLDFRRRGSSTPVPHFTKGIPPL 616
            H ++L+LYA GRTTG+VL     G+S   P  T  + PL
Sbjct: 1020 HQALLALYAYGRTTGLVLG-SGYGTSYVAPILTGDLAPL 1057


>UniRef50_Q54JL1 Cluster: Putative uncharacterized protein; n=1;
           Dictyostelium discoideum AX4|Rep: Putative
           uncharacterized protein - Dictyostelium discoideum AX4
          Length = 414

 Score = 79.0 bits (186), Expect = 8e-14
 Identities = 36/74 (48%), Positives = 51/74 (68%)
 Frame = +3

Query: 288 LTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMF 467
           L+L  P++ GIV+NW+DMEKI+    Y E +VAPEE  +LLTE PL  K +  K+ +IMF
Sbjct: 64  LSLTCPMKRGIVSNWEDMEKIYSRLLYYEFKVAPEESDILLTEPPLTSKNDHNKLIEIMF 123

Query: 468 ETFNTPAMYVAIQA 509
           ETF T ++ +  Q+
Sbjct: 124 ETFCTQSVSLLDQS 137


>UniRef50_UPI0000F2DE11 Cluster: PREDICTED: similar to
           testis-specific actin-related protein 3; n=1;
           Monodelphis domestica|Rep: PREDICTED: similar to
           testis-specific actin-related protein 3 - Monodelphis
           domestica
          Length = 939

 Score = 78.6 bits (185), Expect = 1e-13
 Identities = 30/65 (46%), Positives = 48/65 (73%)
 Frame = +3

Query: 315 GIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMY 494
           G+VT+WD +E +W+H FY++L V P+E  VL+ ++P++P+ NREK+ +++FE F  PAM 
Sbjct: 167 GVVTDWDALEVLWNHIFYSKLCVEPQELAVLVADSPVSPRTNREKVVELLFENFGVPAMQ 226

Query: 495 VAIQA 509
              QA
Sbjct: 227 TVHQA 231



 Score = 41.5 bits (93), Expect = 0.015
 Identities = 17/35 (48%), Positives = 25/35 (71%)
 Frame = +1

Query: 103 EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGR 207
           + +AA+V+D G+G  K G AG+D  RA+ P+ VGR
Sbjct: 106 KNLAAVVIDTGTGYSKCGLAGEDRTRAIVPTRVGR 140



 Score = 33.9 bits (74), Expect = 3.1
 Identities = 18/39 (46%), Positives = 24/39 (61%)
 Frame = +2

Query: 500 HPSVLSLYASGRTTGIVLDFRRRGSSTPVPHFTKGIPPL 616
           H ++LSLYA GRTTG+V+     G+S   P  T  + PL
Sbjct: 229 HQALLSLYAYGRTTGLVMG-SGHGTSYVAPIITGELAPL 266


>UniRef50_Q4QF44 Cluster: Actin-related protein 3, putative; n=3;
           Leishmania|Rep: Actin-related protein 3, putative -
           Leishmania major
          Length = 405

 Score = 78.6 bits (185), Expect = 1e-13
 Identities = 40/94 (42%), Positives = 53/94 (56%), Gaps = 1/94 (1%)
 Frame = +3

Query: 231 RYGTEGLLVGDEAQSKRGI-LTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVL 407
           R   E   VGD A +  G  +  + P+EHG+V NWD ME+ W H F   L V P++  VL
Sbjct: 43  RMSAETFAVGDAAATMVGPGVQQRRPLEHGLVVNWDVMEEYWCHLFNRYLCVEPQDVGVL 102

Query: 408 LTEAPLNPKANREKMTQIMFETFNTPAMYVAIQA 509
           LTEA + P   RE   +IMFE+F  P + +  QA
Sbjct: 103 LTEAAVTPYEQREMTAEIMFESFGVPRLCIGSQA 136


>UniRef50_UPI0000E47BC7 Cluster: PREDICTED: similar to ubiquitin/actin
            fusion protein; n=1; Strongylocentrotus purpuratus|Rep:
            PREDICTED: similar to ubiquitin/actin fusion protein -
            Strongylocentrotus purpuratus
          Length = 1608

 Score = 77.4 bits (182), Expect = 3e-13
 Identities = 39/93 (41%), Positives = 55/93 (59%), Gaps = 9/93 (9%)
 Frame = +3

Query: 255  VGDEAQSKRGILT---------LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVL 407
            VG+E   K G+LT         L+Y    G+V NW ++E IW H   +EL V  E+HP+L
Sbjct: 1281 VGNELTKKYGLLTYQIILNNSPLRYLPIGGVVDNWAELEHIWDHVVSHELNVKWEDHPIL 1340

Query: 408  LTEAPLNPKANREKMTQIMFETFNTPAMYVAIQ 506
            LTE    PK  RE++ +++FET+ TPA +V  Q
Sbjct: 1341 LTELASAPKRQRERILEVLFETYKTPACFVVNQ 1373



 Score = 35.9 bits (79), Expect = 0.77
 Identities = 14/30 (46%), Positives = 20/30 (66%)
 Frame = +1

Query: 118  LVVDNGSGMCKAGFAGDDAPRAVFPSIVGR 207
            +++DNGS M +AG A   AP    P++VGR
Sbjct: 1236 IILDNGSSMLRAGLADGVAPSVTMPTVVGR 1265


>UniRef50_Q75JT2 Cluster: Similar to Drosophila melanogaster (Fruit
           fly). RE12057p; n=4; Dictyostelium discoideum|Rep:
           Similar to Drosophila melanogaster (Fruit fly). RE12057p
           - Dictyostelium discoideum (Slime mold)
          Length = 414

 Score = 77.4 bits (182), Expect = 3e-13
 Identities = 39/84 (46%), Positives = 49/84 (58%)
 Frame = +3

Query: 342 EKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQACSRC 521
           +K W+H F ++L V+ ++HPV LTE P NPK N EKM Q MFE +  PAMYV+IQA    
Sbjct: 235 KKFWNHAFNDQLCVSSDQHPVFLTEPPFNPKVNTEKMAQYMFECYGIPAMYVSIQAILSL 294

Query: 522 TRPVVPPVSCWTSGDGGLPHPCPI 593
                       SG GG+ H  PI
Sbjct: 295 YASGRTTGIVIDSG-GGVSHTVPI 317


>UniRef50_Q8IS27 Cluster: Actin-related protein 2; n=5;
           Oligohymenophorea|Rep: Actin-related protein 2 -
           Tetrahymena thermophila
          Length = 393

 Score = 77.0 bits (181), Expect = 3e-13
 Identities = 41/115 (35%), Positives = 62/115 (53%)
 Frame = +3

Query: 249 LLVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLN 428
           +++G EA   + +L L  P+E G V NW DME +W ++F  +L    + + VL+TE  LN
Sbjct: 53  IMIGGEAAPYQAMLELTKPVEEGTVKNWQDMELLWDYSF-KKLGAETKGNTVLMTEPVLN 111

Query: 429 PKANREKMTQIMFETFNTPAMYVAIQACSRCTRPVVPPVSCWTSGDGGLPHPCPI 593
           P  NR+K  +++FE FN   M + IQA        +       SGD G+ H  P+
Sbjct: 112 PAQNRKKTAEVLFEQFNFGRMQIGIQALLSLYCEGLTTGMLLDSGD-GVTHCIPV 165



 Score = 38.7 bits (86), Expect = 0.11
 Identities = 14/31 (45%), Positives = 23/31 (74%)
 Frame = +1

Query: 118 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRP 210
           +V D+G+G  K G+AGD+ P+   P+++GRP
Sbjct: 7   IVCDSGTGYIKIGYAGDNFPKYSIPAMIGRP 37


>UniRef50_UPI00015B6274 Cluster: PREDICTED: similar to putative mRNA
           splicing factor; n=1; Nasonia vitripennis|Rep:
           PREDICTED: similar to putative mRNA splicing factor -
           Nasonia vitripennis
          Length = 515

 Score = 74.5 bits (175), Expect = 2e-12
 Identities = 38/84 (45%), Positives = 50/84 (59%)
 Frame = -3

Query: 506 LDGDVHGGRVECFEHDXXXXXXXXXXXXXXXXEQDWVFLGGDTQLIVEGMMPNLLHVIPV 327
           L+  VH  RVE  EHD                E++ +FL GD QL+VEG+MP+LLHVIPV
Sbjct: 363 LNSYVHSRRVERLEHDLRHLLSVGLRVERSLGEENGMFLWGDAQLVVEGVMPDLLHVIPV 422

Query: 326 SDDSVFDGVFEGQDTSFALCLISY 255
            D SV D +F  +DT+  L L++Y
Sbjct: 423 GDYSVLDRIFNREDTALGLGLVAY 446



 Score = 44.8 bits (101), Expect = 0.002
 Identities = 25/62 (40%), Positives = 37/62 (59%), Gaps = 10/62 (16%)
 Frame = -2

Query: 249 VLLSHTDHHAL----------MAGPSHDRGEHGARSIISCETGLAHTGAIVYYQRGNFFV 100
           VLL+H DH AL          +AGP+ D  + G+R +++ ET LAH+ +IV ++ G   V
Sbjct: 449 VLLAHADHDALWIKSMVDTHLIAGPADDGWKDGSRRVVAGETSLAHSRSIVNHESGYVVV 508

Query: 99  AH 94
           AH
Sbjct: 509 AH 510


>UniRef50_Q5CSX9 Cluster: Actin; n=2; Cryptosporidium|Rep: Actin -
           Cryptosporidium parvum Iowa II
          Length = 405

 Score = 74.5 bits (175), Expect = 2e-12
 Identities = 31/86 (36%), Positives = 57/86 (66%)
 Frame = +3

Query: 249 LLVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLN 428
           + VG+EA ++R  L+L +PI+HG + +W   E++ ++ FY  L + P +  V++T+ PL 
Sbjct: 66  IFVGEEAIAQRKKLSLTFPIDHGHIDDWTKFEELLNYLFYRGLDIDPIDSSVIITKPPLC 125

Query: 429 PKANREKMTQIMFETFNTPAMYVAIQ 506
              + EK+T++MFE F T ++ +A+Q
Sbjct: 126 SNRHEEKITELMFEMFQTQSLNIALQ 151



 Score = 35.5 bits (78), Expect = 1.0
 Identities = 16/36 (44%), Positives = 23/36 (63%)
 Frame = +1

Query: 118 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGV 225
           +V+D GS   KAG   D +P  +FPS+VG+ R + V
Sbjct: 22  IVIDCGSAYMKAGTDSDKSPTCIFPSMVGQYRSRYV 57


>UniRef50_Q4DMP2 Cluster: Actin-related protein 2, putative; n=4;
           Trypanosoma|Rep: Actin-related protein 2, putative -
           Trypanosoma cruzi
          Length = 403

 Score = 74.5 bits (175), Expect = 2e-12
 Identities = 33/86 (38%), Positives = 53/86 (61%)
 Frame = +3

Query: 249 LLVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLN 428
           ++ GDE    R +L + YPI +GI+ N D+M  +W +TF   L++ P EH +LL+E PL 
Sbjct: 67  IVFGDECSGVRHLLDMTYPIRNGIIQNMDEMCHLWDYTFGEMLQINPSEHRLLLSEVPLF 126

Query: 429 PKANREKMTQIMFETFNTPAMYVAIQ 506
              +R  + ++MFE +N  A+  A+Q
Sbjct: 127 SSKHRCHLYEVMFEKYNFMAIQSAVQ 152



 Score = 41.5 bits (93), Expect = 0.015
 Identities = 18/35 (51%), Positives = 24/35 (68%)
 Frame = +1

Query: 106 EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRP 210
           E   +V+DNGSG  K G+AG + P AVF + +GRP
Sbjct: 4   EKRPVVLDNGSGFIKCGYAGANFPTAVFQTALGRP 38


>UniRef50_UPI0000F2D272 Cluster: PREDICTED: similar to actin; n=1;
           Monodelphis domestica|Rep: PREDICTED: similar to actin -
           Monodelphis domestica
          Length = 790

 Score = 72.1 bits (169), Expect = 1e-11
 Identities = 34/86 (39%), Positives = 54/86 (62%)
 Frame = +3

Query: 252 LVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNP 431
           +VG E   +   +  ++ I+ G V NWD ME IW+++F + L +  + HPVL+TE P N 
Sbjct: 126 VVGLEKMRELKEMPNQFAIDRGRVLNWDAMEDIWYYSF-DYLGIKTKNHPVLITEFPRND 184

Query: 432 KANREKMTQIMFETFNTPAMYVAIQA 509
           +  R+K  +IM ETFN P++++  QA
Sbjct: 185 ENYRQKTLEIMMETFNVPSLHIGNQA 210



 Score = 49.6 bits (113), Expect = 6e-05
 Identities = 29/95 (30%), Positives = 49/95 (51%), Gaps = 1/95 (1%)
 Frame = +3

Query: 213 PSGRDGRYGTEG-LLVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAP 389
           PS R G   ++  LL G +       L  ++ I  G +TNW+ ME IW + F  EL    
Sbjct: 463 PSLRPGPSRSQAKLLTGSKNLPIMRDLRTEFVINRGTITNWEAMESIWRYIF-GELNSGS 521

Query: 390 EEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMY 494
            +HP+L+T  P+N +   + +T++    FN+  ++
Sbjct: 522 MDHPLLITGLPMNDEYCLQLVTELF--AFNSSFLF 554



 Score = 39.1 bits (87), Expect = 0.082
 Identities = 17/33 (51%), Positives = 22/33 (66%)
 Frame = +1

Query: 106 EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVG 204
           E + LVVD GS  CKAG+ G+  P  + PS+VG
Sbjct: 423 ERSCLVVDIGSACCKAGWCGEKFPPIIVPSVVG 455



 Score = 35.9 bits (79), Expect = 0.77
 Identities = 15/33 (45%), Positives = 22/33 (66%)
 Frame = +1

Query: 106 EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVG 204
           E +++V+D GS  CKAG A ++ P    PS+VG
Sbjct: 68  ESSSVVIDIGSAWCKAGLAMENYPTLAVPSVVG 100


>UniRef50_UPI0000EC9F4D Cluster: HSD21.; n=2; Gallus gallus|Rep:
           HSD21. - Gallus gallus
          Length = 373

 Score = 71.3 bits (167), Expect = 2e-11
 Identities = 32/87 (36%), Positives = 55/87 (63%)
 Frame = +3

Query: 246 GLLVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPL 425
           G+++G+EA     I T++  + +G + NW+  E + ++   +ELRV PE+H +LLTE   
Sbjct: 54  GVIIGEEALLYSDIETMEV-MHNGFIINWEAAENLCYYLLKHELRVNPEDHALLLTEPLF 112

Query: 426 NPKANREKMTQIMFETFNTPAMYVAIQ 506
           +P ++RE M ++ FE   TP ++VA Q
Sbjct: 113 SPTSSRENMAEMAFEVLGTPGLFVAPQ 139



 Score = 32.3 bits (70), Expect = 9.4
 Identities = 15/41 (36%), Positives = 25/41 (60%), Gaps = 1/41 (2%)
 Frame = +1

Query: 118 LVVDNGSGMCKAGFAGDDAPRAVFPSIVG-RPRHQGVMVGM 237
           +V+D G+  C+AGF+G  +P A   ++VG R   +G   G+
Sbjct: 15  IVIDMGTRSCRAGFSGHYSPSAEVSTLVGHRMGSEGASAGV 55


>UniRef50_UPI000049A548 Cluster: actin; n=1; Entamoeba histolytica
           HM-1:IMSS|Rep: actin - Entamoeba histolytica HM-1:IMSS
          Length = 365

 Score = 70.9 bits (166), Expect = 2e-11
 Identities = 35/85 (41%), Positives = 53/85 (62%)
 Frame = +3

Query: 255 VGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPK 434
           +GD A+  +  L L+ PI+ GI+ +W+D+E IW   F  EL+V   +  V+LT+A L P 
Sbjct: 45  IGDFARFSKD-LNLQQPIQRGIINDWNDIEDIWDFAF-EELQVESSDQVVMLTQAALTPP 102

Query: 435 ANREKMTQIMFETFNTPAMYVAIQA 509
            ++EKM QIMFE F    + V +Q+
Sbjct: 103 IHKEKMAQIMFEGFGMKGLDVMMQS 127



 Score = 42.3 bits (95), Expect = 0.009
 Identities = 15/41 (36%), Positives = 27/41 (65%)
 Frame = +1

Query: 118 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMG 240
           +++DNGSG+ KAG + ++ P+ VFP +VG  +    +  +G
Sbjct: 6   IIIDNGSGLIKAGESSEELPKIVFPCVVGHSKETNKLENIG 46


>UniRef50_Q9N4N4 Cluster: Putative uncharacterized protein; n=2;
           Caenorhabditis|Rep: Putative uncharacterized protein -
           Caenorhabditis elegans
          Length = 436

 Score = 70.1 bits (164), Expect = 4e-11
 Identities = 30/72 (41%), Positives = 45/72 (62%)
 Frame = +3

Query: 306 IEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTP 485
           ++ G++ +W+  EKI  H++ N L   P EHPVL +E+  N +A REK+T+IMFE F  P
Sbjct: 94  MKEGLIEDWELFEKIVEHSYENILYSNPSEHPVLFSESSWNDRARREKLTEIMFEKFQVP 153

Query: 486 AMYVAIQACSRC 521
           A Y++      C
Sbjct: 154 AYYLSKNVVLSC 165



 Score = 33.5 bits (73), Expect = 4.1
 Identities = 14/33 (42%), Positives = 21/33 (63%)
 Frame = +1

Query: 103 EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIV 201
           +EV+ LV D GS   + GFAG++ P+   PS +
Sbjct: 9   DEVSGLVFDAGSQSFRVGFAGEEYPKGDIPSYI 41


>UniRef50_A2DNQ0 Cluster: Actin family protein; n=1; Trichomonas
           vaginalis G3|Rep: Actin family protein - Trichomonas
           vaginalis G3
          Length = 358

 Score = 69.7 bits (163), Expect = 5e-11
 Identities = 26/66 (39%), Positives = 45/66 (68%)
 Frame = +3

Query: 291 TLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFE 470
           T + PIE+ ++TN+D+M++IW   F  +L++ PE+HP L+ ++ LN   NR++  QI  E
Sbjct: 56  TFRSPIENRVITNFDNMKRIWQELFTEQLQIQPEQHPFLVADSALNSLENRQQTLQIFME 115

Query: 471 TFNTPA 488
            +N P+
Sbjct: 116 EYNVPS 121



 Score = 33.5 bits (73), Expect = 4.1
 Identities = 14/26 (53%), Positives = 17/26 (65%)
 Frame = +1

