SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0036
         (602 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_P13395 Cluster: Spectrin alpha chain; n=16; Bilateria|R...   120   3e-26
UniRef50_Q13813 Cluster: Spectrin alpha chain, brain; n=70; Eume...   116   4e-25
UniRef50_Q4T9R5 Cluster: Chromosome undetermined SCAF7505, whole...   101   2e-20
UniRef50_Q7KV70 Cluster: CG12008-PC, isoform C; n=14; Endopteryg...    78   1e-13
UniRef50_UPI00015B6254 Cluster: PREDICTED: similar to beta chain...    77   2e-13
UniRef50_A7RGP6 Cluster: Predicted protein; n=2; Nematostella ve...    77   2e-13
UniRef50_UPI0000ECB960 Cluster: Spectrin beta chain, brain 4 (Sp...    77   4e-13
UniRef50_UPI000069E88E Cluster: Spectrin beta chain, brain 4 (Sp...    74   3e-12
UniRef50_P02549 Cluster: Spectrin alpha chain, erythrocyte; n=32...    73   4e-12
UniRef50_UPI0000D99C5B Cluster: PREDICTED: spectrin, alpha, eryt...    72   9e-12
UniRef50_UPI000065F0D4 Cluster: Spectrin beta chain, brain 4 (Sp...    62   7e-09
UniRef50_A7S1C0 Cluster: Predicted protein; n=1; Nematostella ve...    62   7e-09
UniRef50_O02425 Cluster: Putative uncharacterized protein sma-1;...    59   7e-08
UniRef50_O15020 Cluster: Spectrin beta chain, brain 2; n=55; Euk...    59   9e-08
UniRef50_UPI0000E485B1 Cluster: PREDICTED: similar to beta chain...    58   2e-07
UniRef50_Q9NRC6 Cluster: Spectrin beta chain, brain 4; n=25; Eut...    57   3e-07
UniRef50_Q01082 Cluster: Spectrin beta chain, brain 1; n=168; Eu...    56   5e-07
UniRef50_Q4SRS6 Cluster: Chromosome undetermined SCAF14494, whol...    55   1e-06
UniRef50_Q00963 Cluster: Spectrin beta chain; n=16; Bilateria|Re...    55   1e-06
UniRef50_UPI0000E25477 Cluster: PREDICTED: similar to beta V spe...    54   2e-06
UniRef50_Q4RFW4 Cluster: Chromosome 16 SCAF15113, whole genome s...    54   3e-06
UniRef50_Q86FK0 Cluster: Antigen; n=1; Taenia solium|Rep: Antige...    54   3e-06
UniRef50_Q4REP5 Cluster: Chromosome 10 SCAF15123, whole genome s...    52   1e-05
UniRef50_Q9H254 Cluster: Spectrin beta chain, brain 3; n=43; cel...    52   1e-05
UniRef50_UPI00005A51E2 Cluster: PREDICTED: similar to Spectrin b...    51   2e-05
UniRef50_Q95ZL8 Cluster: Uncoordinated protein 70, isoform b; n=...    51   2e-05
UniRef50_A7RGP7 Cluster: Predicted protein; n=2; Nematostella ve...    50   3e-05
UniRef50_UPI0000E47ED5 Cluster: PREDICTED: similar to GA11331-PA...    46   5e-04
UniRef50_UPI0000660AE0 Cluster: Homolog of Homo sapiens "Splice ...    46   5e-04
UniRef50_UPI0000E4782C Cluster: PREDICTED: similar to alpha-spec...    45   0.001
UniRef50_Q4T832 Cluster: Chromosome undetermined SCAF7908, whole...    45   0.001
UniRef50_UPI0000DA227F Cluster: PREDICTED: similar to Spectrin b...    43   0.006
UniRef50_UPI0000E82095 Cluster: PREDICTED: similar to brain beta...    42   0.011
UniRef50_A2BGE8 Cluster: Novel protein similar to spectrin, beta...    42   0.015
UniRef50_UPI0000E260D8 Cluster: PREDICTED: spectrin, beta, non-e...    40   0.034
UniRef50_A7S2F5 Cluster: Predicted protein; n=1; Nematostella ve...    40   0.045
UniRef50_A7T2A8 Cluster: Predicted protein; n=1; Nematostella ve...    39   0.10 
UniRef50_A7SF35 Cluster: Predicted protein; n=1; Nematostella ve...    39   0.10 
UniRef50_UPI0000E2615F Cluster: PREDICTED: similar to beta V spe...    38   0.14 
UniRef50_Q4SKB2 Cluster: Chromosome 13 SCAF14566, whole genome s...    37   0.32 
UniRef50_UPI0000660388 Cluster: Homolog of Homo sapiens "spectri...    37   0.42 
UniRef50_Q4RFJ9 Cluster: Chromosome 8 SCAF15119, whole genome sh...    37   0.42 