Query: 118 LVVDNGSGMCKAGFAGDDAPRAVFPS 195
           +V+D G  + KAGF GD  P  VFPS
Sbjct: 6   IVLDCGGSIIKAGFGGDSEPGIVFPS 31


>UniRef50_O96019 Cluster: Actin-like protein 6A; n=63;
           Eumetazoa|Rep: Actin-like protein 6A - Homo sapiens
           (Human)
          Length = 429

 Score = 69.7 bits (163), Expect = 5e-11
 Identities = 27/65 (41%), Positives = 45/65 (69%)
 Frame = +3

Query: 303 PIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNT 482
           P+++G+V +WD  + I  HT+   ++     HPVL++EAP N +A REK+T++MFE +N 
Sbjct: 87  PLKNGMVEDWDSFQAILDHTYKMHVKSEASLHPVLMSEAPWNTRAKREKLTELMFEHYNI 146

Query: 483 PAMYV 497
           PA ++
Sbjct: 147 PAFFL 151



 Score = 40.7 bits (91), Expect = 0.027
 Identities = 17/34 (50%), Positives = 24/34 (70%)
 Frame = +1

Query: 103 EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVG 204
           +EV ALV D GS   +AG+AG+D P+  FP+ +G
Sbjct: 9   DEVGALVFDIGSYTVRAGYAGEDCPKVDFPTAIG 42


>UniRef50_Q19R57 Cluster: Actin-like protein 1; n=2; Trypanosoma
           cruzi|Rep: Actin-like protein 1 - Trypanosoma cruzi
           strain CL Brener
          Length = 390

 Score = 69.3 bits (162), Expect = 7e-11
 Identities = 33/80 (41%), Positives = 48/80 (60%)
 Frame = +3

Query: 252 LVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNP 431
           LVG EA  +    TL +PI HGIV +W  ME++ HHTF  E  +  EE  ++ TE    P
Sbjct: 55  LVGAEAIHEMHRATLHHPIRHGIVKDWPRMEQVIHHTFV-EFGMNSEETSIVCTEPLFTP 113

Query: 432 KANREKMTQIMFETFNTPAM 491
           K N E++ +++FE F  P++
Sbjct: 114 KRNSEQLAEVLFEAFGVPSI 133



 Score = 33.9 bits (74), Expect = 3.1
 Identities = 13/31 (41%), Positives = 20/31 (64%)
 Frame = +1

Query: 118 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRP 210
           ++VD GS + KAG   +  P  +FP++VG P
Sbjct: 2   IIVDFGSSLVKAGTVTESLPSLIFPAVVGVP 32


>UniRef50_Q7M3Y6 Cluster: Actin homolog fat, testicular; n=3;
           Deuterostomia|Rep: Actin homolog fat, testicular -
           Pisaster ochraceus (Sea star)
          Length = 155

 Score = 67.3 bits (157), Expect = 3e-10
 Identities = 37/59 (62%), Positives = 38/59 (64%)
 Frame = +3

Query: 417 APLNPKANREKMTQIMFETFNTPAMYVAIQACSRCTRPVVPPVSCWTSGDGGLPHPCPI 593
           APLNPKANREKMTQIMFETFNTPAMYV IQA                SGD G+ H  PI
Sbjct: 1   APLNPKANREKMTQIMFETFNTPAMYVGIQAVLSLYASGRTTGIVLDSGD-GVSHTVPI 58


>UniRef50_Q6FRF2 Cluster: Similar to sp|P38696 Saccharomyces
           cerevisiae YHR129c ACT5; n=1; Candida glabrata|Rep:
           Similar to sp|P38696 Saccharomyces cerevisiae YHR129c
           ACT5 - Candida glabrata (Yeast) (Torulopsis glabrata)
          Length = 387

 Score = 67.3 bits (157), Expect = 3e-10
 Identities = 28/81 (34%), Positives = 47/81 (58%), Gaps = 1/81 (1%)
 Frame = +3

Query: 255 VGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAP-EEHPVLLTEAPLNP 431
           +G+ A  +R  L L+ P     + +WD +E +W +   N+L +   +EHPV+LT +    
Sbjct: 59  IGNSAYERRATLHLESPYSTNAIMSWDRLEDLWDYVLLNKLEIEQLQEHPVVLTNSMSTS 118

Query: 432 KANREKMTQIMFETFNTPAMY 494
           K   EKM +++FE F+ PA+Y
Sbjct: 119 KKEEEKMCEVLFEKFSIPAIY 139



 Score = 36.7 bits (81), Expect = 0.44
 Identities = 16/45 (35%), Positives = 27/45 (60%)
 Frame = +1

Query: 118 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 252
           +++DNGS + KAGFAG   P  +  + +G P  +  MV +  K++
Sbjct: 13  VILDNGSSVIKAGFAGSQQPDVLEYAWIGNPLAERSMVTVSNKET 57


>UniRef50_Q6BG23 Cluster: Actin, putative; n=1; Paramecium
           tetraurelia|Rep: Actin, putative - Paramecium
           tetraurelia
          Length = 328

 Score = 66.5 bits (155), Expect = 5e-10
 Identities = 29/72 (40%), Positives = 42/72 (58%)
 Frame = +3

Query: 294 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 473
           +KYPI +  + ++D ME +WH  F+  L   PE+  +L+T      K  +EK TQIMFET
Sbjct: 21  IKYPILNSKIVDFDTMETVWHKAFFEYLMTNPEDSSILITSQLNTSKNEKEKTTQIMFET 80

Query: 474 FNTPAMYVAIQA 509
           FN     + IQ+
Sbjct: 81  FNISKFIIQIQS 92


>UniRef50_A2ECQ8 Cluster: Actin family protein; n=1; Trichomonas
           vaginalis G3|Rep: Actin family protein - Trichomonas
           vaginalis G3
          Length = 371

 Score = 66.1 bits (154), Expect = 6e-10
 Identities = 30/75 (40%), Positives = 44/75 (58%)
 Frame = +3

Query: 255 VGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPK 434
           VG+EA +K  +L L  PIE+G+V NW+   ++W   F N+     E+  +L  E P   +
Sbjct: 53  VGNEALAKENLLNLVNPIENGVVQNWEFQTQLWDELFANQFHCPLEDVCILTGEKPACTQ 112

Query: 435 ANREKMTQIMFETFN 479
            N+ KM QI+FE FN
Sbjct: 113 QNKAKMAQILFEKFN 127



 Score = 43.6 bits (98), Expect = 0.004
 Identities = 18/47 (38%), Positives = 28/47 (59%)
 Frame = +1

Query: 106 EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQK 246
           ++  +V+DNG+   KAGFAG   P  + P++VG  +    MVG+  K
Sbjct: 3   DMKTIVIDNGTFSVKAGFAGTKKPHFIIPTVVGTAKENADMVGIKNK 49


>UniRef50_Q9P7X7 Cluster: Actin-related protein 4; n=1;
           Schizosaccharomyces pombe|Rep: Actin-related protein 4 -
           Schizosaccharomyces pombe (Fission yeast)
          Length = 433

 Score = 63.7 bits (148), Expect = 3e-09
 Identities = 34/94 (36%), Positives = 48/94 (51%), Gaps = 1/94 (1%)
 Frame = +3

Query: 228 GRYGTEGLLVGDEAQSKRGI-LTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPV 404
           G +     L G+E   K    + +K  I +G V NWD    +W +    +L+  P EHP+
Sbjct: 42  GEFSDGRRLFGEEYIYKSNPGMEIKNAIRNGWVENWDVTVDLWRYGLEQQLKTNPLEHPI 101

Query: 405 LLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQ 506
           L+TE   NP  NR K  + MFE+   PA Y+A Q
Sbjct: 102 LITEPFDNPPENRVKTLETMFESLRCPATYLAKQ 135



 Score = 40.3 bits (90), Expect = 0.036
 Identities = 16/34 (47%), Positives = 24/34 (70%)
 Frame = +1

Query: 103 EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVG 204
           +EV+A+V+D GS   + GF+G+D P+ V PS  G
Sbjct: 9   DEVSAIVIDPGSKWTRIGFSGEDIPKCVLPSYCG 42


>UniRef50_Q9Y7X8 Cluster: Actin-like protein Arp5; n=1;
           Schizosaccharomyces pombe|Rep: Actin-like protein Arp5 -
           Schizosaccharomyces pombe (Fission yeast)
          Length = 721

 Score = 63.3 bits (147), Expect = 4e-09
 Identities = 31/95 (32%), Positives = 54/95 (56%), Gaps = 1/95 (1%)
 Frame = +3

Query: 222 RDGRYGTEGLLVGDEAQSKRGILTL-KYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEH 398
           RD +      LVG++   + G  ++ + P E  +++NWD ME++  +TF  +L +   EH
Sbjct: 58  RDRKLSRTSTLVGNDTLIEVGSRSIARSPFERNVISNWDLMEQVLDYTFL-KLGIDRMEH 116

Query: 399 PVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAI 503
           P+ +TE   NP   R  MT+++FE +N P++   I
Sbjct: 117 PICMTEPLANPTYVRSTMTELLFELYNAPSVAYGI 151



 Score = 35.9 bits (79), Expect = 0.77
 Identities = 15/32 (46%), Positives = 22/32 (68%)
 Frame = +1

Query: 118 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPR 213
           LV+DNGS   +AG+ G+  P+ VF ++V R R
Sbjct: 27  LVIDNGSWQLRAGWGGEKDPKLVFDNLVSRYR 58


>UniRef50_Q9H568 Cluster: Actin-like protein 8; n=10; Eutheria|Rep:
           Actin-like protein 8 - Homo sapiens (Human)
          Length = 366

 Score = 62.9 bits (146), Expect = 6e-09
 Identities = 28/72 (38%), Positives = 43/72 (59%)
 Frame = +3

Query: 291 TLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFE 470
           T  YPIE G + NW+ ++ +W     N  R   E  PV++TE PL   A+R+KM +I+FE
Sbjct: 62  TFSYPIERGRILNWEGVQYLWSFVLENHRR-EQEVPPVIITETPLREPADRKKMLEILFE 120

Query: 471 TFNTPAMYVAIQ 506
             + P++ +A Q
Sbjct: 121 LLHVPSVLLADQ 132



 Score = 36.7 bits (81), Expect = 0.44
 Identities = 15/28 (53%), Positives = 22/28 (78%)
 Frame = +1

Query: 118 LVVDNGSGMCKAGFAGDDAPRAVFPSIV 201
           +++D+GSG  KAG AG + P+ VFP+IV
Sbjct: 6   VIIDHGSGFLKAGTAGWNEPQMVFPNIV 33


>UniRef50_Q5C683 Cluster: SJCHGC08418 protein; n=1; Schistosoma
           japonicum|Rep: SJCHGC08418 protein - Schistosoma
           japonicum (Blood fluke)
          Length = 106

 Score = 61.7 bits (143), Expect = 1e-08
 Identities = 27/57 (47%), Positives = 38/57 (66%)
 Frame = +3

Query: 255 VGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPL 425
           VG+ A + R  L L  PI +GIVT+ D +  +W++ F  ELR +PE HPVL++E PL
Sbjct: 50  VGEHANAIRNELILNCPIANGIVTDIDGLSLVWYYMFMKELRTSPENHPVLISEYPL 106



 Score = 47.2 bits (107), Expect = 3e-04
 Identities = 18/32 (56%), Positives = 25/32 (78%)
 Frame = +1

Query: 118 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPR 213
           +VVDNG+G  KAG+AGD  PR + P ++GRP+
Sbjct: 9   IVVDNGAGHLKAGYAGDGGPRILVPMLIGRPK 40


>UniRef50_A4RW28 Cluster: Predicted protein; n=2; Ostreococcus|Rep:
           Predicted protein - Ostreococcus lucimarinus CCE9901
          Length = 425

 Score = 61.3 bits (142), Expect = 2e-08
 Identities = 26/64 (40%), Positives = 40/64 (62%)
 Frame = +3

Query: 309 EHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPA 488
           E+G++ +W+ +E IW H     L +  +EHPVLL+E   N  A R KM ++MFE    PA
Sbjct: 80  ENGMLEDWEAVEAIWEHALKKRLALQTDEHPVLLSEPVHNSDAVRAKMVELMFEKHAPPA 139

Query: 489 MYVA 500
           +++A
Sbjct: 140 LFLA 143



 Score = 44.4 bits (100), Expect = 0.002
 Identities = 19/34 (55%), Positives = 26/34 (76%)
 Frame = +1

Query: 103 EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVG 204
           +EV+A+V+D G+   KAG+AG D P+ VFPS VG
Sbjct: 5   DEVSAVVIDLGTHSVKAGYAGQDTPQHVFPSAVG 38


>UniRef50_Q8IIQ4 Cluster: Actin, putative; n=7; Apicomplexa|Rep:
           Actin, putative - Plasmodium falciparum (isolate 3D7)
          Length = 392

 Score = 60.5 bits (140), Expect = 3e-08
 Identities = 30/81 (37%), Positives = 48/81 (59%)
 Frame = +3

Query: 240 TEGLLVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEA 419
           T+ +  GDEA      L +  PI+HG +++WD  +K+W +T  N +  +     +LLTE 
Sbjct: 41  TKRIYTGDEAFFHESNLNIYRPIDHGHISDWDKAQKVWDYTL-NCVDPSKSIKDILLTEP 99

Query: 420 PLNPKANREKMTQIMFETFNT 482
           PL   ++R+KM +I FE F+T
Sbjct: 100 PLCSISHRKKMGEIFFEYFDT 120



 Score = 39.1 bits (87), Expect = 0.082
 Identities = 17/33 (51%), Positives = 21/33 (63%)
 Frame = +1

Query: 106 EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVG 204
           E   +V+DNGSG  KAG    + P  VFP+IVG
Sbjct: 2   ENKTIVIDNGSGYIKAGINSSEEPTIVFPTIVG 34


>UniRef50_Q4Q187 Cluster: Actin-like protein, putative; n=3;
           Leishmania|Rep: Actin-like protein, putative -
           Leishmania major
          Length = 407

 Score = 60.5 bits (140), Expect = 3e-08
 Identities = 26/79 (32%), Positives = 45/79 (56%)
 Frame = +3

Query: 249 LLVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLN 428
           +  GD A +  G+L+L YP+  G V ++D +EK+  +    E RV P+  P L       
Sbjct: 57  IATGDAAYNDGGLLSLTYPVRAGHVCDYDALEKLLFYALVEEARVTPDTSPFLFLVPADQ 116

Query: 429 PKANREKMTQIMFETFNTP 485
            + +RE++ +++FE+FN P
Sbjct: 117 TRLDRERLCELLFESFNIP 135



 Score = 34.3 bits (75), Expect = 2.3
 Identities = 14/34 (41%), Positives = 23/34 (67%)
 Frame = +1

Query: 109 VAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRP 210
           + ++VVD G+   + GF+G++APR +  S VG P
Sbjct: 8   IQSVVVDVGTRNTRVGFSGEEAPRTMLRSCVGLP 41


>UniRef50_Q4N7N1 Cluster: Actin, putative; n=2; Theileria|Rep:
           Actin, putative - Theileria parva
          Length = 383

 Score = 60.5 bits (140), Expect = 3e-08
 Identities = 29/88 (32%), Positives = 49/88 (55%)
 Frame = +3

Query: 240 TEGLLVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEA 419
           TE     ++  S    ++L + I+HG ++++D ME +W + F   L V  +  PVLLTEA
Sbjct: 46  TEDFYYAEDVYSSLEFMSLDHLIDHGHISDFDKMEGLWQYCF-TRLEVHSDCRPVLLTEA 104

Query: 420 PLNPKANREKMTQIMFETFNTPAMYVAI 503
           P     +R K ++I FE FN   + +++
Sbjct: 105 PFTSPKHRIKSSEIFFERFNVDDLNISV 132



 Score = 35.5 bits (78), Expect = 1.0
 Identities = 17/40 (42%), Positives = 24/40 (60%)
 Frame = +1

Query: 94  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPR 213
           M DE+   +V+DNGS   K G +G  +P  +  S+VG PR
Sbjct: 1   MADEQ--CVVIDNGSFSLKIGLSGSYSPSFIVHSVVGNPR 38


>UniRef50_Q6C061 Cluster: Actin-related protein 4; n=1; Yarrowia
           lipolytica|Rep: Actin-related protein 4 - Yarrowia
           lipolytica (Candida lipolytica)
          Length = 432

 Score = 59.7 bits (138), Expect = 5e-08
 Identities = 29/85 (34%), Positives = 46/85 (54%)
 Frame = +3

Query: 255 VGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPK 434
           VGD A      + + +P+  GIV +WD ++ IW ++    L    + HP++LTE   N +
Sbjct: 72  VGDSANLPLPNMEVLHPLTDGIVADWDAVQNIWEYSLAR-LNADTKTHPLMLTEPCWNTQ 130

Query: 435 ANREKMTQIMFETFNTPAMYVAIQA 509
           AN+ K  +I FE+   PA Y+   A
Sbjct: 131 ANKLKALEIAFESLEVPASYLVKDA 155



 Score = 37.1 bits (82), Expect = 0.33
 Identities = 15/34 (44%), Positives = 22/34 (64%)
 Frame = +1

Query: 103 EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVG 204
           +EVA LV+D GS   + G+AG+D P+ V  +  G
Sbjct: 14  DEVATLVIDTGSSYTRVGYAGEDTPKLVVSTECG 47


>UniRef50_A2DEE0 Cluster: Actin family protein; n=1; Trichomonas
           vaginalis G3|Rep: Actin family protein - Trichomonas
           vaginalis G3
          Length = 378

 Score = 58.8 bits (136), Expect = 9e-08
 Identities = 27/83 (32%), Positives = 53/83 (63%), Gaps = 1/83 (1%)
 Frame = +3

Query: 255 VGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLN-P 431
           VG EA  K    +L  P ++G +TN DD+E+++H+ F  E+ + PE+  V+++  PLN P
Sbjct: 61  VGQEAIEKSDPNSLYNPFKNGYITNPDDIERLFHYIFEKEIHINPEKKSVIIS-TPLNGP 119

Query: 432 KANREKMTQIMFETFNTPAMYVA 500
           ++ R  + +I+FE +   +++++
Sbjct: 120 QSQRNIIAEILFEKYKIGSLHIS 142


>UniRef50_Q5C3R3 Cluster: SJCHGC08022 protein; n=1; Schistosoma
           japonicum|Rep: SJCHGC08022 protein - Schistosoma
           japonicum (Blood fluke)
          Length = 209

 Score = 58.0 bits (134), Expect = 2e-07
 Identities = 31/86 (36%), Positives = 53/86 (61%), Gaps = 2/86 (2%)
 Frame = +3

Query: 240 TEGLLVGDEAQSKRGIL-TLKYPIEHGIVTNWDDMEKIWHHTFYNELRVA-PEEHPVLLT 413
           ++G+LVG++ Q    +  +LK P    +V N D  E++  H F ++L V  P  +PV++ 
Sbjct: 72  SKGVLVGNDIQDLESVRHSLKSPFIDNLVINLDVQEQVISHIF-DKLNVQKPLSNPVVIN 130

Query: 414 EAPLNPKANREKMTQIMFETFNTPAM 491
           EA  NP   R ++T+++FE+FNTP +
Sbjct: 131 EALCNPGVCRSQLTELLFESFNTPKL 156



 Score = 44.0 bits (99), Expect = 0.003
 Identities = 19/45 (42%), Positives = 31/45 (68%), Gaps = 1/45 (2%)
 Frame = +1

Query: 118 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPR-HQGVMVGMGQKD 249
           +V+DNG+  C+AG++  + P   FP++V RPR  +GV+VG   +D
Sbjct: 39  IVIDNGNFECRAGYSNFEKPHMTFPNVVYRPRMSKGVLVGNDIQD 83


>UniRef50_Q19R56 Cluster: Actin-like protein 3; n=4; Trypanosoma
           cruzi|Rep: Actin-like protein 3 - Trypanosoma cruzi
           strain CL Brener
          Length = 426

 Score = 58.0 bits (134), Expect = 2e-07
 Identities = 30/90 (33%), Positives = 47/90 (52%)
 Frame = +3

Query: 234 YGTEGLLVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLT 413
           +G + + VG +A  +RG+L L YPI+HGI+ NWD  + +       +L  +  E  V   
Sbjct: 44  HGCDVVSVGKDAAERRGLLHLTYPIQHGIIVNWDVWQLLLQQ-IEQQLDASLAEKSVFWV 102

Query: 414 EAPLNPKANREKMTQIMFETFNTPAMYVAI 503
           E P + +  R ++ QI+FE      M V I
Sbjct: 103 EHPFSSRPQRARVAQILFEEKGIFGMCVGI 132


>UniRef50_Q9LZY1 Cluster: Actin-like protein; n=4; core
           eudicotyledons|Rep: Actin-like protein - Arabidopsis
           thaliana (Mouse-ear cress)
          Length = 368

 Score = 57.2 bits (132), Expect = 3e-07
 Identities = 28/70 (40%), Positives = 39/70 (55%), Gaps = 1/70 (1%)
 Frame = +3

Query: 303 PIEHGIVTNWDDMEKIWHHTFYNELRVAP-EEHPVLLTEAPLNPKANREKMTQIMFETFN 479
           PIE G++ +WD ME +  +  Y  L      E  +L T+    PKA RE++ Q+MFETFN
Sbjct: 57  PIERGLIRDWDAMEDLLRYVVYTGLGWEEGNEGNILFTDPLCTPKAIREQLVQLMFETFN 116

Query: 480 TPAMYVAIQA 509
               Y + QA
Sbjct: 117 VSGFYASEQA 126


>UniRef50_A7QZ13 Cluster: Chromosome undetermined scaffold_261,
           whole genome shotgun sequence; n=1; Vitis vinifera|Rep:
           Chromosome undetermined scaffold_261, whole genome
           shotgun sequence - Vitis vinifera (Grape)
          Length = 232

 Score = 55.2 bits (127), Expect = 1e-06
 Identities = 27/70 (38%), Positives = 40/70 (57%), Gaps = 2/70 (2%)
 Frame = +3

Query: 303 PIEHGIVTNWDDMEKIWHHTFYNELR--VAPEEHPVLLTEAPLNPKANREKMTQIMFETF 476
           P+  G++ +WD ME + +H  Y  LR  +  E H +L T+    PKA RE++ Q+MFE F
Sbjct: 99  PVVRGLIRDWDTMEDLLNHVLYTGLRWEMGNEGH-ILFTDPLSTPKAFREQLVQLMFEIF 157

Query: 477 NTPAMYVAIQ 506
           N    Y + Q
Sbjct: 158 NISDFYASEQ 167


>UniRef50_Q9VEC3 Cluster: Actin-related protein 5; n=1; Drosophila
           melanogaster|Rep: Actin-related protein 5 - Drosophila
           melanogaster (Fruit fly)
          Length = 648

 Score = 55.2 bits (127), Expect = 1e-06
 Identities = 25/74 (33%), Positives = 43/74 (58%), Gaps = 2/74 (2%)
 Frame = +3

Query: 294 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPE--EHPVLLTEAPLNPKANREKMTQIMF 467
           LK P E  ++TNW+  E+I+ + F        +  +HP++LTEA  NP   R++M +++F
Sbjct: 79  LKSPFERNVITNWNHQEQIFDYIFTKMGFDGQDKIDHPIILTEALANPNFCRQQMNELLF 138

Query: 468 ETFNTPAMYVAIQA 509
           E +  P++   I A
Sbjct: 139 ECYGIPSVSYGIDA 152


>UniRef50_Q9SRK2 Cluster: Putative actin; n=1; Arabidopsis
           thaliana|Rep: Putative actin - Arabidopsis thaliana
           (Mouse-ear cress)
          Length = 378

 Score = 54.8 bits (126), Expect = 2e-06
 Identities = 24/69 (34%), Positives = 41/69 (59%)
 Frame = +3

Query: 294 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 473
           ++ PI+ G + N D   +IW H F + L +AP    +LLTEAPL+  + +    +++FE 
Sbjct: 61  VRRPIDRGYLINSDLQREIWSHLFTSLLHIAPSSSSLLLTEAPLSIPSVQRTTDELVFED 120

Query: 474 FNTPAMYVA 500
           F   ++Y+A
Sbjct: 121 FGFSSLYIA 129



 Score = 32.7 bits (71), Expect = 7.1
 Identities = 13/31 (41%), Positives = 20/31 (64%)
 Frame = +1

Query: 118 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRP 210
           +V+DNG G+ KAG  G+  P  V P+ + +P
Sbjct: 5   VVLDNGGGLIKAGQGGERDPTTVIPNCLYKP 35


>UniRef50_Q8LKR0 Cluster: Actin-related protein 6; n=26;
           Magnoliophyta|Rep: Actin-related protein 6 - Arabidopsis
           thaliana (Mouse-ear cress)
          Length = 422

 Score = 54.8 bits (126), Expect = 2e-06
 Identities = 24/69 (34%), Positives = 41/69 (59%)
 Frame = +3

Query: 294 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 473
           ++ PI+ G + N D   +IW H F + L +AP    +LLTEAPL+  + +    +++FE 
Sbjct: 62  VRRPIDRGYLINSDLQREIWSHLFTSLLHIAPSSSSLLLTEAPLSIPSVQRTTDELVFED 121

Query: 474 FNTPAMYVA 500
           F   ++Y+A
Sbjct: 122 FGFSSLYIA 130


>UniRef50_UPI0000F2D271 Cluster: PREDICTED: similar to actin-like 8;
           n=1; Monodelphis domestica|Rep: PREDICTED: similar to
           actin-like 8 - Monodelphis domestica
          Length = 370

 Score = 54.4 bits (125), Expect = 2e-06
 Identities = 24/70 (34%), Positives = 42/70 (60%)
 Frame = +3

Query: 288 LTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMF 467
           L  ++PI  G V NW+ ME +  + F   L +  E+H +L+T    +  ++R K+ ++M 
Sbjct: 63  LPTEFPIVRGQVKNWEAMETVLTYAF-ESLGIKTEDHAILVTGFLSHRASHRMKLLEVMM 121

Query: 468 ETFNTPAMYV 497
           ETFN P++Y+
Sbjct: 122 ETFNVPSLYI 131


>UniRef50_Q383R8 Cluster: Actin-like protein, putative; n=4;
           Trypanosoma|Rep: Actin-like protein, putative -
           Trypanosoma brucei
          Length = 394

 Score = 54.4 bits (125), Expect = 2e-06
 Identities = 23/78 (29%), Positives = 44/78 (56%)
 Frame = +3

Query: 258 GDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 437
           GD A ++ G+L L YP+ +  +T+  ++E      FY+ L + P    +L  E+    + 
Sbjct: 57  GDAACAQEGMLNLSYPVRNRRITSMPEVEHFLQDVFYSRLPLVPSNTMMLWVESVRTSRE 116

Query: 438 NREKMTQIMFETFNTPAM 491
           +RE++ ++MFE+F  P +
Sbjct: 117 DRERLCEMMFESFGLPQL 134



 Score = 41.9 bits (94), Expect = 0.012
 Identities = 17/47 (36%), Positives = 30/47 (63%)
 Frame = +1

Query: 103 EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQ 243
           ++   +V D GS   + GFAG++APR +  ++VG PR +G++  + Q
Sbjct: 3   QQQPVVVFDMGSNKTRVGFAGEEAPRVISSTVVGVPRQRGLVGSLMQ 49


>UniRef50_Q293V2 Cluster: Actin-related protein 5; n=2; Drosophila
           pseudoobscura|Rep: Actin-related protein 5 - Drosophila
           pseudoobscura (Fruit fly)
          Length = 651

 Score = 54.4 bits (125), Expect = 2e-06
 Identities = 27/75 (36%), Positives = 45/75 (60%), Gaps = 3/75 (4%)
 Frame = +3

Query: 294 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEE---HPVLLTEAPLNPKANREKMTQIM 464
           LK P E  I+TNW+  E+I+ + F  ++    E+   +P++LTEA  NP   R+ M++++
Sbjct: 82  LKSPFERNIITNWNHQEQIFDYIF-TKMGFEGEQSIANPIVLTEALANPNFCRQNMSELL 140

Query: 465 FETFNTPAMYVAIQA 509
           FE +  PA+   I A
Sbjct: 141 FECYGIPAVSYGIDA 155


>UniRef50_Q4P303 Cluster: Putative uncharacterized protein; n=1;
           Ustilago maydis|Rep: Putative uncharacterized protein -
           Ustilago maydis (Smut fungus)
          Length = 1173

 Score = 53.6 bits (123), Expect = 4e-06
 Identities = 29/96 (30%), Positives = 51/96 (53%), Gaps = 2/96 (2%)
 Frame = +3

Query: 222 RDGRYGTEGLLVGDEAQSKR-GILTLKYPIEHGIVTNWDDMEKIWHHTFYN-ELRVAPEE 395
           RD +     LLVG++  +      +++ P +  +VT+WD ME +  +TF N  +     +
Sbjct: 464 RDRKKSFTMLLVGNDVYADGLSRSSIRSPFDTDVVTSWDAMEIVLDYTFSNLGIDTDRVQ 523

Query: 396 HPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAI 503
           HP+ +TE   NP  +R  M ++MFE +  P++   I
Sbjct: 524 HPICMTETLCNPAYSRGIMNELMFEAYQVPSVNYGI 559


>UniRef50_Q22WQ4 Cluster: Actin family protein; n=1; Tetrahymena
           thermophila SB210|Rep: Actin family protein -
           Tetrahymena thermophila SB210
          Length = 444

 Score = 52.8 bits (121), Expect = 6e-06
 Identities = 22/70 (31%), Positives = 40/70 (57%)
 Frame = +3

Query: 312 HGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAM 491
           +G V +WD  EK+    + N++RV P E+ +L++E+ L+ +  REK+ Q+ FE+   P  
Sbjct: 101 NGEVKDWDAFEKLLLDVYENQIRVQPSEYCLLISESSLHNQRQREKICQLAFESLKVPNF 160

Query: 492 YVAIQACSRC 521
           ++       C
Sbjct: 161 FIVKSGVLSC 170



 Score = 43.2 bits (97), Expect = 0.005
 Identities = 19/37 (51%), Positives = 26/37 (70%)
 Frame = +1

Query: 94  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVG 204
           M  E++ A+VVD GS   +AG++G+D PR V PS VG
Sbjct: 1   MFTEDITAIVVDPGSLSIRAGYSGEDTPRLVMPSQVG 37


>UniRef50_UPI0000498A93 Cluster: actin; n=1; Entamoeba histolytica
           HM-1:IMSS|Rep: actin - Entamoeba histolytica HM-1:IMSS
          Length = 360

 Score = 52.4 bits (120), Expect = 8e-06
 Identities = 23/77 (29%), Positives = 39/77 (50%)
 Frame = +3

Query: 264 EAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANR 443
           E+     I    YPI  G++++ DD+E I    F   + V     P+++TE  L P   +
Sbjct: 45  ESVFNNNIKDYHYPINRGMISDCDDIEGILRFVFDENMGVDASTRPIIVTEEALCPNLRK 104

Query: 444 EKMTQIMFETFNTPAMY 494
           ++  ++ FE F TP +Y
Sbjct: 105 QEYGELFFEKFETPGLY 121


>UniRef50_Q6C0A9 Cluster: Yarrowia lipolytica chromosome F of strain
           CLIB122 of Yarrowia lipolytica; n=1; Yarrowia
           lipolytica|Rep: Yarrowia lipolytica chromosome F of
           strain CLIB122 of Yarrowia lipolytica - Yarrowia
           lipolytica (Candida lipolytica)
          Length = 427

 Score = 52.4 bits (120), Expect = 8e-06
 Identities = 20/64 (31%), Positives = 39/64 (60%), Gaps = 1/64 (1%)
 Frame = +3

Query: 303 PIEHGIVTNWDDMEKIWHHTFYNELRVAP-EEHPVLLTEAPLNPKANREKMTQIMFETFN 479
           P++ G + +WD + K+W +    +L+V    E+P+++TE   N  A R K+ ++ F+ F 
Sbjct: 81  PVQDGCIQDWDGVAKLWEYAIKEKLKVDDLSEYPLVITEQMWNSSARRAKIAEMCFDKFR 140

Query: 480 TPAM 491
           +PA+
Sbjct: 141 SPAI 144



 Score = 38.3 bits (85), Expect = 0.14
 Identities = 14/35 (40%), Positives = 24/35 (68%)
 Frame = +1

Query: 103 EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGR 207
           +EV ++V++ GS   + GF+GDD P+ V P+  G+
Sbjct: 18  DEVTSIVIECGSSYTRVGFSGDDLPKVVIPTKYGK 52


>UniRef50_UPI0000E46266 Cluster: PREDICTED: similar to actin; n=1;
           Strongylocentrotus purpuratus|Rep: PREDICTED: similar to
           actin - Strongylocentrotus purpuratus
          Length = 341

 Score = 52.0 bits (119), Expect = 1e-05
 Identities = 20/60 (33%), Positives = 36/60 (60%)
 Frame = +3

Query: 321 VTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVA 500
           VT+WD  E+I  H  + + ++   +HP++L E P   ++ R+KM ++ FE  + P  Y+A
Sbjct: 61  VTDWDSFEQIIQHAIWTKSKIKSSDHPLVLIEKPGLERSCRQKMVELAFEGLDVPEFYLA 120


>UniRef50_Q5KLG9 Cluster: 53 kDa brg1-associated factor b
           (Actin-related protein baf53b), putative; n=1;
           Filobasidiella neoformans|Rep: 53 kDa brg1-associated
           factor b (Actin-related protein baf53b), putative -
           Cryptococcus neoformans (Filobasidiella neoformans)
          Length = 476

 Score = 52.0 bits (119), Expect = 1e-05
 Identities = 30/100 (30%), Positives = 51/100 (51%)
 Frame = +3

Query: 195 DRGKAPPSGRDGRYGTEGLLVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNE 374
           ++ K   SGR    G +G+ V      + G+    + ++ G+V + +    + HH  +  
Sbjct: 79  EQSKKKGSGRKYYVGEDGVSVW-----RPGMEVGNFMLD-GVVNDPEPASALLHHILHER 132

Query: 375 LRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMY 494
           L V PEEHP+++TE   N    R+ MT++ FE    PA+Y
Sbjct: 133 LGVNPEEHPIMITEPAWNTPKARQVMTEMAFEGEKMPALY 172



 Score = 42.7 bits (96), Expect = 0.007
 Identities = 19/34 (55%), Positives = 25/34 (73%)
 Frame = +1

Query: 103 EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVG 204
           +EV+ALV+D GS   +AG+AG+D PR V PS  G
Sbjct: 6   DEVSALVLDFGSYTTRAGYAGEDCPRVVCPSFYG 39


>UniRef50_Q0V0G6 Cluster: Putative uncharacterized protein; n=1;
           Phaeosphaeria nodorum|Rep: Putative uncharacterized
           protein - Phaeosphaeria nodorum (Septoria nodorum)
          Length = 443

 Score = 52.0 bits (119), Expect = 1e-05
 Identities = 28/91 (30%), Positives = 41/91 (45%), Gaps = 5/91 (5%)
 Frame = +3

Query: 282 GILTLKYPIEHGIVTNWDDMEKIWHHTFYNE-----LRVAPEEHPVLLTEAPLNPKANRE 446
           G L  + P+E G + NW+  + IW H F         R  P+E  +LLTE P  PK  ++
Sbjct: 73  GELAFRRPVEKGFIVNWEAEKAIWEHEFMEAAVVEGFRCDPKETNLLLTEKPNCPKELQK 132

Query: 447 KMTQIMFETFNTPAMYVAIQACSRCTRPVVP 539
              +I+FE F   + Y  +        P  P
Sbjct: 133 NCDEIVFEQFEFASYYRCVGPRLNAYHPASP 163


>UniRef50_UPI0000D56C2F Cluster: PREDICTED: similar to Actin-57B;
           n=1; Tribolium castaneum|Rep: PREDICTED: similar to
           Actin-57B - Tribolium castaneum
          Length = 291

 Score = 51.6 bits (118), Expect = 1e-05
 Identities = 26/46 (56%), Positives = 33/46 (71%), Gaps = 2/46 (4%)
 Frame = +3

Query: 366 YNELRVAPEEHPVLLTEAPLNP--KANREKMTQIMFETFNTPAMYV 497
           Y +L+VAPE HPVLLT+ P  P  KA  EK+ QIMFE F  PA+++
Sbjct: 14  YKQLKVAPENHPVLLTK-PYFPISKATTEKIAQIMFEDFKIPALHL 58


>UniRef50_Q00UL2 Cluster: Alpha amylase 1; n=3; Ostreococcus|Rep:
           Alpha amylase 1 - Ostreococcus tauri
          Length = 913

 Score = 51.6 bits (118), Expect = 1e-05
 Identities = 25/33 (75%), Positives = 28/33 (84%)
 Frame = -3

Query: 197 IEGNTARGASSPAKPALHIPEPLSTTNAATSSS 99
           ++GNTA GASSPAKPAL IPEPLS T+A TS S
Sbjct: 1   MDGNTAFGASSPAKPALTIPEPLSHTSAETSPS 33