UniRef50_Q4REJ7 Cluster: Chromosome 10 SCAF15123, whole genome s...    37   0.42 
UniRef50_Q89M57 Cluster: Bll4336 protein; n=1; Bradyrhizobium ja...    37   0.42 
UniRef50_UPI0000E254D5 Cluster: PREDICTED: plectin 1; n=3; Amnio...    36   0.56 
UniRef50_Q15149 Cluster: Plectin-1; n=128; cellular organisms|Re...    36   0.56 
UniRef50_P18091 Cluster: Alpha-actinin, sarcomeric; n=53; Bilate...    36   0.56 
UniRef50_Q4ABH1 Cluster: CG33715-PD, isoform D; n=9; Sophophora|...    35   1.3  
UniRef50_UPI0001556552 Cluster: PREDICTED: similar to MAP/microt...    35   1.7  
UniRef50_UPI0000E23F6F Cluster: PREDICTED: spectrin, beta, non-e...    35   1.7  
UniRef50_UPI0000585CF2 Cluster: PREDICTED: similar to beta spect...    35   1.7  
UniRef50_Q96PK2 Cluster: Microtubule-actin cross-linking factor ...    35   1.7  
UniRef50_Q9UPN3 Cluster: Microtubule-actin cross-linking factor ...    35   1.7  
UniRef50_Q9QW73 Cluster: Beta-spectrin subunit; n=1; Mus sp.|Rep...    34   2.3  
UniRef50_A4XBS1 Cluster: Putative uncharacterized protein; n=2; ...    34   2.3  
UniRef50_UPI0000EBC2AB Cluster: PREDICTED: hypothetical protein;...    34   3.0  
UniRef50_UPI0000E820B7 Cluster: PREDICTED: hypothetical protein,...    34   3.0  
UniRef50_UPI000023F2A2 Cluster: hypothetical protein FG05967.1; ...    34   3.0  
UniRef50_Q6A6M4 Cluster: 8-amino-7-oxononanoate synthase; n=1; P...    34   3.0  
UniRef50_A2FHJ4 Cluster: Putative uncharacterized protein; n=1; ...    34   3.0  
UniRef50_Q4RQA7 Cluster: Chromosome 17 SCAF15006, whole genome s...    33   3.9  
UniRef50_Q07FY0 Cluster: Envoplakin; n=2; Xenopus tropicalis|Rep...    33   3.9  
UniRef50_Q2G714 Cluster: Putative uncharacterized protein precur...    33   3.9  
UniRef50_Q3R0M6 Cluster: Lysozyme; n=2; Xylella fastidiosa|Rep: ...    33   3.9  
UniRef50_Q1V114 Cluster: Cell division particle; n=2; Candidatus...    33   3.9  
UniRef50_A0DR68 Cluster: Chromosome undetermined scaffold_60, wh...    33   3.9  
UniRef50_UPI000065D76F Cluster: Homolog of Homo sapiens "Bullous...    33   5.2  
UniRef50_A1AUB9 Cluster: DTDP-4-dehydrorhamnose 3,5-epimerase; n...    33   5.2  
UniRef50_Q7KY09 Cluster: Trio; n=10; Diptera|Rep: Trio - Drosoph...    33   5.2  
UniRef50_Q5BRC3 Cluster: SJCHGC08698 protein; n=1; Schistosoma j...    33   5.2  
UniRef50_Q5TBT1 Cluster: Dystonin; n=33; Euteleostomi|Rep: Dysto...    33   5.2  
UniRef50_Q9QXZ0 Cluster: Microtubule-actin cross-linking factor ...    33   5.2  
UniRef50_O94833 Cluster: Bullous pemphigoid antigen 1, isoforms ...    33   5.2  
UniRef50_Q91ZU6 Cluster: Bullous pemphigoid antigen 1, isoforms ...    33   5.2  
UniRef50_Q03001 Cluster: Bullous pemphigoid antigen 1, isoforms ...    33   5.2  
UniRef50_O43707 Cluster: Alpha-actinin-4; n=186; Eumetazoa|Rep: ...    33   5.2  
UniRef50_UPI0000E81ECF Cluster: PREDICTED: similar to protocadhe...    33   6.9  
UniRef50_Q8JG61 Cluster: Protein 4.1; n=1; Danio rerio|Rep: Prot...    33   6.9  
UniRef50_UPI0000F1F58B Cluster: PREDICTED: similar to dystonin; ...    32   9.1  
UniRef50_UPI000069EF7E Cluster: Bullous pemphigoid antigen 1 iso...    32   9.1  
UniRef50_Q01WV5 Cluster: Glycoside hydrolase family 2, sugar bin...    32   9.1  
UniRef50_Q01A79 Cluster: JERF3; n=2; Ostreococcus|Rep: JERF3 - O...    32   9.1  
UniRef50_Q9BJD3 Cluster: Major plasmodial myosin heavy chain; n=...    32   9.1  
UniRef50_A7EE60 Cluster: Putative uncharacterized protein; n=1; ...    32   9.1  
UniRef50_P39922 Cluster: Myosin heavy chain, clone 203; n=2; Hyd...    32   9.1  