>UniRef50_Q54KZ7 Cluster: Putative uncharacterized protein; n=1;
           Dictyostelium discoideum AX4|Rep: Putative
           uncharacterized protein - Dictyostelium discoideum AX4
          Length = 490

 Score = 51.2 bits (117), Expect = 2e-05
 Identities = 20/66 (30%), Positives = 44/66 (66%), Gaps = 1/66 (1%)
 Frame = +3

Query: 303 PIEHGIVTNWDDMEKIWHHTFY-NELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN 479
           P+E G +TNW   ++IW + F  +++++ P+++ +LLTEAP +    R+ M ++++E + 
Sbjct: 87  PMEKGYITNWGLEKEIWDYAFKRDDMKIKPQDYNLLLTEAPNSLDDLRKTMYEVVYEQYK 146

Query: 480 TPAMYV 497
             ++Y+
Sbjct: 147 FKSLYL 152


>UniRef50_Q09849 Cluster: Uncharacterized protein C23D3.09; n=1;
           Schizosaccharomyces pombe|Rep: Uncharacterized protein
           C23D3.09 - Schizosaccharomyces pombe (Fission yeast)
          Length = 430

 Score = 50.4 bits (115), Expect = 3e-05
 Identities = 26/87 (29%), Positives = 46/87 (52%), Gaps = 2/87 (2%)
 Frame = +3

Query: 255 VGDEAQSKRGI--LTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLN 428
           V DE Q    I  + +K    +GI+ +W+     W      +L+V P E+ +++TE   N
Sbjct: 53  VVDELQIHAPIPGMEVKNGKSNGIIQDWESTLYTWERGLKEKLQVNPTEYAMMITEPSWN 112

Query: 429 PKANREKMTQIMFETFNTPAMYVAIQA 509
           P++ R+++ +  FE  + PA Y+  QA
Sbjct: 113 PQSVRQQIMEAAFEQLHVPAFYLTKQA 139



 Score = 36.7 bits (81), Expect = 0.44
 Identities = 14/34 (41%), Positives = 23/34 (67%)
 Frame = +1

Query: 103 EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVG 204
           EE+ +LV+D GS   + G+AG+++P  + PS  G
Sbjct: 8   EEIPSLVIDPGSCWTRFGYAGEESPMTILPSYYG 41


>UniRef50_UPI0000E4A0BF Cluster: PREDICTED: similar to Actin-related
           protein 5; n=2; Strongylocentrotus purpuratus|Rep:
           PREDICTED: similar to Actin-related protein 5 -
           Strongylocentrotus purpuratus
          Length = 602

 Score = 50.0 bits (114), Expect = 4e-05
 Identities = 24/75 (32%), Positives = 42/75 (56%), Gaps = 3/75 (4%)
 Frame = +3

Query: 294 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPE---EHPVLLTEAPLNPKANREKMTQIM 464
           LK   +  +VT++D  E+I  H F   L +  E   +HP+++TE P NP   R+ M++++
Sbjct: 147 LKTQFDRDVVTHYDAQEQILDHAF-QRLGIDSEGAVKHPIVMTETPCNPNLCRQTMSELL 205

Query: 465 FETFNTPAMYVAIQA 509
           FE +  P +   I +
Sbjct: 206 FECYQIPNLAYGIDS 220



 Score = 33.1 bits (72), Expect = 5.4
 Identities = 12/32 (37%), Positives = 20/32 (62%)
 Frame = +1

Query: 118 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPR 213
           +++DNGS   + G+A +  PR  F +I+ R R
Sbjct: 93  IIIDNGSCFSRVGWASEGTPRLTFRNIIARQR 124


>UniRef50_Q5KAQ4 Cluster: Actin-like protein ARP6; n=1;
           Filobasidiella neoformans|Rep: Actin-like protein ARP6 -
           Cryptococcus neoformans (Filobasidiella neoformans)
          Length = 490

 Score = 49.6 bits (113), Expect = 6e-05
 Identities = 35/117 (29%), Positives = 51/117 (43%), Gaps = 3/117 (2%)
 Frame = +3

Query: 255 VGDEAQSKRGILTLKY--PIEHGIVTNWDDMEKIWHHTFY-NELRVAPEEHPVLLTEAPL 425
           VGDE  + + +  + Y  P E G++ NWD    IW   F  + L + P E  +L+TE   
Sbjct: 45  VGDEIDNCKDLSGIVYRRPFEKGMLVNWDAERIIWDRLFSPSVLNINPTETSLLVTEPYF 104

Query: 426 NPKANREKMTQIMFETFNTPAMYVAIQACSRCTRPVVPPVSCWTSGDGGLPHPCPIL 596
           N     E   Q++FE F         Q+  RC    + P       D G+P  C I+
Sbjct: 105 NLPNIAETYDQMIFEEFE-------FQSYFRCAPAALIPYGGLYESDQGIPPQCTIV 154


>UniRef50_P53946 Cluster: Actin-related protein 5; n=7;
           Saccharomycetales|Rep: Actin-related protein 5 -
           Saccharomyces cerevisiae (Baker's yeast)
          Length = 755

 Score = 49.6 bits (113), Expect = 6e-05
 Identities = 30/100 (30%), Positives = 52/100 (52%), Gaps = 4/100 (4%)
 Frame = +3

Query: 222 RDGRYGTEGLLVGDEAQSKRGILTL-KYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEE- 395
           RD +       VG++    + + +  + P +   VTNW+  E+I  +TF++ L V P+  
Sbjct: 71  RDRKLNKNFTFVGNDTLLDQAVRSQSRSPFDGPFVTNWNLTEEILDYTFHH-LGVVPDNG 129

Query: 396 --HPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQA 509
             +P+LLTE     ++ R    QI+FET+N P +   I +
Sbjct: 130 IPNPILLTERLATVQSQRTNWYQILFETYNVPGVTFGIDS 169


>UniRef50_A2EUM6 Cluster: Actin family protein; n=1; Trichomonas
           vaginalis G3|Rep: Actin family protein - Trichomonas
           vaginalis G3
          Length = 360

 Score = 49.2 bits (112), Expect = 8e-05
 Identities = 21/33 (63%), Positives = 26/33 (78%)
 Frame = +1

Query: 118 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRH 216
           LV+D GSG  KAGFAG+D+P  VFP++VG  RH
Sbjct: 8   LVLDFGSGFVKAGFAGNDSPSLVFPTVVGNLRH 40


>UniRef50_UPI0000DD7E8B Cluster: PREDICTED: similar to ARP3
           actin-related protein 3 homolog B; n=1; Homo
           sapiens|Rep: PREDICTED: similar to ARP3 actin-related
           protein 3 homolog B - Homo sapiens
          Length = 406

 Score = 48.8 bits (111), Expect = 1e-04
 Identities = 20/35 (57%), Positives = 26/35 (74%)
 Frame = +3

Query: 405 LLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQA 509
           L TE PLN   NRE + +IMFE+FN P +Y+A+QA
Sbjct: 257 LQTEPPLNTPENREYLAEIMFESFNVPGLYIAVQA 291


>UniRef50_A6R1X8 Cluster: Putative uncharacterized protein; n=1;
           Ajellomyces capsulatus NAm1|Rep: Putative
           uncharacterized protein - Ajellomyces capsulatus NAm1
          Length = 444

 Score = 41.1 bits (92), Expect = 0.020
 Identities = 15/35 (42%), Positives = 26/35 (74%)
 Frame = +1

Query: 103 EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGR 207
           +EV+A+++D G    +AGFAG+D P++V P+  G+
Sbjct: 15  DEVSAIILDPGYSTVRAGFAGEDTPKSVIPTCYGK 49



 Score = 36.3 bits (80), Expect(2) = 1e-04
 Identities = 16/36 (44%), Positives = 22/36 (61%)
 Frame = +3

Query: 393 EHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVA 500
           + P+L+TE   NP   REK  +I  E + TPA Y+A
Sbjct: 139 DSPLLMTECGWNPVKAREKTIEIAMEKWGTPAFYLA 174



 Score = 31.9 bits (69), Expect(2) = 1e-04
 Identities = 19/64 (29%), Positives = 33/64 (51%), Gaps = 5/64 (7%)
 Frame = +3

Query: 228 GRYGTEG---LLVGDEAQ-SKRGILTLKYPI-EHGIVTNWDDMEKIWHHTFYNELRVAPE 392
           G+Y T+     + GD    + R  L++  P+   GIV +WD  EK+W ++F + L     
Sbjct: 48  GKYTTDAQDKYIYGDSIYVTPRPGLSIHNPMGREGIVEDWDAAEKVWEYSFTSRLTGPKS 107

Query: 393 EHPV 404
            +P+
Sbjct: 108 GNPL 111


>UniRef50_Q8ILM5 Cluster: Actin, putative; n=1; Plasmodium
           falciparum 3D7|Rep: Actin, putative - Plasmodium
           falciparum (isolate 3D7)
          Length = 522

 Score = 48.4 bits (110), Expect = 1e-04
 Identities = 21/40 (52%), Positives = 30/40 (75%)
 Frame = +3

Query: 390 EEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQA 509
           EEHP+LLTE  ++    RE+MT+I+FE +N PA+Y A +A
Sbjct: 146 EEHPILLTEFNMHNHKIREQMTEILFEKYNIPALYFAKKA 185



 Score = 32.3 bits (70), Expect = 9.4
 Identities = 15/34 (44%), Positives = 20/34 (58%)
 Frame = +1

Query: 103 EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVG 204
           E++++LVVD G   CK G   +D PR    SI G
Sbjct: 16  EDISSLVVDLGFYSCKIGHNQEDTPRIFLNSICG 49


>UniRef50_A5K109 Cluster: Actin, putative; n=4; Plasmodium|Rep:
           Actin, putative - Plasmodium vivax
          Length = 493

 Score = 48.4 bits (110), Expect = 1e-04
 Identities = 22/45 (48%), Positives = 32/45 (71%)
 Frame = +3

Query: 375 LRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQA 509
           L +  EEHP+LL+E  ++    R +MT+I+FETFN PA+Y A +A
Sbjct: 134 LNLKIEEHPILLSEENIHNHRVRAEMTEILFETFNIPAVYFAKKA 178


>UniRef50_Q9H9F9 Cluster: Actin-related protein 5; n=19;
           Euteleostomi|Rep: Actin-related protein 5 - Homo sapiens
           (Human)
          Length = 607

 Score = 48.0 bits (109), Expect = 2e-04
 Identities = 29/101 (28%), Positives = 53/101 (52%), Gaps = 4/101 (3%)
 Frame = +3

Query: 219 GRDGRYGTEGLLVGDEAQSKRGIL-TLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPE- 392
           GR G  G  G  VG+   S   +   L+ P +  +  N +  E +  ++F + L V+ + 
Sbjct: 68  GRGGARGASGPQVGNALGSLEPLRWMLRSPFDRNVPVNLELQELLLDYSFQH-LGVSSQG 126

Query: 393 --EHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQA 509
             +HP++LTEA  NP  +R+ M++++FE +  P +   I +
Sbjct: 127 CVDHPIVLTEAVCNPLYSRQMMSELLFECYGIPKVAYGIDS 167


>UniRef50_Q5CKL2 Cluster: BRG1/brm-associated factor 53A; n=2;
           Cryptosporidium|Rep: BRG1/brm-associated factor 53A -
           Cryptosporidium hominis
          Length = 423

 Score = 47.6 bits (108), Expect = 2e-04
 Identities = 29/73 (39%), Positives = 41/73 (56%), Gaps = 1/73 (1%)
 Frame = +3

Query: 294 LKYPIEHGIVTNWDDMEKIWHHTFYN-ELRVAPEEHPVLLTEAPLNPKANREKMTQIMFE 470
           LKY ++  ++ N D  E+I   T     L     EHP+LLTE   + +  REK  +IMFE
Sbjct: 70  LKY-VDGDLILNGDVFEEIIRTTSGKIGLSTDLREHPILLTEPSKHNRQIREKEVEIMFE 128

Query: 471 TFNTPAMYVAIQA 509
            F+ PA+Y A +A
Sbjct: 129 KFDVPAVYTAKKA 141



 Score = 45.2 bits (102), Expect = 0.001
 Identities = 18/34 (52%), Positives = 26/34 (76%)
 Frame = +1

Query: 103 EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVG 204
           ++V A++VD GS M K G+ G+D PR V+PS+VG
Sbjct: 11  DDVGAIIVDVGSYMTKIGYGGEDCPRQVWPSVVG 44


>UniRef50_Q12406 Cluster: Actin-related protein 7; n=2;
           Saccharomyces cerevisiae|Rep: Actin-related protein 7 -
           Saccharomyces cerevisiae (Baker's yeast)
          Length = 477

 Score = 47.6 bits (108), Expect = 2e-04
 Identities = 28/95 (29%), Positives = 47/95 (49%), Gaps = 4/95 (4%)
 Frame = +3

Query: 234 YGTEGLLVGDEAQSKR-GILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLL 410
           +GT  ++  D A  KR G          G+  NWD +E  W + +  +L+V+PEE P+++
Sbjct: 49  FGTYNMI--DAAAEKRNGDEVYTLVDSQGLPYNWDALEMQWRYLYDTQLKVSPEELPLVI 106

Query: 411 TEAPLNPK---ANREKMTQIMFETFNTPAMYVAIQ 506
           T    N K   A  E+  ++ F+  N P   + I+
Sbjct: 107 TMPATNGKPDMAILERYYELAFDKLNVPVFQIVIE 141


>UniRef50_Q9LHH0 Cluster: Actin-like protein; n=11;
           Magnoliophyta|Rep: Actin-like protein - Arabidopsis
           thaliana (Mouse-ear cress)
          Length = 724

 Score = 47.2 bits (107), Expect = 3e-04
 Identities = 22/70 (31%), Positives = 38/70 (54%), Gaps = 1/70 (1%)
 Frame = +3

Query: 303 PIEHGIVTNWDDMEKIWHHTFYN-ELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN 479
           P +  +V  ++ ME I  + F       +  +HP+L+TE   NP  +R KM +++FET+ 
Sbjct: 85  PFDSNVVYQFEIMEYILDYAFDRLGANGSGIDHPILITECACNPVQSRSKMAELLFETYG 144

Query: 480 TPAMYVAIQA 509
            PA+   + A
Sbjct: 145 VPAVAFGVDA 154



 Score = 42.7 bits (96), Expect = 0.007
 Identities = 17/34 (50%), Positives = 25/34 (73%)
 Frame = +1

Query: 118 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQ 219
           +V+DNG+   + G+AG+  PR VF +IV RPRH+
Sbjct: 22  IVIDNGASYFRIGWAGETEPRVVFRNIVQRPRHK 55


>UniRef50_Q4P2E8 Cluster: Actin-related protein 4; n=1; Ustilago
           maydis|Rep: Actin-related protein 4 - Ustilago maydis
           (Smut fungus)
          Length = 534

 Score = 47.2 bits (107), Expect = 3e-04
 Identities = 19/36 (52%), Positives = 27/36 (75%)
 Frame = +3

Query: 393 EHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVA 500
           EHP+LLTE   N + +REK+T++ FET  +PA Y+A
Sbjct: 181 EHPLLLTEPAWNSRESREKLTELAFETLGSPAFYLA 216



 Score = 41.1 bits (92), Expect = 0.020
 Identities = 17/34 (50%), Positives = 23/34 (67%)
 Frame = +1

Query: 103 EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVG 204
           +E+ ALV+D G    + G+AG+DAPR V PS  G
Sbjct: 8   DEINALVIDAGHSSSRVGWAGEDAPRVVLPSYYG 41


>UniRef50_P80428 Cluster: Actin-related protein 4; n=4;
           Saccharomycetales|Rep: Actin-related protein 4 -
           Saccharomyces cerevisiae (Baker's yeast)
          Length = 489

 Score = 46.8 bits (106), Expect = 4e-04
 Identities = 25/70 (35%), Positives = 36/70 (51%), Gaps = 1/70 (1%)
 Frame = +3

Query: 294 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEH-PVLLTEAPLNPKANREKMTQIMFE 470
           LK  IE+G+V +WD  ++ W     NEL +      P LLTE   N   NR+K  +++ E
Sbjct: 71  LKPIIENGLVIDWDTAQEQWQWALQNELYLNSNSGIPALLTEPVWNSTENRKKSLEVLLE 130

Query: 471 TFNTPAMYVA 500
                A Y+A
Sbjct: 131 GMQFEACYLA 140



 Score = 38.3 bits (85), Expect = 0.14
 Identities = 14/35 (40%), Positives = 25/35 (71%)
 Frame = +1

Query: 103 EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGR 207
           +EV+A+V+D GS     G++G D P+++ PS+ G+
Sbjct: 12  DEVSAVVIDPGSYTTNIGYSGSDFPQSILPSVYGK 46


>UniRef50_A6RD74 Cluster: Putative uncharacterized protein; n=1;
           Ajellomyces capsulatus NAm1|Rep: Putative
           uncharacterized protein - Ajellomyces capsulatus NAm1
          Length = 731

 Score = 46.4 bits (105), Expect = 5e-04
 Identities = 30/112 (26%), Positives = 51/112 (45%), Gaps = 2/112 (1%)
 Frame = +3

Query: 192 LDRGKAPPSGRDGRYGTEGLLVGDE-AQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFY 368
           ++ G    +  D  +  EG ++ +E   S  G +   YPI +G +  W     +  H F 
Sbjct: 129 VENGHEETTVADAEHSEEGQIIYEEDPTSDEGAV---YPIRNGEIVEWSCFFALLSHIFK 185

Query: 369 NELRVAPEEH-PVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQACSRC 521
               ++P  H P++    P+    +RE +TQ +FE F TPA  +   A + C
Sbjct: 186 T---LSPPFHTPIMFIAQPVWTARDREAITQFVFEKFQTPAFCLMDSALAAC 234


>UniRef50_Q17GZ9 Cluster: Actin-related protein 5; n=4;
           Endopterygota|Rep: Actin-related protein 5 - Aedes
           aegypti (Yellowfever mosquito)
          Length = 655

 Score = 46.0 bits (104), Expect = 7e-04
 Identities = 18/34 (52%), Positives = 26/34 (76%)
 Frame = +1

Query: 112 AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPR 213
           AA+V+DNGS  C+AG+AG D P  VF +++ +PR
Sbjct: 28  AAIVIDNGSYHCRAGWAGKDVPSLVFKNVLAKPR 61



 Score = 41.5 bits (93), Expect = 0.015
 Identities = 23/73 (31%), Positives = 39/73 (53%), Gaps = 3/73 (4%)
 Frame = +3

Query: 294 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPE---EHPVLLTEAPLNPKANREKMTQIM 464
           L+   +  +VT+    E+I+ + F   L +  +    HPVLLTE   NP  +R  M+++M
Sbjct: 93  LRTQFDRNVVTHLHVQEQIFDYLF-GRLGINADGCVPHPVLLTECVANPNYSRMLMSELM 151

Query: 465 FETFNTPAMYVAI 503
           FE +  P +  A+
Sbjct: 152 FECYGIPGIVYAV 164


>UniRef50_UPI0000499930 Cluster: actin; n=1; Entamoeba histolytica
           HM-1:IMSS|Rep: actin - Entamoeba histolytica HM-1:IMSS
          Length = 372

 Score = 45.6 bits (103), Expect = 0.001
 Identities = 19/36 (52%), Positives = 25/36 (69%)
 Frame = +3

Query: 399 PVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQ 506
           P+L TE  LNPK  REK  Q++FE F  P++Y +IQ
Sbjct: 92  PILFTEPALNPKQIREKTIQLLFERFKVPSVYFSIQ 127



 Score = 38.3 bits (85), Expect = 0.14
 Identities = 16/34 (47%), Positives = 22/34 (64%)
 Frame = +1

Query: 118 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQ 219
           +V+D GS  C+ G AG+  P  +FPS VG PR +
Sbjct: 5   IVLDFGSQTCRVGNAGESMPTNIFPSYVGIPREK 38


>UniRef50_Q18PR4 Cluster: Actin-related protein; n=1; Porphyra
           yezoensis|Rep: Actin-related protein - Porphyra
           yezoensis
          Length = 573

 Score = 45.6 bits (103), Expect = 0.001
 Identities = 24/87 (27%), Positives = 48/87 (55%), Gaps = 2/87 (2%)
 Frame = +3

Query: 246 GLLVGDEAQS-KRGILTLKYPIE-HGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEA 419
           G++VGD+A + +R  + +    + +G+V NW+  E +  H +   ++ A E+  V+  E 
Sbjct: 57  GIIVGDQALAIRRDDMNVTPAFDANGLVANWEAYEGLLAHAYSTGVQAASEDFAVMYAEP 116

Query: 420 PLNPKANREKMTQIMFETFNTPAMYVA 500
                  RE++ +++FET   PA+ V+
Sbjct: 117 THACIRQRERIGELLFETHGAPALAVS 143



 Score = 38.3 bits (85), Expect = 0.14
 Identities = 16/35 (45%), Positives = 23/35 (65%)
 Frame = +1

Query: 100 DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVG 204
           D  V ++V D GS  CK GFAG+D P +++ S +G
Sbjct: 5   DGTVPSVVFDFGSHTCKVGFAGEDLPHSLYSSNIG 39


>UniRef50_A1CCH7 Cluster: Chromatin remodeling complex subunit
           (Arp9), putative; n=20; Pezizomycotina|Rep: Chromatin
           remodeling complex subunit (Arp9), putative -
           Aspergillus clavatus
          Length = 693

 Score = 45.6 bits (103), Expect = 0.001
 Identities = 25/74 (33%), Positives = 38/74 (51%)
 Frame = +3

Query: 300 YPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN 479
           YPIE+G + +W     +  H  +N L   P   P++L   P+    +RE +TQ +FE F 
Sbjct: 146 YPIENGRIVDWPCFFALLTHV-HNTLS-PPFHTPIMLISEPVWSARDREAITQFVFEKFK 203

Query: 480 TPAMYVAIQACSRC 521
           TPA  +   A + C
Sbjct: 204 TPAFCLMDSALAIC 217


>UniRef50_Q4P4D4 Cluster: Putative uncharacterized protein; n=1;
           Ustilago maydis|Rep: Putative uncharacterized protein -
           Ustilago maydis (Smut fungus)
          Length = 544

 Score = 45.2 bits (102), Expect = 0.001
 Identities = 31/117 (26%), Positives = 54/117 (46%), Gaps = 5/117 (4%)
 Frame = +3

Query: 186 VPLDRGKAPPSGRDGRYGTEGLLVG---DEAQSKRGILTLKYPIEHGIVTNWDDMEKIWH 356
           V L R  A  S        +  LVG   D+A+ +   + + +P+  G V +W  M  +W+
Sbjct: 39  VGLPRSSASTSSSSSPPDYKQYLVGSALDQAERRGDDVAIFWPMRKGYVRDWQQMIALWN 98

Query: 357 HTFYNELRVAPEEHPV-LLTEAPLN-PKANREKMTQIMFETFNTPAMYVAIQACSRC 521
           +  ++ L +    +   +L   PL   +A    +TQI FE FN+ A+ +A +    C
Sbjct: 99  YVLFHLLPIRRSHNDSNILISLPLPVSRATHAYLTQIFFEHFNSAAITIAEKPLLSC 155


>UniRef50_Q6CSB9 Cluster: Actin-related protein 4; n=1;
           Kluyveromyces lactis|Rep: Actin-related protein 4 -
           Kluyveromyces lactis (Yeast) (Candida sphaerica)
          Length = 520

 Score = 45.2 bits (102), Expect = 0.001
 Identities = 22/75 (29%), Positives = 41/75 (54%), Gaps = 1/75 (1%)
 Frame = +3

Query: 279 RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEH-PVLLTEAPLNPKANREKMT 455
           R  + +K  +E+  + +WD  ++ W +    +L+    +  PVLLTE   N +A+R+K  
Sbjct: 66  RAGMEIKPIVENSTIVDWDRAQEQWEYALNTDLKFESNKGTPVLLTEPIWNSEASRKKSL 125

Query: 456 QIMFETFNTPAMYVA 500
           +I+ E+    A Y+A
Sbjct: 126 EILLESMEFEACYLA 140



 Score = 36.3 bits (80), Expect = 0.58
 Identities = 14/40 (35%), Positives = 24/40 (60%)
 Frame = +1

Query: 103 EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQG 222
           +E+ A+V+D GS +   G++G D P+++ PS  G     G
Sbjct: 12  DEINAIVIDPGSFVTNIGYSGTDCPQSIMPSSYGNVETDG 51


>UniRef50_UPI0000E80C06 Cluster: PREDICTED: hypothetical protein;
           n=1; Gallus gallus|Rep: PREDICTED: hypothetical protein
           - Gallus gallus
          Length = 65

 Score = 44.8 bits (101), Expect = 0.002
 Identities = 23/49 (46%), Positives = 26/49 (53%)
 Frame = +2

Query: 104 KKLPRW**TMAPVCARPVSQEMMLLAPCSPRSWEGPAIRA*WSVWDRRT 250
           +KL  W  TMA VCAR     MM    CS   W+ P I+  W VW RRT
Sbjct: 2   RKLLPWWWTMALVCARQALLGMMPPGLCSLPLWDAPGIKVSWWVWGRRT 50


>UniRef50_Q6BIA3 Cluster: CA5059|IPF3691 Candida albicans IPF3691;
           n=5; Saccharomycetales|Rep: CA5059|IPF3691 Candida
           albicans IPF3691 - Debaryomyces hansenii (Yeast)
           (Torulaspora hansenii)
          Length = 450

 Score = 44.8 bits (101), Expect = 0.002
 Identities = 24/80 (30%), Positives = 40/80 (50%), Gaps = 3/80 (3%)
 Frame = +3

Query: 255 VGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYN---ELRVAPEEHPVLLTEAPL 425
           VGD+   +     +   +E+G++ N+D +   W + + N      +  +E P++LTE P 
Sbjct: 45  VGDKQVDESPESDIMTFMENGLIYNFDSIVHNWQYVYDNIDNNNAINAKEFPLMLTEQPW 104

Query: 426 NPKANREKMTQIMFETFNTP 485
           N   N+   TQI FET   P
Sbjct: 105 NTSKNKLATTQIAFETLEVP 124



 Score = 37.9 bits (84), Expect = 0.19
 Identities = 22/45 (48%), Positives = 25/45 (55%)
 Frame = +1

Query: 115 ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKD 249
           A+V+DNGS   KAGFA DD P  VF S      +  V VG  Q D
Sbjct: 7   AVVIDNGSHTTKAGFALDDLPSLVFNSNYVVDSNSKVQVGDKQVD 51


>UniRef50_Q4YVG6 Cluster: Actin, putative; n=7; Plasmodium|Rep:
           Actin, putative - Plasmodium berghei
          Length = 505

 Score = 44.0 bits (99), Expect = 0.003
 Identities = 24/71 (33%), Positives = 42/71 (59%), Gaps = 4/71 (5%)
 Frame = +3

Query: 327 NWDDMEKIWHHTFYNE-LRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYV-- 497
           N++ MEK++     ++ L V  ++HP+LLTE        REK T++MFE++N   M++  
Sbjct: 82  NFEAMEKLFEDISGSKALDVNFQDHPILLTEPNKIDSRYREKFTELMFESYNVYQMFLSK 141

Query: 498 -AIQACSRCTR 527
            ++ +C  C R
Sbjct: 142 RSVLSCYGCAR 152


>UniRef50_Q2H0E9 Cluster: Putative uncharacterized protein; n=1;
           Chaetomium globosum|Rep: Putative uncharacterized
           protein - Chaetomium globosum (Soil fungus)
          Length = 656

 Score = 44.0 bits (99), Expect = 0.003
 Identities = 23/80 (28%), Positives = 43/80 (53%), Gaps = 3/80 (3%)
 Frame = +3

Query: 279 RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPE---EHPVLLTEAPLNPKANREK 449
           RG +   +    GIV++WD +E +  H F        E   + P+++TEA  N   +R+ 
Sbjct: 109 RGHIRNAFEAGTGIVSSWDVVEHVLDHVFIKLGMNGVEGGIDMPIVMTEAVANLPYSRKT 168

Query: 450 MTQIMFETFNTPAMYVAIQA 509
           M++++FE +N P++   I +
Sbjct: 169 MSEMLFECYNAPSVVYGIDS 188



 Score = 35.1 bits (77), Expect = 1.3
 Identities = 14/34 (41%), Positives = 22/34 (64%)
 Frame = +1

Query: 112 AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPR 213
           A +V+DNGS   +AG++ +D PR   P I+ + R
Sbjct: 54  AVIVIDNGSSTVRAGWSFEDKPRLAIPPIMSKYR 87


>UniRef50_Q6C982 Cluster: Actin-like protein ARP6; n=1; Yarrowia
           lipolytica|Rep: Actin-like protein ARP6 - Yarrowia
           lipolytica (Candida lipolytica)
          Length = 387

 Score = 44.0 bits (99), Expect = 0.003
 Identities = 20/63 (31%), Positives = 31/63 (49%)
 Frame = +3

Query: 288 LTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMF 467
           L  K P E G + NWD  + +W + FYN       +  +LLT+ PL        + Q++F
Sbjct: 47  LVFKRPSEKGQLINWDIQKAVWDNLFYNPQTGVDTDSSLLLTQYPLTLPQVSANIDQVVF 106

Query: 468 ETF 476
           E +
Sbjct: 107 EEY 109


>UniRef50_Q7S6X6 Cluster: Actin-like protein arp-6; n=5;
           Pezizomycotina|Rep: Actin-like protein arp-6 -
           Neurospora crassa
          Length = 446

 Score = 44.0 bits (99), Expect = 0.003
 Identities = 22/87 (25%), Positives = 44/87 (50%), Gaps = 5/87 (5%)
 Frame = +3

Query: 249 LLVGDEAQSKRGI--LTLKYPIEHGIVTNWDDMEKIWHHTFYNE---LRVAPEEHPVLLT 413
           + VG E +  +    L  + P+E G + NW+  ++IW   F+++    +  P +  ++LT
Sbjct: 60  IYVGSELEKCKDFSELAFRRPVEKGFIVNWEAQKEIWDREFFDDKAAQKCDPSDTRLILT 119

Query: 414 EAPLNPKANREKMTQIMFETFNTPAMY 494
           E P +  + +    QI+FE +   + Y
Sbjct: 120 EQPNSLPSLQTHCDQIVFEEYGFASYY 146



 Score = 36.3 bits (80), Expect = 0.58
 Identities = 19/43 (44%), Positives = 26/43 (60%), Gaps = 4/43 (9%)
 Frame = +1

Query: 118 LVVDNGSGMCKAGFAGDD----APRAVFPSIVGRPRHQGVMVG 234
           LV+DNG+   KAGF  DD     PR + P+ + R RH+ + VG
Sbjct: 22  LVLDNGADTIKAGFVSDDKSDGKPR-IIPNCLARDRHRKIYVG 63


>UniRef50_A4S826 Cluster: Predicted protein; n=1; Ostreococcus
           lucimarinus CCE9901|Rep: Predicted protein -
           Ostreococcus lucimarinus CCE9901
          Length = 346

 Score = 43.6 bits (98), Expect = 0.004
 Identities = 21/27 (77%), Positives = 23/27 (85%), Gaps = 1/27 (3%)
 Frame = +1

Query: 94  MCDE-EVAALVVDNGSGMCKAGFAGDD 171
           M DE E++ALV DNGSGM KAGFAGDD
Sbjct: 1   MADEGELSALVCDNGSGMVKAGFAGDD 27


>UniRef50_Q7SXV8 Cluster: ARP5 actin-related protein 5 homolog; n=6;
           Euteleostomi|Rep: ARP5 actin-related protein 5 homolog -
           Danio rerio (Zebrafish) (Brachydanio rerio)
          Length = 592

 Score = 42.7 bits (96), Expect = 0.007
 Identities = 26/104 (25%), Positives = 51/104 (49%), Gaps = 4/104 (3%)
 Frame = +3

Query: 210 PPSGRDGRYGTEGLLVGDEAQSKRGIL-TLKYPIEHGIVTNWDDMEKIWHHTFYNELRVA 386
           P + R       G  VG++  +   +  TLK   +   V N+D  E ++ + F + L + 
Sbjct: 64  PAAARSRGAARGGAQVGNDIPNPEPLRWTLKSAFDRDTVVNFDIQELVFDYIFMH-LGIN 122

Query: 387 PE---EHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQA 509
            +   EHP+++TE   NP   R+ M++++FE +  P +   + +
Sbjct: 123 TQGRVEHPLVVTEPACNPLQCRQMMSELLFECYGVPRVAYGVDS 166


>UniRef50_Q54E71 Cluster: Putative uncharacterized protein; n=1;
           Dictyostelium discoideum AX4|Rep: Putative
           uncharacterized protein - Dictyostelium discoideum AX4
          Length = 684

 Score = 42.3 bits (95), Expect = 0.009
 Identities = 15/30 (50%), Positives = 24/30 (80%)
 Frame = +1

Query: 118 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGR 207
           +++DNGS  C+AGFA D +P+ +F S+VG+
Sbjct: 33  IIIDNGSYQCRAGFANDISPKLIFRSLVGK 62



 Score = 42.3 bits (95), Expect = 0.009
 Identities = 21/74 (28%), Positives = 40/74 (54%)
 Frame = +3

Query: 288 LTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMF 467
           LT+K P +  ++ +    E I+ + F+        E+PVL+TE   NP   R+ M++++F
Sbjct: 83  LTIKSPFDSNLLVHPPSQESIFDYIFHKFGIENEIENPVLITEPTSNPTFCRKYMSELLF 142

Query: 468 ETFNTPAMYVAIQA 509
           E +N  ++   I +
Sbjct: 143 ECYNIKSVVYGIDS 156


>UniRef50_Q0IFH2 Cluster: Actin; n=4; Endopterygota|Rep: Actin -
           Aedes aegypti (Yellowfever mosquito)
          Length = 400

 Score = 42.3 bits (95), Expect = 0.009
 Identities = 22/82 (26%), Positives = 46/82 (56%), Gaps = 3/82 (3%)
 Frame = +3

Query: 255 VGDEAQSKRGILTLKYPI--EHGIVTNWDDMEKIWHHTFYNEL-RVAPEEHPVLLTEAPL 425
           +G++ +  R +  L Y +  + G + NWD  + +W + F ++   V   E P+L+TE   
Sbjct: 45  IGNQIEECRDVSGLFYILCFQRGYLVNWDIQKTVWDYMFSSDCCPVNFSETPLLITEPLF 104

Query: 426 NPKANREKMTQIMFETFNTPAM 491
           N ++ +E M +I++E ++  A+
Sbjct: 105 NFQSIQEAMLEILYEEYDCDAV 126


>UniRef50_Q6FMT7 Cluster: Similar to sp|Q12406 Saccharomyces
           cerevisiae YPR034w ARP7 Actin-like protein; n=1; Candida
           glabrata|Rep: Similar to sp|Q12406 Saccharomyces
           cerevisiae YPR034w ARP7 Actin-like protein - Candida
           glabrata (Yeast) (Torulopsis glabrata)
          Length = 529

 Score = 41.9 bits (94), Expect = 0.012
 Identities = 22/73 (30%), Positives = 39/73 (53%), Gaps = 7/73 (9%)
 Frame = +3

Query: 309 EHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIM-------F 467
           +HGI  NW  +E+++ + +  EL+V P E P+++T   L    NRE  T+I+       F
Sbjct: 87  DHGIPYNWKALERLYRYIYEKELKVDPSELPLVIT---LPSMTNRELETKIVENYMELAF 143

Query: 468 ETFNTPAMYVAIQ 506
           E    P + + ++
Sbjct: 144 EKLKVPVLQIVVE 156


>UniRef50_UPI0000EBF019 Cluster: PREDICTED: similar to ribosomal
           protein L10; n=1; Bos taurus|Rep: PREDICTED: similar to
           ribosomal protein L10 - Bos taurus
          Length = 289

 Score = 41.5 bits (93), Expect = 0.015
 Identities = 23/45 (51%), Positives = 27/45 (60%)
 Frame = +1

Query: 118 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 252
           LVVD G   CK GF  D+    V P+    P+HQ  MVG+GQKDS
Sbjct: 4   LVVDCGFDTCKTGFTEDNTLSCV-PTHRLVPQHQDCMVGVGQKDS 47



 Score = 38.7 bits (86), Expect = 0.11
 Identities = 17/47 (36%), Positives = 28/47 (59%)
 Frame = +3

Query: 237 GTEGLLVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNEL 377
           G +   +G + Q +  + T +YP+E GI+T+ DD+ KIW     N+L
Sbjct: 43  GQKDSYMGGKIQGRLSVQTPEYPMEQGIITHPDDVGKIWITIAINQL 89


>UniRef50_UPI00004987CF Cluster: actin; n=2; Entamoeba histolytica
           HM-1:IMSS|Rep: actin - Entamoeba histolytica HM-1:IMSS
          Length = 876