>UniRef50_P13395 Cluster: Spectrin alpha chain; n=16; Bilateria|Rep:
           Spectrin alpha chain - Drosophila melanogaster (Fruit
           fly)
          Length = 2415

 Score =  120 bits (288), Expect = 3e-26
 Identities = 54/69 (78%), Positives = 63/69 (91%)
 Frame = -3

Query: 249 KGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSS 70
           KG KL EA QQQQ+NR +EDIELWLSE+EGQLLSED+GKDLTSVQNLQKKHALLEADV +
Sbjct: 673 KGTKLNEACQQQQFNRTIEDIELWLSEIEGQLLSEDHGKDLTSVQNLQKKHALLEADVMA 732

Query: 69  HAERIDAIR 43
           H +RI++I+
Sbjct: 733 HQDRIESIK 741



 Score =  112 bits (269), Expect = 7e-24
 Identities = 62/121 (51%), Positives = 83/121 (68%)
 Frame = -1

Query: 602 RLLLEKSRTKRPRSPWKDRPTKYQQFETRL**N*RLGKRES*KFATDDSYLDPTNLNGKV 423
           R  L++  +KR R   +D   +YQQFE R     +    E  KFATDDSYLDPTNLNGK+
Sbjct: 558 RAALQEKSSKR-RQLLEDS-NRYQQFE-RDCDETKGWISEKLKFATDDSYLDPTNLNGKM 614

Query: 422 QKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEELGGIWERLVQSSS*RE 243
           QKHQNFE EL ANK R+++IT VG  L+E +H+A  QI++R++E+  +WE LVQ+S  + 
Sbjct: 615 QKHQNFEHELNANKSRIEDITNVGTELIEKQHYAADQINTRMQEIVVLWETLVQASDKKG 674

Query: 242 T 240
           T
Sbjct: 675 T 675



 Score = 79.8 bits (188), Expect = 5e-14
 Identities = 37/65 (56%), Positives = 48/65 (73%)
 Frame = -3

Query: 249  KGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSS 70
            K  KL+EA +Q+ Y  AV+D++ WL EVE  L +ED GKDL SVQNL KKH L+EAD+ +
Sbjct: 1598 KSLKLKEANKQRTYIAAVKDLDFWLGEVESLLTTEDSGKDLASVQNLMKKHQLVEADIVA 1657