 Score = 41.5 bits (93), Expect = 0.015
 Identities = 21/69 (30%), Positives = 36/69 (52%), Gaps = 1/69 (1%)
 Frame = +3

Query: 294 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVA-PEEHPVLLTEAPLNPKANREKMTQIMFE 470
           L +P++    T+WD +  I  + + NEL    P  HPV++TE P   +   +K+  +MF 
Sbjct: 573 LVWPLDPRKDTDWDGLLAIIQNIYENELDGCDPASHPVVMTELPNMNEVATDKIKSMMFN 632

Query: 471 TFNTPAMYV 497
             N P + +
Sbjct: 633 DLNVPFLKI 641


>UniRef50_Q7M3Y5 Cluster: Actin; n=1; Aplysia californica|Rep: Actin
           - Aplysia californica (California sea hare)
          Length = 92

 Score = 41.5 bits (93), Expect = 0.015
 Identities = 19/20 (95%), Positives = 19/20 (95%)
 Frame = +1

Query: 109 VAALVVDNGSGMCKAGFAGD 168
           VAALVVDNGSGM KAGFAGD
Sbjct: 1   VAALVVDNGSGMXKAGFAGD 20



 Score = 41.1 bits (92), Expect = 0.020
 Identities = 18/21 (85%), Positives = 19/21 (90%)
 Frame = +3

Query: 363 FYNELRVAPEEHPVLLTEAPL 425
           F  +LRVAPEEHPVLLTEAPL
Sbjct: 17  FAGDLRVAPEEHPVLLTEAPL 37


>UniRef50_Q9GZN1 Cluster: Actin-related protein 6; n=26;
           Chordata|Rep: Actin-related protein 6 - Homo sapiens
           (Human)
          Length = 396

 Score = 41.5 bits (93), Expect = 0.015
 Identities = 21/78 (26%), Positives = 41/78 (52%), Gaps = 1/78 (1%)
 Frame = +3

Query: 261 DEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNEL-RVAPEEHPVLLTEAPLNPKA 437
           DE +   G+  +  P + G + NWD   ++W + F  E+ +V   +  +++TE   N  +
Sbjct: 46  DEIKDPSGLFYI-LPFQKGYLVNWDVQRQVWDYLFGKEMYQVDFLDTNIIITEPYFNFTS 104

Query: 438 NREKMTQIMFETFNTPAM 491
            +E M +I+FE +   A+
Sbjct: 105 IQESMNEILFEEYQFQAV 122


>UniRef50_UPI00006CBDF1 Cluster: Actin family protein; n=1;
           Tetrahymena thermophila SB210|Rep: Actin family protein
           - Tetrahymena thermophila SB210
          Length = 400

 Score = 40.7 bits (91), Expect = 0.027
 Identities = 17/64 (26%), Positives = 32/64 (50%)
 Frame = +3

Query: 306 IEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTP 485
           +  G+V NW+             +++ P E P+ L E  L+ K  R+K  + +FE+ N  
Sbjct: 79  LSQGMVNNWEQASNFIEQINKKLMQINPSETPLFLIEQALSTKDVRQKCVEAVFESMNFA 138

Query: 486 AMYV 497
           A+++
Sbjct: 139 ALFI 142


>UniRef50_Q7QYV9 Cluster: GLP_164_51431_54055; n=1; Giardia lamblia
           ATCC 50803|Rep: GLP_164_51431_54055 - Giardia lamblia
           ATCC 50803
          Length = 874

 Score = 40.7 bits (91), Expect = 0.027
 Identities = 17/63 (26%), Positives = 30/63 (47%)
 Frame = +2

Query: 422 PQPQGQQREDDPDHVRNIQHARHVRRHPSVLSLYASGRTTGIVLDFRRRGSSTPVPHFTK 601
           P PQ + +E   D+V+++ H    R HP+  +L  +  +T +  D        P P +  
Sbjct: 421 PPPQQENQEQGQDYVQHVAHEAMARSHPNPTTLAGTASSTALAHDNLYSSVKNPSPEYDT 480

Query: 602 GIP 610
           G+P
Sbjct: 481 GLP 483


>UniRef50_A0D9D5 Cluster: Chromosome undetermined scaffold_42, whole
           genome shotgun sequence; n=1; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_42,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 94

 Score = 40.7 bits (91), Expect = 0.027
 Identities = 16/31 (51%), Positives = 23/31 (74%)
 Frame = +1

Query: 118 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRP 210
           ++ D+G+G  K GFAGD+ P   FP++VGRP
Sbjct: 5   IIEDSGTGYLKIGFAGDNFPSHSFPAMVGRP 35


>UniRef50_A7TM96 Cluster: Putative uncharacterized protein; n=1;
           Vanderwaltozyma polyspora DSM 70294|Rep: Putative
           uncharacterized protein - Vanderwaltozyma polyspora DSM
           70294
          Length = 488

 Score = 40.3 bits (90), Expect = 0.036
 Identities = 23/74 (31%), Positives = 37/74 (50%), Gaps = 7/74 (9%)
 Frame = +3

Query: 315 GIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANR-------EKMTQIMFET 473
           G+  NW+ +EK W + F  +L+  P E PVL+T  P +   N        E+  +I FE 
Sbjct: 73  GVPYNWEALEKQWEYIFEKQLKCDPTELPVLIT-IPSSISKNEDIENKVIEQYCKIAFEK 131

Query: 474 FNTPAMYVAIQACS 515
           F  P + +  ++ S
Sbjct: 132 FKIPYLQIVNESLS 145


>UniRef50_A3M088 Cluster: Vacuolar targeting, actin-related protein;
           n=5; Saccharomycetales|Rep: Vacuolar targeting,
           actin-related protein - Pichia stipitis (Yeast)
          Length = 775

 Score = 39.9 bits (89), Expect = 0.047
 Identities = 22/76 (28%), Positives = 40/76 (52%), Gaps = 3/76 (3%)
 Frame = +3

Query: 291 TLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPE---EHPVLLTEAPLNPKANREKMTQI 461
           ++K P +  +VTNWD ME +  ++  +   V       +P++LTE    P + R+ M +I
Sbjct: 98  SIKTPFDGPLVTNWDYMEVLLDYSLAHLGVVGDNGRLNNPLILTEPVGVPFSQRKNMYEI 157

Query: 462 MFETFNTPAMYVAIQA 509
           +FE +  P +   I +
Sbjct: 158 LFEAYQAPKVTFGIDS 173


>UniRef50_UPI0000498FDF Cluster: actin; n=1; Entamoeba histolytica
           HM-1:IMSS|Rep: actin - Entamoeba histolytica HM-1:IMSS
          Length = 763

 Score = 39.5 bits (88), Expect = 0.062
 Identities = 23/75 (30%), Positives = 44/75 (58%)
 Frame = +3

Query: 243 EGLLVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAP 422
           + L VGDEA  KRGIL+L+YP++   + +++ ++ +  H+    + VA + HP ++    
Sbjct: 464 QNLYVGDEAIDKRGILSLEYPMQKEPI-DYNSLKSVMKHS----VEVA-QGHPTVVITNG 517

Query: 423 LNPKANREKMTQIMF 467
           L P   +   ++I+F
Sbjct: 518 LTPLQMKINTSEILF 532


>UniRef50_Q7QA11 Cluster: ENSANGP00000003921; n=1; Anopheles gambiae
           str. PEST|Rep: ENSANGP00000003921 - Anopheles gambiae
           str. PEST
          Length = 390

 Score = 39.5 bits (88), Expect = 0.062
 Identities = 20/77 (25%), Positives = 42/77 (54%), Gaps = 3/77 (3%)
 Frame = +3

Query: 288 LTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEE---HPVLLTEAPLNPKANREKMTQ 458
           L L+   +  +VT+++  E+I+ + F  +L +  E    H V++TE   NP   R  M++
Sbjct: 58  LQLRTQFDRNVVTHYNVQEQIFDYIF-TKLGINSENSVPHKVMITECLFNPNYCRSLMSE 116

Query: 459 IMFETFNTPAMYVAIQA 509
           ++FE ++ P +   + +
Sbjct: 117 LLFECYDIPGLSYGVDS 133



 Score = 34.7 bits (76), Expect = 1.8
 Identities = 14/32 (43%), Positives = 22/32 (68%)
 Frame = +1

Query: 118 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPR 213
           +V+DNGS  C+AG+   + P  VF +I+ +PR
Sbjct: 5   IVIDNGSFNCRAGWMLKEKPALVFRNILAKPR 36


>UniRef50_Q6CF37 Cluster: Similar to sp|P53946 Saccharomyces
           cerevisiae YNL059c ARP5Actin- related protein; n=1;
           Yarrowia lipolytica|Rep: Similar to sp|P53946
           Saccharomyces cerevisiae YNL059c ARP5Actin- related
           protein - Yarrowia lipolytica (Candida lipolytica)
          Length = 724

 Score = 39.5 bits (88), Expect = 0.062
 Identities = 19/77 (24%), Positives = 43/77 (55%), Gaps = 3/77 (3%)
 Frame = +3

Query: 288 LTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPE---EHPVLLTEAPLNPKANREKMTQ 458
           L+ + P +  +V+NW   E++  +TF  +LRV  +   ++ +++ E   +P A R  + Q
Sbjct: 83  LSARSPYDGALVSNWTVAEEVLDYTF-AKLRVGSDGCVDNHIIMNELMSSPAAQRRNLQQ 141

Query: 459 IMFETFNTPAMYVAIQA 509
           ++FE +   ++ + + A
Sbjct: 142 VLFEGYGVRSVALGVDA 158


>UniRef50_Q0H7S7 Cluster: Actin; n=29; Sordariomycetes|Rep: Actin -
           Phaeoacremonium sphinctrophorum
          Length = 39

 Score = 39.5 bits (88), Expect = 0.062
 Identities = 16/19 (84%), Positives = 18/19 (94%)
 Frame = +1

Query: 142 MCKAGFAGDDAPRAVFPSI 198
           MCKAGFAGDDAPRAVF ++
Sbjct: 1   MCKAGFAGDDAPRAVFRNL 19


>UniRef50_Q5AXH1 Cluster: Actin-like protein arp6; n=5;
           Trichocomaceae|Rep: Actin-like protein arp6 - Emericella
           nidulans (Aspergillus nidulans)
          Length = 479

 Score = 39.5 bits (88), Expect = 0.062
 Identities = 20/69 (28%), Positives = 38/69 (55%), Gaps = 8/69 (11%)
 Frame = +3

Query: 288 LTLKYPIEHGIVTNWDDMEKIWHHTFYN-------ELRVA-PEEHPVLLTEAPLNPKANR 443
           +  + P+E G   NW+  ++IW ++F++       EL +A PE+  ++ TEAP    A +
Sbjct: 86  MLFRRPVEKGYTVNWEAQKEIWENSFFDERTVRSKELHIADPEDVTIIFTEAPNALPALQ 145

Query: 444 EKMTQIMFE 470
           +   +I+ E
Sbjct: 146 KNADEIIME 154


>UniRef50_A7EG89 Cluster: Putative uncharacterized protein; n=2;
           Sclerotiniaceae|Rep: Putative uncharacterized protein -
           Sclerotinia sclerotiorum 1980
          Length = 669

 Score = 39.1 bits (87), Expect = 0.082
 Identities = 23/67 (34%), Positives = 34/67 (50%), Gaps = 1/67 (1%)
 Frame = +3

Query: 300 YPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEH-PVLLTEAPLNPKANREKMTQIMFETF 476
           +P+  G + N        HH  +N+L  +P  H PV+L   P     N E +TQ +FE F
Sbjct: 97  WPLREGRIENLPAFCAFLHHV-HNQL--SPTLHTPVMLIAQPSWTAKNHEDLTQFIFEKF 153

Query: 477 NTPAMYV 497
            TPA+ +
Sbjct: 154 RTPALCI 160


>UniRef50_A1C924 Cluster: Actin family protein; n=4;
           Eurotiomycetidae|Rep: Actin family protein - Aspergillus
           clavatus
          Length = 436

 Score = 39.1 bits (87), Expect = 0.082
 Identities = 18/53 (33%), Positives = 32/53 (60%), Gaps = 8/53 (15%)
 Frame = +3

Query: 288 LTLKYPIEHGIVTNWDDMEKIWHHTFYNE-------LRVA-PEEHPVLLTEAP 422
           +  + P+E G + NW+  ++IW  +F++E       LR+  PE+  ++LTEAP
Sbjct: 86  MAFRRPVEKGYIVNWEAQKEIWETSFFDEKTVRSKDLRIENPEDTTLVLTEAP 138


>UniRef50_A4S172 Cluster: Predicted protein; n=3; Ostreococcus|Rep:
           Predicted protein - Ostreococcus lucimarinus CCE9901
          Length = 503

 Score = 38.7 bits (86), Expect = 0.11
 Identities = 18/63 (28%), Positives = 30/63 (47%)
 Frame = +3

Query: 288 LTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMF 467
           L L+ P + G V +W+   +I        L V P    +++TE P      RE + +++F
Sbjct: 88  LALRRPCDRGYVVHWEQQREILDDALRRTLGVDPTRCDLIITEPPFALPRTREALDEMVF 147

Query: 468 ETF 476
           E F
Sbjct: 148 EYF 150


>UniRef50_Q4WA13 Cluster: Chromatin remodeling complex subunit
           (Arp5), putative; n=14; Pezizomycotina|Rep: Chromatin
           remodeling complex subunit (Arp5), putative -
           Aspergillus fumigatus (Sartorya fumigata)
          Length = 757

 Score = 38.7 bits (86), Expect = 0.11
 Identities = 16/41 (39%), Positives = 28/41 (68%)
 Frame = +1

Query: 112 AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVG 234
           +A+V+DNGS + KAG++ D +PR + P ++ R R + +  G
Sbjct: 59  SAIVIDNGSSLLKAGWSFDVSPRFILPPVMSRYRDRKLNKG 99



 Score = 36.3 bits (80), Expect = 0.58
 Identities = 21/77 (27%), Positives = 38/77 (49%), Gaps = 5/77 (6%)
 Frame = +3

Query: 294 LKYPIEHG--IVTNWDDMEKIWHHTFYN---ELRVAPEEHPVLLTEAPLNPKANREKMTQ 458
           L+Y  + G  +V NWD ME +  + F     +      + P+++TE   N    R  M +
Sbjct: 117 LRYAFDPGTSVVGNWDVMEGLLDYVFIKLGVDGANGGVDRPIVMTEPIANLNYPRRMMNE 176

Query: 459 IMFETFNTPAMYVAIQA 509
           I+FE ++ P++   I +
Sbjct: 177 ILFECYSAPSVAYGIDS 193


>UniRef50_Q0UJ41 Cluster: Putative uncharacterized protein; n=1;
           Phaeosphaeria nodorum|Rep: Putative uncharacterized
           protein - Phaeosphaeria nodorum (Septoria nodorum)
          Length = 645

 Score = 38.7 bits (86), Expect = 0.11
 Identities = 22/63 (34%), Positives = 29/63 (46%)
 Frame = +3

Query: 300 YPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN 479
           +PI+ G + +W     +  H  YN L   P    +LL   P       EK+TQ  FE F 
Sbjct: 101 WPIQDGRIVDWPCFYALLTHV-YNTLN-PPFHTAILLIAQPAWTPREHEKLTQFFFEKFK 158

Query: 480 TPA 488
           TPA
Sbjct: 159 TPA 161


>UniRef50_Q9NZ32 Cluster: Actin-related protein 10; n=40;
           Eumetazoa|Rep: Actin-related protein 10 - Homo sapiens
           (Human)
          Length = 417

 Score = 38.7 bits (86), Expect = 0.11
 Identities = 15/34 (44%), Positives = 21/34 (61%)
 Frame = +1

Query: 106 EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGR 207
           E  A+V+D G    K GFAG+  PR + PS++ R
Sbjct: 12  EKTAVVIDLGEAFTKCGFAGETGPRCIIPSVIKR 45


>UniRef50_Q4QF49 Cluster: Actin-like protein, putative; n=2;
           Leishmania|Rep: Actin-like protein, putative -
           Leishmania major
          Length = 440

 Score = 38.3 bits (85), Expect = 0.14
 Identities = 18/67 (26%), Positives = 35/67 (52%), Gaps = 1/67 (1%)
 Frame = +3

Query: 306 IEHGIVTNWDDMEKIWHHTF-YNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNT 482
           +E+G++ +W+  E++        +L       P+L+TE  L P   R+K+ +++FET   
Sbjct: 82  LENGVIVDWEGYEELLSRVARILDLENVENSTPLLVTEKALVPTHQRQKIAEVLFETHRV 141

Query: 483 PAMYVAI 503
            A   A+
Sbjct: 142 VATSFAL 148


>UniRef50_Q6BXN0 Cluster: Actin-related protein 4; n=7;
           Saccharomycetales|Rep: Actin-related protein 4 -
           Debaryomyces hansenii (Yeast) (Torulaspora hansenii)
          Length = 492

 Score = 38.3 bits (85), Expect = 0.14
 Identities = 15/65 (23%), Positives = 37/65 (56%)
 Frame = +3

Query: 306 IEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTP 485
           ++  ++ +W+   + +H+ F + L +  +E P+L+TE        R+ + +  +E F+ P
Sbjct: 88  LKDSVIIDWEAAIEQYHYYFDDVLTLNYKEQPILITEPVWCTPQYRQTLLETFYENFDFP 147

Query: 486 AMYVA 500
           A+++A
Sbjct: 148 ALFLA 152



 Score = 35.9 bits (79), Expect = 0.77
 Identities = 15/49 (30%), Positives = 28/49 (57%)
 Frame = +1

Query: 103 EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKD 249
           +E+ A+V+D+ S   + G+AGDD P+ + PS    P    + +   +K+
Sbjct: 14  DEINAIVLDSSSFHTRIGYAGDDFPKIITPSSYASPNEDAMELDNKKKN 62


>UniRef50_P45890 Cluster: Actin-like protein 13E; n=8;
           Eumetazoa|Rep: Actin-like protein 13E - Drosophila
           melanogaster (Fruit fly)
          Length = 398

 Score = 37.9 bits (84), Expect = 0.19
 Identities = 19/83 (22%), Positives = 41/83 (49%), Gaps = 3/83 (3%)
 Frame = +3

Query: 255 VGDEAQSKRGILTLKYPI--EHGIVTNWDDMEKIWHHTFYNE-LRVAPEEHPVLLTEAPL 425
           VG++    R    L Y +  + G + NW   + +W + F  + +  + E   +++TE  +
Sbjct: 44  VGNQIDECRDTSALYYILAFQRGYLLNWHTQKTVWDYIFSKDGIGCSLENRNIVITEPQM 103

Query: 426 NPKANREKMTQIMFETFNTPAMY 494
           N ++ +E   +I+FE +    +Y
Sbjct: 104 NFQSIQEATLEILFEEYKVDGVY 126


>UniRef50_Q7SHR0 Cluster: Actin-related protein 4; n=16;
           Pezizomycotina|Rep: Actin-related protein 4 - Neurospora
           crassa
          Length = 469

 Score = 37.9 bits (84), Expect = 0.19
 Identities = 16/36 (44%), Positives = 24/36 (66%)
 Frame = +3

Query: 393 EHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVA 500
           E+P+L+TEAP N    REK  +I  ET+  PA +++
Sbjct: 145 ENPLLMTEAPWNSPKAREKAIEISMETWGVPAFWLS 180



 Score = 37.5 bits (83), Expect = 0.25
 Identities = 16/34 (47%), Positives = 24/34 (70%)
 Frame = +1

Query: 103 EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVG 204
           +EV+ALV+D G    +AG+AG++ P+ V PS  G
Sbjct: 20  DEVSALVLDPGYCNTRAGYAGEEMPKQVLPSFYG 53


>UniRef50_Q23FF9 Cluster: Actin family protein; n=2; Tetrahymena
           thermophila|Rep: Actin family protein - Tetrahymena
           thermophila SB210
          Length = 426

 Score = 37.5 bits (83), Expect = 0.25
 Identities = 18/66 (27%), Positives = 39/66 (59%), Gaps = 1/66 (1%)
 Frame = +3

Query: 276 KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAP-EEHPVLLTEAPLNPKANREKM 452
           K+  L  K+PI++G + ++D +  ++ +     L+V       +L+ ++PLNPK  + K+
Sbjct: 108 KKFELEEKFPIQNGKIVDFDAIRDLYTYALEKLLQVNEISSCNLLIIDSPLNPKNYKHKL 167

Query: 453 TQIMFE 470
            +I+F+
Sbjct: 168 AEILFD 173


>UniRef50_A3FQH9 Cluster: Actin-like protein, putative; n=2;
           Cryptosporidium|Rep: Actin-like protein, putative -
           Cryptosporidium parvum Iowa II
          Length = 367

 Score = 37.5 bits (83), Expect = 0.25
 Identities = 17/58 (29%), Positives = 33/58 (56%)
 Frame = +3

Query: 303 PIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETF 476
           P   G++ +      IW + F N++ ++P +  +L+TE  LNP + +  + +I+FE F
Sbjct: 44  PFSEGLLIDVSMENDIWEYIF-NKMNISPGDIGLLVTEPFLNPSSLQHSLFEIIFEQF 100


>UniRef50_A3FQE6 Cluster: Putative uncharacterized protein; n=2;
           Cryptosporidium|Rep: Putative uncharacterized protein -
           Cryptosporidium parvum Iowa II
          Length = 396

 Score = 37.5 bits (83), Expect = 0.25
 Identities = 13/36 (36%), Positives = 25/36 (69%)
 Frame = +1

Query: 112 AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQ 219
           +++++D G+   +AG+ GDD PR+V P+ +G P  +
Sbjct: 15  SSIILDIGTQSIRAGYGGDDLPRSVVPTCIGIPNKE 50


>UniRef50_A6RD01 Cluster: Putative uncharacterized protein; n=1;
           Ajellomyces capsulatus NAm1|Rep: Putative
           uncharacterized protein - Ajellomyces capsulatus NAm1
          Length = 762

 Score = 37.5 bits (83), Expect = 0.25
 Identities = 26/102 (25%), Positives = 46/102 (45%), Gaps = 6/102 (5%)
 Frame = +3

Query: 222 RDGRYGTEGLLVGDEAQ---SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYN---ELRV 383
           RD ++      VG +A    + RG +   +     ++ NWD ME +  + F     +   
Sbjct: 144 RDRKFNRTCHFVGYDAYVDATTRGQVRNAFDPGSSVIGNWDVMEGVLDYIFLKLGVDGAN 203

Query: 384 APEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQA 509
              + P++LTE   N    R  M +I+FE ++ PA+   I +
Sbjct: 204 GSVDRPIVLTEPIANLGYTRRMMNEILFECYSAPAVAYGIDS 245



 Score = 36.7 bits (81), Expect = 0.44
 Identities = 14/34 (41%), Positives = 25/34 (73%)
 Frame = +1

Query: 112 AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPR 213
           +A+V+DNGS + KAG++ D +PR + P ++ + R
Sbjct: 111 SAIVIDNGSYLVKAGWSFDKSPRFIIPPVMAKYR 144


>UniRef50_Q09443 Cluster: Actin-like protein C08B11.6; n=2;
           Caenorhabditis|Rep: Actin-like protein C08B11.6 -
           Caenorhabditis elegans
          Length = 418

 Score = 37.5 bits (83), Expect = 0.25
 Identities = 21/72 (29%), Positives = 35/72 (48%)
 Frame = +3

Query: 261 DEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKAN 440
           +E   K  +  ++ PIE G V NWD  ++IW  TF   + V      + LT+      A 
Sbjct: 49  EECSDKFSLFYVR-PIERGYVVNWDTQQQIWEKTF-GSMDVEASTSRIALTDNNYLIPAL 106

Query: 441 REKMTQIMFETF 476
            +  ++I+F+ F
Sbjct: 107 PDVSSEILFDYF 118


>UniRef50_UPI00006CC3F4 Cluster: Actin family protein; n=1;
           Tetrahymena thermophila SB210|Rep: Actin family protein
           - Tetrahymena thermophila SB210
          Length = 725

 Score = 37.1 bits (82), Expect = 0.33
 Identities = 17/69 (24%), Positives = 37/69 (53%), Gaps = 2/69 (2%)
 Frame = +3

Query: 303 PIEHGIVTNWDDMEKIWHHTFYNELRVAPE--EHPVLLTEAPLNPKANREKMTQIMFETF 476
           P E  I+  +  +E + +   +NE+ V     +HP+++TE   NP+  R+ + +  FE +
Sbjct: 106 PYERNIIQQFGLLENL-NDFIFNEIGVVESKVDHPLIITEPVANPEYCRQNLLEQYFECY 164

Query: 477 NTPAMYVAI 503
             P++ + +
Sbjct: 165 EIPSVMIGV 173


>UniRef50_A7TST0 Cluster: Putative uncharacterized protein; n=1;
           Vanderwaltozyma polyspora DSM 70294|Rep: Putative
           uncharacterized protein - Vanderwaltozyma polyspora DSM
           70294
          Length = 501

 Score = 37.1 bits (82), Expect = 0.33
 Identities = 14/34 (41%), Positives = 23/34 (67%)
 Frame = +1

Query: 103 EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVG 204
           +E++A+V+D GS     G++G D P+A+ PS  G
Sbjct: 12  DEISAVVIDPGSFTTNIGYSGTDCPQAILPSYYG 45



 Score = 35.5 bits (78), Expect = 1.0
 Identities = 19/70 (27%), Positives = 33/70 (47%), Gaps = 1/70 (1%)
 Frame = +3

Query: 294 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEH-PVLLTEAPLNPKANREKMTQIMFE 470
           +K  +++G V +WD  ++ W     N L +      P  LTE   N   NR+K  +++ E
Sbjct: 88  IKPIVKNGEVIDWDGAQEQWDWALKNALYLESNSGIPAFLTEPIWNTVENRKKSLEVLLE 147

Query: 471 TFNTPAMYVA 500
                A Y++
Sbjct: 148 GLQFEACYLS 157


>UniRef50_Q4UGT7 Cluster: Actin-related protein, putative; n=2;
           Theileria|Rep: Actin-related protein, putative -
           Theileria annulata
          Length = 575

 Score = 36.7 bits (81), Expect = 0.44
 Identities = 15/32 (46%), Positives = 22/32 (68%)
 Frame = +1

Query: 118 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPR 213
           +V++NGSG  K G AG+  P  V P+ VG+P+
Sbjct: 12  VVLENGSGYVKIGMAGNKKPPHVIPNCVGQPK 43



 Score = 36.7 bits (81), Expect = 0.44
 Identities = 20/50 (40%), Positives = 28/50 (56%), Gaps = 1/50 (2%)
 Frame = +3

Query: 369 NELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTP-AMYVAIQACS 515
           N L V PE   + LTEA L P  +R+   +I+FE F  P A +++ Q  S
Sbjct: 128 NYLSVIPESSSICLTEANLCPAQSRQLSAEIIFEDFGFPLACFLSSQTAS 177


>UniRef50_Q19R70 Cluster: Actin-like protein 3; n=4; Leishmania|Rep:
           Actin-like protein 3 - Leishmania major
          Length = 519

 Score = 36.7 bits (81), Expect = 0.44
 Identities = 24/90 (26%), Positives = 43/90 (47%), Gaps = 13/90 (14%)
 Frame = +3

Query: 240 TEGLLVGDEAQSKRGILTLKYPIEH-GIVTNWDDMEKIWHHTFYNEL----------RVA 386
           T   +VG +A S+RG+L L  PI+H G++ +W     +   +  N L          +  
Sbjct: 79  TSCFVVGSDAASRRGVLRLSRPIQHGGVIMDWVGTRPLLRQSIQNALVPPSSSLAVRQPL 138

Query: 387 PEEHPVL--LTEAPLNPKANREKMTQIMFE 470
            E   V+  L E+P   +  R ++ +++FE
Sbjct: 139 EEGEDVIYSLVESPYASRPQRARLAELLFE 168


>UniRef50_A7D8V0 Cluster: Putative uncharacterized protein; n=2;
           Methylobacterium extorquens PA1|Rep: Putative
           uncharacterized protein - Methylobacterium extorquens
           PA1
          Length = 202

 Score = 36.3 bits (80), Expect = 0.58
 Identities = 18/51 (35%), Positives = 26/51 (50%), Gaps = 4/51 (7%)
 Frame = -1

Query: 571 PPSPEV----QHDTGGTTGRVQREHAWMATYMAGVLNVSNMIWVIFSLLAL 431
           PPSP            T+GR+QR   W+ T +  +L +   +WV+F LL L
Sbjct: 5   PPSPAPTIAPSEPADHTSGRMQRIRRWLLTEVKRILGIFAYLWVVFGLLIL 55


>UniRef50_Q75BT7 Cluster: ACR184Cp; n=1; Eremothecium gossypii|Rep:
           ACR184Cp - Ashbya gossypii (Yeast) (Eremothecium
           gossypii)
          Length = 401

 Score = 35.9 bits (79), Expect = 0.77
 Identities = 16/59 (27%), Positives = 29/59 (49%)
 Frame = +3

Query: 315 GIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAM 491
           G+ T+W+ +E+     +  +LRV PEE PV +T  P      R +  +++      P +
Sbjct: 65  GVPTDWEMLERFCRWIYATQLRVGPEELPVCITVPPDLSATVRSQFHELVLCKLRAPVL 123


>UniRef50_Q02B84 Cluster: Putative uncharacterized protein; n=1;
           Solibacter usitatus Ellin6076|Rep: Putative
           uncharacterized protein - Solibacter usitatus (strain
           Ellin6076)
          Length = 482

 Score = 35.1 bits (77), Expect = 1.3
 Identities = 21/60 (35%), Positives = 29/60 (48%), Gaps = 1/60 (1%)
 Frame = -1

Query: 310 SMGYLRVR-IPLLLCASSPTKSPSVPYRPSRPDGGAFPRSRGTRREEHHLLRNRPCTYRS 134
           S G LR+   P L  A++P    S P   + P   A PRS GTR+  H +  + P   R+
Sbjct: 357 SGGSLRLEPAPSLAAAAAPPSMNSAPANAAPPTAAAEPRSTGTRKAVHEVQPSIPAGIRA 416


>UniRef50_Q19R52 Cluster: ALP5; n=6; Trypanosomatidae|Rep: ALP5 -
           Trypanosoma cruzi strain CL Brener
          Length = 422

 Score = 35.1 bits (77), Expect = 1.3
 Identities = 25/82 (30%), Positives = 47/82 (57%), Gaps = 3/82 (3%)
 Frame = +3

Query: 264 EAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNEL-RVAPEE--HPVLLTEAPLNPK 434
           +A + R    +   IE G V +W+ ME++   ++ +EL +++ +E   P+LLTE  L P+
Sbjct: 70  KAYNCRATTEVSRVIEKGEV-DWEAMEQLL--SYLDELLQLSSKEVQTPLLLTEKMLVPR 126

Query: 435 ANREKMTQIMFETFNTPAMYVA 500
             R+K+ +I+ E     A++ A
Sbjct: 127 TQRQKLAEILMEKHGVTAVHFA 148


>UniRef50_Q5K9I3 Cluster: Protein-vacuolar targeting-related
           protein, putative; n=1; Filobasidiella neoformans|Rep:
           Protein-vacuolar targeting-related protein, putative -
           Cryptococcus neoformans (Filobasidiella neoformans)
          Length = 724

 Score = 35.1 bits (77), Expect = 1.3
 Identities = 23/108 (21%), Positives = 50/108 (46%), Gaps = 2/108 (1%)
 Frame = +3

Query: 192 LDRGKAPPSGRDGRYGTEGLLVGDEAQSKRGILTLKYPIEHG-IVTNWDDMEKIWHHTFY 368
           +DR       ++ ++G   LL G +  +     +    +  G ++   D +E     TF 
Sbjct: 54  IDRINMVSRYKERKFGKNVLLFGGDTDADANSRSNARSMFDGDLLIQGDMLECALDFTFC 113

Query: 369 NELRVAPE-EHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQA 509
                 P+ +HP+++TE   NP  +R   ++++FE +N P++   + +
Sbjct: 114 QLGIDTPQIQHPIVMTERLANPLFSRAMTSELLFELYNAPSVAFGVDS 161


>UniRef50_Q5FT07 Cluster: Glycosyltransferase; n=1; Gluconobacter
           oxydans|Rep: Glycosyltransferase - Gluconobacter oxydans
           (Gluconobacter suboxydans)
          Length = 904

 Score = 34.7 bits (76), Expect = 1.8
 Identities = 16/31 (51%), Positives = 18/31 (58%)
 Frame = -1

Query: 598 RKMGHGCGRPPSPEVQHDTGGTTGRVQREHA 506
           R +  G GRP    VQHD GG  GRV RE +
Sbjct: 543 RLLQQGAGRPAILMVQHDAGGGVGRVVRERS 573


>UniRef50_Q8I450 Cluster: Actin-related protein, putative; n=5;
           Plasmodium|Rep: Actin-related protein, putative -
           Plasmodium falciparum (isolate 3D7)
          Length = 565

 Score = 34.7 bits (76), Expect = 1.8
 Identities = 15/35 (42%), Positives = 22/35 (62%)
 Frame = +1

Query: 106 EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRP 210
           ++ ++V+D G    K G+AGD+ P  VF S VG P
Sbjct: 6   DILSIVIDLGFENTKVGYAGDENPTNVFSSNVGMP 40


>UniRef50_Q9UTQ7 Cluster: SWI/SNF and RSC complex subunit Arp9; n=1;
           Schizosaccharomyces pombe|Rep: SWI/SNF and RSC complex
           subunit Arp9 - Schizosaccharomyces pombe (Fission yeast)
          Length = 523

 Score = 34.7 bits (76), Expect = 1.8
 Identities = 21/72 (29%), Positives = 32/72 (44%), Gaps = 4/72 (5%)
 Frame = +3

Query: 303 PIEHGIVTNWDDMEKIWHHTFYNELRVAPEE----HPVLLTEAPLNPKANREKMTQIMFE 470
           PI+ G V +W+ ++  W H  Y+ L   P +    +PV L         +RE  TQ  FE
Sbjct: 113 PIQRGRVVDWEALKAFWKH-LYSLLLKDPNDTTFRYPVCLVIPTYWSLYDRELATQFFFE 171

Query: 471 TFNTPAMYVAIQ 506
               P   +A +
Sbjct: 172 ECQVPGFTIAYE 183


>UniRef50_Q7RR61 Cluster: Actin-like 6; n=3; Plasmodium
           (Vinckeia)|Rep: Actin-like 6 - Plasmodium yoelii yoelii
          Length = 538

 Score = 34.3 bits (75), Expect = 2.3
 Identities = 14/35 (40%), Positives = 24/35 (68%)
 Frame = +1

Query: 106 EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRP 210
           +V+++V+D G    K G++GD+ P+ +F S VG P
Sbjct: 6   DVSSIVIDLGFENIKLGYSGDENPKNIFSSNVGVP 40


>UniRef50_Q4Q9A1 Cluster: Putative uncharacterized protein; n=3;
           Leishmania|Rep: Putative uncharacterized protein -
           Leishmania major
          Length = 689

 Score = 34.3 bits (75), Expect = 2.3
 Identities = 19/57 (33%), Positives = 29/57 (50%)
 Frame = +3

Query: 234 YGTEGLLVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPV 404
           YG  G  VG+  Q     L++ +P EH  V +   M  + +H FY E+R   ++ PV
Sbjct: 429 YGVPGGAVGEVMQVGPHFLSIHFPREHRTV-DIPRMRVVCYHPFYPEIRYELQQFPV 484


>UniRef50_A4RLB1 Cluster: Putative uncharacterized protein; n=1;
           Magnaporthe grisea|Rep: Putative uncharacterized protein
           - Magnaporthe grisea (Rice blast fungus) (Pyricularia
           grisea)
          Length = 445

 Score = 34.3 bits (75), Expect = 2.3
 Identities = 15/41 (36%), Positives = 25/41 (60%)
 Frame = +3

Query: 375 LRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYV 497
           L +A  E+P+L+TE+P N    REK  ++  E +  PA ++
Sbjct: 95  LELALGENPLLMTESPWNTPKAREKAIELAMEGWGVPAFWL 135


>UniRef50_UPI00015B5EE4 Cluster: PREDICTED: similar to Actin-related
           protein 10 homolog (S. cerevisiae); n=1; Nasonia
           vitripennis|Rep: PREDICTED: similar to Actin-related
           protein 10 homolog (S. cerevisiae) - Nasonia vitripennis
          Length = 373

 Score = 33.9 bits (74), Expect = 3.1
 Identities = 12/48 (25%), Positives = 27/48 (56%)
 Frame = +3

Query: 354 HHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYV 497
           H+ F+    ++P++  +++ E+PL P   R  + ++MF  F   ++ V
Sbjct: 73  HYIFFKRTVISPKDIRIVILESPLIPSKFRNTLVKVMFRHFEVGSLMV 120


>UniRef50_UPI000023E19F Cluster: hypothetical protein FG04383.1;
           n=1; Gibberella zeae PH-1|Rep: hypothetical protein
           FG04383.1 - Gibberella zeae PH-1
          Length = 422