Query: 69   HAERI 55
            H +RI
Sbjct: 1658 HEDRI 1662



 Score = 68.1 bits (159), Expect = 1e-10
 Identities = 32/69 (46%), Positives = 45/69 (65%)
 Frame = -3

Query: 240  KLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAE 61
            +L EA    Q+ R + D E W+ E +  + S+DYG+DLT VQNL+KKH  LEA++ SH  
Sbjct: 1707 RLNEALTLHQFFRDIADEESWIKEKKLLVGSDDYGRDLTGVQNLKKKHKRLEAELGSHEP 1766

Query: 60   RIDAIREPG 34
             I A++E G
Sbjct: 1767 AIQAVQEAG 1775



 Score = 66.9 bits (156), Expect = 3e-10
 Identities = 28/69 (40%), Positives = 44/69 (63%)
 Frame = -1

Query: 470 ATDDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEE 291
           A+++SY DPTNL  K+QKHQ FE E+ A+   +  +   G+ ++  +HFA   I  R++E
Sbjct: 70  ASEESYRDPTNLQAKIQKHQAFEAEVSAHSNAIVSLDNTGQEMINQQHFASESIQVRLDE 129

Query: 290 LGGIWERLV 264
           L  +WE L+
Sbjct: 130 LHKLWELLL 138



 Score = 60.1 bits (139), Expect = 4e-08
 Identities = 28/72 (38%), Positives = 41/72 (56%)
 Frame = -3

Query: 249  KGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSS 70
            +G KL E+   QQ+   VE+ E W++E +  L  EDYG  + +VQ L KKH   E D ++
Sbjct: 1810 RGQKLDESLTYQQFLAQVEEEEAWITEKQQLLSVEDYGDSMAAVQGLLKKHDAFETDFTA 1869

Query: 69   HAERIDAIREPG 34
            H +R   I + G
Sbjct: 1870 HKDRCSLICDQG 1881



 Score = 59.7 bits (138), Expect = 5e-08
 Identities = 30/120 (25%), Positives = 60/120 (50%), Gaps = 2/120 (1%)
 Frame = -1

Query: 485  ES*KFATDDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHF--AQPQ 312
            E  + AT++SY DP N+  K QKHQ FE EL AN  R+  + A+G  L++ +    ++  
Sbjct: 1517 EKLQLATEESYKDPANIQSKHQKHQAFEAELAANADRIQSVLAMGGNLIDKKQCSGSEDA 1576

Query: 311  ISSRVEELGGIWERLVQSSS*RETSCRKRLNNSSTTGPSRTLNFGSRKLKDSCSARTTGR 132
            +  R+ ++   WE L   ++ +    ++     +     + L+F   +++   +   +G+
Sbjct: 1577 VQKRLTQIADQWEYLTHKTTEKSLKLKEANKQRTYIAAVKDLDFWLGEVESLLTTEDSGK 1636



 Score = 54.8 bits (126), Expect = 1e-06
 Identities = 24/69 (34%), Positives = 45/69 (65%)
 Frame = -3

Query: 252 LKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVS 73
           ++  KL  A + Q++NR  ++   W++E +  L S+DYG+DL SVQ LQ+KH  +E D++
Sbjct: 249 VRQEKLFGAHEIQRFNRDADETVAWIAEKDVVLSSDDYGRDLASVQALQRKHEGVERDLA 308

Query: 72  SHAERIDAI 46
           +  +++  +
Sbjct: 309 ALEDKVSTL 317



 Score = 53.6 bits (123), Expect = 3e-06
 Identities = 24/70 (34%), Positives = 46/70 (65%)
 Frame = -3

Query: 249  KGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSS 70
            K ++L  A + Q+++R +++ + W++E    L ++D GKDL SVQ LQ+KH  +E D+++
Sbjct: 1173 KASQLGSAHEVQRFHRDIDETKDWIAEKANALNNDDLGKDLRSVQTLQRKHEGVERDLAA 1232

Query: 69   HAERIDAIRE 40
              ++I  + E
Sbjct: 1233 LRDKIRQLDE 1242



 Score = 48.8 bits (111), Expect = 1e-04
 Identities = 27/81 (33%), Positives = 40/81 (49%)
 Frame = -3

Query: 297  GRAGRNMGATGAVFELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSV 118
            G       A  A    +   L ++ Q QQ  R +ED   W+ E E    S + G+DL  V
Sbjct: 763  GNLSARYAALAAPMGERKQHLLDSLQVQQLFRDLEDEAAWIREKEPIAASTNRGRDLIGV 822

Query: 117  QNLQKKHALLEADVSSHAERI 55
            QNL KKH  + A++++H  R+
Sbjct: 823  QNLIKKHQAVLAEINNHEARL 843



 Score = 48.8 bits (111), Expect = 1e-04
 Identities = 23/72 (31%), Positives = 47/72 (65%)
 Frame = -3

Query: 249  KGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSS 70
            K ++L +    QQ++R  ++IE W++E + QL +E+  KD  ++Q+  +KH   EA++++
Sbjct: 1491 KRSRLGDEQTLQQFSRDADEIENWIAE-KLQLATEESYKDPANIQSKHQKHQAFEAELAA 1549

Query: 69   HAERIDAIREPG 34
            +A+RI ++   G
Sbjct: 1550 NADRIQSVLAMG 1561



 Score = 47.2 bits (107), Expect = 3e-04
 Identities = 21/70 (30%), Positives = 41/70 (58%)
 Frame = -3

Query: 249 KGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSS 70
           KG KLQ+A    Q+ R  E++  W+ + E  + ++++G+DL  V+ LQ+K    + D++S
Sbjct: 144 KGLKLQQALVLVQFLRQCEEVMFWIKDKETFVTADEFGQDLEHVEVLQRKFDEFQKDMAS 203

Query: 69  HAERIDAIRE 40
              R+  + +
Sbjct: 204 QEYRVTEVNQ 213



 Score = 46.4 bits (105), Expect = 5e-04
 Identities = 23/69 (33%), Positives = 34/69 (49%)
 Frame = -3

Query: 237  LQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAER 58
            L ++ Q  QY     + E W+ E E      DYGKD  S + L KKH  L +D+ +    
Sbjct: 889  LDDSLQAHQYFADANEAESWMREKEPIATGSDYGKDEDSSEALLKKHEALVSDLEAFGNT 948

Query: 57   IDAIREPGR 31
            I A++E  +
Sbjct: 949  IQALQEQAK 957



 Score = 45.6 bits (103), Expect = 0.001
 Identities = 23/73 (31%), Positives = 44/73 (60%)
 Frame = -3

Query: 249 KGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSS 70
           K  KL+++ + Q + R  +++E W+ E + Q  SE+  +D T++Q   +KH   EA+VS+
Sbjct: 39  KREKLEDSRRFQYFKRDADELESWIHE-KLQAASEESYRDPTNLQAKIQKHQAFEAEVSA 97

Query: 69  HAERIDAIREPGR 31
           H+  I ++   G+
Sbjct: 98  HSNAIVSLDNTGQ 110



 Score = 44.4 bits (100), Expect = 0.002
 Identities = 18/67 (26%), Positives = 36/67 (53%)
 Frame = -1

Query: 467  TDDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEEL 288
            +DD   D T +    +KH+  E EL +++P +  +   G++L+++ +   P+I  R++ L
Sbjct: 1737 SDDYGRDLTGVQNLKKKHKRLEAELGSHEPAIQAVQEAGEKLMDVSNLGVPEIEQRLKAL 1796

Query: 287  GGIWERL 267
               W  L
Sbjct: 1797 NQAWAEL 1803



 Score = 41.9 bits (94), Expect = 0.011
 Identities = 20/63 (31%), Positives = 34/63 (53%)
 Frame = -3

Query: 234 QEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAERI 55
           ++    Q + R  E  + W+++ E  L +ED G  L SV+ L KKH   E  +++  E+I
Sbjct: 467 EQCMDLQLFYRDTEQADTWMAKQEAFLANEDLGDSLDSVEALIKKHEDFEKSLAAQEEKI 526

Query: 54  DAI 46
            A+
Sbjct: 527 KAL 529



 Score = 40.3 bits (90), Expect = 0.034
 Identities = 20/83 (24%), Positives = 37/83 (44%)
 Frame = -1