 Score = 33.9 bits (74), Expect = 3.1
 Identities = 18/40 (45%), Positives = 23/40 (57%), Gaps = 1/40 (2%)
 Frame = -1

Query: 295 RVRIPLLLCASSPTKSPSVPYRPSRPDGGAFP-RSRGTRR 179
           R R+P+LL    P + PS PYRPSR      P RS+  +R
Sbjct: 136 RERLPILLFDGLPFRIPSRPYRPSRIPSNTVPDRSKQGKR 175


>UniRef50_A7AS14 Cluster: Actin, putative; n=1; Babesia bovis|Rep:
           Actin, putative - Babesia bovis
          Length = 382

 Score = 33.9 bits (74), Expect = 3.1
 Identities = 17/82 (20%), Positives = 39/82 (47%)
 Frame = +3

Query: 258 GDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 437
           G+E Q +   ++    ++HG + ++D    +W + F + + V P+   VL+ E  L    
Sbjct: 52  GNECQQRMSYMSTTNVVDHGHIFDYDIAAGLWKYAF-DTMDVEPKGASVLMIEPVLCSAE 110

Query: 438 NREKMTQIMFETFNTPAMYVAI 503
           +  K  +I+ E      ++ ++
Sbjct: 111 HHRKTGEILLEGMGVEEIHTSM 132


>UniRef50_A5E5Q2 Cluster: Putative uncharacterized protein; n=1;
           Lodderomyces elongisporus NRRL YB-4239|Rep: Putative
           uncharacterized protein - Lodderomyces elongisporus
           (Yeast) (Saccharomyces elongisporus)
          Length = 541

 Score = 33.9 bits (74), Expect = 3.1
 Identities = 16/76 (21%), Positives = 42/76 (55%), Gaps = 2/76 (2%)
 Frame = +3

Query: 291 TLKYPI-EHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMF 467
           T  +PI  + ++T+WD     + + ++  L++   + P+++TE   +    R+ + + ++
Sbjct: 67  TTVHPIVTNSLITDWDAAMDQFAY-YFKLLKIEQNDQPIMITEPIWSTYEYRKTLVEKIY 125

Query: 468 ETFNTPAMY-VAIQAC 512
             F+ PA+Y + + +C
Sbjct: 126 AKFDFPALYLIKVPSC 141



 Score = 32.7 bits (71), Expect = 7.1
 Identities = 15/43 (34%), Positives = 26/43 (60%)
 Frame = +1

Query: 103 EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMV 231
           +E+ A+++D G+   + G+AGDD P+ +  S  G+   QG  V
Sbjct: 13  DEINAIILDIGTHTTRIGYAGDDFPKIITTSNYGK-TSQGTKV 54


>UniRef50_UPI0000E477BD Cluster: PREDICTED: similar to
           uncharacterized hypothalamus protein HARP11; n=1;
           Strongylocentrotus purpuratus|Rep: PREDICTED: similar to
           uncharacterized hypothalamus protein HARP11 -
           Strongylocentrotus purpuratus
          Length = 481

 Score = 33.5 bits (73), Expect = 4.1
 Identities = 15/30 (50%), Positives = 18/30 (60%)
 Frame = +1

Query: 106 EVAALVVDNGSGMCKAGFAGDDAPRAVFPS 195
           E  A V D G+   K GFAG+ +PRA  PS
Sbjct: 12  EKTAAVFDIGAAYTKVGFAGETSPRATIPS 41


>UniRef50_Q5FQJ4 Cluster: GDP-6-deoxy-D-lyxo-4-hexulose reductase;
           n=3; Acetobacteraceae|Rep: GDP-6-deoxy-D-lyxo-4-hexulose
           reductase - Gluconobacter oxydans (Gluconobacter
           suboxydans)
          Length = 302

 Score = 33.5 bits (73), Expect = 4.1
 Identities = 17/30 (56%), Positives = 19/30 (63%), Gaps = 1/30 (3%)
 Frame = -2

Query: 579 VEDPRRRKSSTIPVVRPDA-YSESTLGWRR 493
           V DP R + S IP+ R DA    STLGWRR
Sbjct: 252 VTDPDRLRPSDIPIARGDATLITSTLGWRR 281


>UniRef50_A7AQU0 Cluster: Actin-related, putative; n=1; Babesia
           bovis|Rep: Actin-related, putative - Babesia bovis
          Length = 508

 Score = 33.5 bits (73), Expect = 4.1
 Identities = 14/33 (42%), Positives = 19/33 (57%)
 Frame = +1

Query: 121 VVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQ 219
           VVDNGSG+ K   A    P  V P+ +G P+ +
Sbjct: 13  VVDNGSGLLKFSLASSVKPPFVLPNCIGHPKRK 45


>UniRef50_A5KAY0 Cluster: Actin-related protein, putative; n=1;
           Plasmodium vivax|Rep: Actin-related protein, putative -
           Plasmodium vivax
          Length = 600

 Score = 33.5 bits (73), Expect = 4.1
 Identities = 15/35 (42%), Positives = 22/35 (62%)
 Frame = +1

Query: 106 EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRP 210
           ++ ++VVD G    K G+AGD+ P  +F S VG P
Sbjct: 6   DILSIVVDLGFENTKIGYAGDENPTNIFSSNVGVP 40


>UniRef50_Q4P820 Cluster: Putative uncharacterized protein; n=1;
           Ustilago maydis|Rep: Putative uncharacterized protein -
           Ustilago maydis (Smut fungus)
          Length = 724

 Score = 33.5 bits (73), Expect = 4.1
 Identities = 22/78 (28%), Positives = 34/78 (43%), Gaps = 10/78 (12%)
 Frame = +3

Query: 288 LTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAP----------EEHPVLLTEAPLNPKA 437
           L L+ P + GIV +W   + IW H   N L   P              V++TEA LN + 
Sbjct: 126 LHLRLPHQSGIVVDWAAQKTIWDHVLTNHLAKLPGGIAKRGKLLAGKAVIMTEAYLNLEP 185

Query: 438 NREKMTQIMFETFNTPAM 491
            +     ++FE +   A+
Sbjct: 186 AQHATDLLLFEHYGAQAV 203


>UniRef50_Q5Z237 Cluster: Putative uncharacterized protein; n=1;
           Nocardia farcinica|Rep: Putative uncharacterized protein
           - Nocardia farcinica
          Length = 156

 Score = 33.1 bits (72), Expect = 5.4
 Identities = 19/49 (38%), Positives = 22/49 (44%)
 Frame = +3

Query: 465 FETFNTPAMYVAIQACSRCTRPVVPPVSCWTSGDGGLPHPCPILRKGFR 611
           F TF    M   I  C+  T P  PP+   T   G  P P P+LR G R
Sbjct: 66  FPTFGDMPMTRQIGPCA-ATHPPAPPIVRPTRRVGARPRPRPVLRTGLR 113


>UniRef50_Q8SRZ3 Cluster: ACTIN-RELATED PROTEIN; n=1;
           Encephalitozoon cuniculi|Rep: ACTIN-RELATED PROTEIN -
           Encephalitozoon cuniculi
          Length = 555

 Score = 33.1 bits (72), Expect = 5.4
 Identities = 13/32 (40%), Positives = 24/32 (75%)
 Frame = +1

Query: 118 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPR 213
           +V+DNG+  CKAG+ G ++P+ VF +++ R +
Sbjct: 23  IVIDNGTYECKAGYCG-ESPQMVFKNVLYRQK 53


>UniRef50_Q2H309 Cluster: Putative uncharacterized protein; n=1;
           Chaetomium globosum|Rep: Putative uncharacterized
           protein - Chaetomium globosum (Soil fungus)
          Length = 675

 Score = 33.1 bits (72), Expect = 5.4
 Identities = 18/64 (28%), Positives = 31/64 (48%)
 Frame = +3

Query: 300 YPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN 479
           YPI+ G + N +       H  + +L       PV+L  +P   + + E +T+ +FE   
Sbjct: 103 YPIQAGRIANMEAFLAFLEHV-HAQLTTTYHNTPVMLMASPQWTRPDCETITRYVFEKTK 161

Query: 480 TPAM 491
           TPA+
Sbjct: 162 TPAL 165


>UniRef50_Q5ZDG3 Cluster: Putative uncharacterized protein
           P0493G01.18; n=1; Oryza sativa (japonica
           cultivar-group)|Rep: Putative uncharacterized protein
           P0493G01.18 - Oryza sativa subsp. japonica (Rice)
          Length = 614

 Score = 32.7 bits (71), Expect = 7.1
 Identities = 16/38 (42%), Positives = 19/38 (50%)
 Frame = -1

Query: 316 PCSMGYLRVRIPLLLCASSPTKSPSVPYRPSRPDGGAF 203
           P S  + R  +PLL  ASSP+ SPS       PD   F
Sbjct: 217 PSSSSHQRQSVPLLFLASSPSASPSASMAVVNPDPALF 254


>UniRef50_A2ZT75 Cluster: Putative uncharacterized protein; n=1;
           Oryza sativa (japonica cultivar-group)|Rep: Putative
           uncharacterized protein - Oryza sativa subsp. japonica
           (Rice)
          Length = 583

 Score = 32.7 bits (71), Expect = 7.1
 Identities = 16/38 (42%), Positives = 19/38 (50%)
 Frame = -1

Query: 316 PCSMGYLRVRIPLLLCASSPTKSPSVPYRPSRPDGGAF 203
           P S  + R  +PLL  ASSP+ SPS       PD   F
Sbjct: 268 PSSSSHQRQSVPLLFLASSPSASPSASMAVVNPDPALF 305


>UniRef50_Q4DAD3 Cluster: Putative uncharacterized protein; n=2;
           Trypanosoma cruzi|Rep: Putative uncharacterized protein
           - Trypanosoma cruzi
          Length = 842

 Score = 32.7 bits (71), Expect = 7.1
 Identities = 21/61 (34%), Positives = 30/61 (49%), Gaps = 1/61 (1%)
 Frame = +2

Query: 425 QPQGQQREDDPDHVRNIQHARHVRRHPSVLSL-YASGRTTGIVLDFRRRGSSTPVPHFTK 601
           + Q QQ++DD DH   +  A    R+PS+LS    SG+   +V+    R S    P  T 
Sbjct: 781 EKQQQQKDDDGDHDEVVPSATARSRNPSLLSPGVGSGQFVPLVVSLPSRQSGPSRPANTS 840

Query: 602 G 604
           G
Sbjct: 841 G 841


>UniRef50_A7AWQ4 Cluster: Actin, putative; n=1; Babesia bovis|Rep:
           Actin, putative - Babesia bovis
          Length = 405

 Score = 32.7 bits (71), Expect = 7.1
 Identities = 14/39 (35%), Positives = 24/39 (61%)
 Frame = +3

Query: 393 EHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQA 509
           +HP+++TE     K  R+   +I+FE  + PA Y+A +A
Sbjct: 126 QHPMMVTEPTAECKQFRDCTLEILFEQLDVPAAYLAKRA 164


>UniRef50_A4UCC4 Cluster: Putative uncharacterized protein; n=1;
           Magnaporthe grisea|Rep: Putative uncharacterized protein
           - Magnaporthe grisea (Rice blast fungus) (Pyricularia
           grisea)
          Length = 633

 Score = 32.7 bits (71), Expect = 7.1
 Identities = 21/70 (30%), Positives = 34/70 (48%), Gaps = 1/70 (1%)
 Frame = -1

Query: 415 SVSRTGCSSGATRSSL*KV*CQIFSMSSQLVTIPCSMGYLRVRIPLLLCASSPTK-SPSV 239
           S+  +G   G T  S+ ++      +  Q +T P +MG +R  +  LL    P+  +PS+
Sbjct: 434 SLHTSGVEFGITTESVQEMGNVCLRVLKQTITAPAAMG-IRADLERLLATGIPSDLAPSI 492

Query: 238 PYRPSRPDGG 209
           P  P  P GG
Sbjct: 493 PESPEIPIGG 502


>UniRef50_Q6BML9 Cluster: Actin-like protein ARP6; n=3;
           Saccharomycetaceae|Rep: Actin-like protein ARP6 -
           Debaryomyces hansenii (Yeast) (Torulaspora hansenii)
          Length = 409

 Score = 32.7 bits (71), Expect = 7.1
 Identities = 29/108 (26%), Positives = 46/108 (42%), Gaps = 6/108 (5%)
 Frame = +3

Query: 189 PLDRGKAPPSGRDGRY--GTEGLLVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHT 362
           P+    A    RDG    G E L+   +  +  G++  K P +HG + +W+  + +W +T
Sbjct: 25  PIKHQNALSKARDGLIYVGNEYLV---QTNNYSGMI-FKRPYDHGHLISWETEKAVWDYT 80

Query: 363 FY----NELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMY 494
           F     N+   A   H + LTE P           QI+FE +     Y
Sbjct: 81  FNKASPNQELDASITH-LTLTETPFQLPQLSMNTDQIVFEEYGFNEYY 127


>UniRef50_Q8AXX1 Cluster: Putative gag protein; n=1; Danio
           rerio|Rep: Putative gag protein - Danio rerio
           (Zebrafish) (Brachydanio rerio)
          Length = 612

 Score = 32.3 bits (70), Expect = 9.4
 Identities = 13/27 (48%), Positives = 18/27 (66%)
 Frame = -3

Query: 167 SPAKPALHIPEPLSTTNAATSSSHILN 87
           SP  P+ H+P P S+  +A SSSH+ N
Sbjct: 62  SPITPSRHLPSPASSYASARSSSHVSN 88


>UniRef50_Q5LUD8 Cluster: Putative uncharacterized protein; n=1;
           Silicibacter pomeroyi|Rep: Putative uncharacterized
           protein - Silicibacter pomeroyi
          Length = 641

 Score = 32.3 bits (70), Expect = 9.4
 Identities = 15/33 (45%), Positives = 19/33 (57%)
 Frame = +3

Query: 213 PSGRDGRYGTEGLLVGDEAQSKRGILTLKYPIE 311
           P   DGR+G       D+AQS+ G+ T KYP E
Sbjct: 438 PGVIDGRWGPNTQAAWDKAQSELGLSTTKYPTE 470


>UniRef50_Q1NK22 Cluster: Electron-transferring-flavoprotein
           dehydrogenase; n=2; delta proteobacterium MLMS-1|Rep:
           Electron-transferring-flavoprotein dehydrogenase - delta
           proteobacterium MLMS-1
          Length = 553

 Score = 32.3 bits (70), Expect = 9.4
 Identities = 21/43 (48%), Positives = 22/43 (51%), Gaps = 4/43 (9%)
 Frame = -1

Query: 244 SVPYRPSRP-DGGAFPRSRGT-RREEH--HLLRNRPCTYRSHC 128
           S PY+PSRP D  AF    GT  REE   HLL   P   R  C
Sbjct: 448 SYPYKPSRPFDKDAFTAKSGTGHREEEPCHLLIADPAICREQC 490


>UniRef50_Q5BXM4 Cluster: SJCHGC05761 protein; n=1; Schistosoma
           japonicum|Rep: SJCHGC05761 protein - Schistosoma
           japonicum (Blood fluke)
          Length = 246

 Score = 32.3 bits (70), Expect = 9.4
 Identities = 14/35 (40%), Positives = 20/35 (57%)
 Frame = +1

Query: 106 EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRP 210
           E  A+V D G+   K GFAG+  PR + P+ +  P
Sbjct: 33  EKTAVVFDIGTVYTKCGFAGETGPRFIIPTAITLP 67


>UniRef50_Q4D7T4 Cluster: Putative uncharacterized protein; n=2;
           Trypanosoma cruzi|Rep: Putative uncharacterized protein
           - Trypanosoma cruzi
          Length = 565

 Score = 32.3 bits (70), Expect = 9.4
 Identities = 17/48 (35%), Positives = 25/48 (52%)
 Frame = +2

Query: 338 HGEDLASYLLQ*AACRPRGTPSPAH*GSPQPQGQQREDDPDHVRNIQH 481
           H ED+  ++ + +A  PR T  P H G+  P+G QRE+     R   H
Sbjct: 37  HPEDVMGFIHEWSA--PRRTGGPTHTGTSCPEGAQREEAVSSERKQSH 82


>UniRef50_Q2PE20 Cluster: CG10067-PB, isoform B; n=1; Drosophila
           melanogaster|Rep: CG10067-PB, isoform B - Drosophila
           melanogaster (Fruit fly)
          Length = 36

 Score = 32.3 bits (70), Expect = 9.4
 Identities = 13/15 (86%), Positives = 15/15 (100%)
 Frame = +1

Query: 94  MCDEEVAALVVDNGS 138
           MCD+EVAALVVDNG+
Sbjct: 1   MCDDEVAALVVDNGA 15


>UniRef50_A6RCR5 Cluster: Predicted protein; n=1; Ajellomyces
           capsulatus NAm1|Rep: Predicted protein - Ajellomyces
           capsulatus NAm1
          Length = 509

 Score = 32.3 bits (70), Expect = 9.4
 Identities = 21/76 (27%), Positives = 33/76 (43%), Gaps = 1/76 (1%)
 Frame = +3

Query: 378 RVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQACSRCTRPVVPPVS-CW 554
           +V PE H V++ EAP    A+ E   +    +   P      +  S  T PV+   S C 
Sbjct: 418 KVVPEPHQVVIDEAPPVYGASNENQEKNQMSSSTEPMPVYESKDSSTVTAPVLTTSSACQ 477

Query: 555 TSGDGGLPHPCPILRK 602
           T+G+   P   P + +
Sbjct: 478 TTGEPPSPPSTPTVEE 493


>UniRef50_Q0W6D4 Cluster: Putative uncharacterized protein; n=1;
           uncultured methanogenic archaeon RC-I|Rep: Putative
           uncharacterized protein - Uncultured methanogenic
           archaeon RC-I
          Length = 427

 Score = 32.3 bits (70), Expect = 9.4
 Identities = 16/45 (35%), Positives = 20/45 (44%)
 Frame = -3

Query: 239 PIPTITP*WRGLPTIEGNTARGASSPAKPALHIPEPLSTTNAATS 105
           P PT+TP     PT+E        +P       P P+ TT A TS
Sbjct: 353 PTPTVTPTPTPEPTVEATPVPATPTPTVEPTVAPSPVPTTTAQTS 397


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 725,576,715
Number of Sequences: 1657284
Number of extensions: 17100021
Number of successful extensions: 60988
Number of sequences better than 10.0: 222
Number of HSP's better than 10.0 without gapping: 55704
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 60854
length of database: 575,637,011
effective HSP length: 97
effective length of database: 414,880,463
effective search space used: 44392209541
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).