Query: 467  TDDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEEL 288
            +D+   D T     +++HQ    E+ A           G  LL+  H+A P+I  ++E+L
Sbjct: 1312 SDELANDVTGAEALIERHQEHRTEIDARAGTFGAFEQFGNELLQANHYASPEIKEKIEDL 1371

Query: 287  GGIWERLVQSSS*RETSCRKRLN 219
                E L ++ + R     + L+
Sbjct: 1372 AKAREDLEKAWTERRLQLEQNLD 1394



 Score = 37.1 bits (82), Expect = 0.32
 Identities = 20/72 (27%), Positives = 38/72 (52%), Gaps = 1/72 (1%)
 Frame = -1

Query: 473 FATDDSY-LDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRV 297
           F T D +  D  ++    +K   F++++ + + RV E+  +  +L++  H  +  I+ R 
Sbjct: 174 FVTADEFGQDLEHVEVLQRKFDEFQKDMASQEYRVTEVNQLADKLVQDGHPERDTITKRK 233

Query: 296 EELGGIWERLVQ 261
           EEL   W+RL Q
Sbjct: 234 EELNEAWQRLKQ 245



 Score = 35.5 bits (78), Expect = 0.97
 Identities = 18/60 (30%), Positives = 35/60 (58%)
 Frame = -3

Query: 249  KGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSS 70
            KG  L  +A  Q   +A + +E W+ + E  + S+++G+DL++VQ L  K    +A +++
Sbjct: 1917 KGALLDNSAYLQFMWKA-DVVESWIDDKENYVRSDEFGRDLSTVQTLLTKQETFDAGLNA 1975



 Score = 34.7 bits (76), Expect = 1.7
 Identities = 22/92 (23%), Positives = 45/92 (48%)
 Frame = -1

Query: 497  LGKRES*KFATDDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQ 318
            LG+ ES    T+DS  D  ++   ++KHQ  E ++ A++ R+ ++      L+E   F  
Sbjct: 1622 LGEVES-LLTTEDSGKDLASVQNLMKKHQLVEADIVAHEDRIKDMNNQADSLVESGQFDT 1680

Query: 317  PQISSRVEELGGIWERLVQSSS*RETSCRKRL 222
              I  + + +   +ER+   ++ R+    + L
Sbjct: 1681 AGIQEKRQSINERYERICNLAAHRQARLNEAL 1712



 Score = 34.3 bits (75), Expect = 2.3
 Identities = 18/76 (23%), Positives = 36/76 (47%)
 Frame = -1

Query: 470 ATDDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEE 291
           ++DD   D  ++    +KH+  E++L A + +V  + A  +RL  +      QI  +  E
Sbjct: 282 SSDDYGRDLASVQALQRKHEGVERDLAALEDKVSTLGAEAQRLCSIHADHSDQIRDKQAE 341

Query: 290 LGGIWERLVQSSS*RE 243
           +   W+ L   +  R+
Sbjct: 342 IANYWQSLTTKARERK 357



 Score = 34.3 bits (75), Expect = 2.3
 Identities = 16/61 (26%), Positives = 30/61 (49%)
 Frame = -1

Query: 470 ATDDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEE 291
           + D+   D       +++HQ  + E+ A +      T  G++LLE EH+A  +I  ++  
Sbjct: 388 SADELAKDVAGAEALLERHQEHKGEIDAREDSFKLTTESGQKLLEREHYAAAEIQEKLAA 447

Query: 290 L 288
           L
Sbjct: 448 L 448



 Score = 34.3 bits (75), Expect = 2.3
 Identities = 15/74 (20%), Positives = 39/74 (52%)
 Frame = -1

Query: 464  DDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEELG 285
            DD   D  ++    +KH+  E++L A + ++ ++     RL++       Q  ++ +E+ 
Sbjct: 1207 DDLGKDLRSVQTLQRKHEGVERDLAALRDKIRQLDETANRLMQSHPDTAEQTYAKQKEIN 1266

Query: 284  GIWERLVQSSS*RE 243
             +W++++  S+ R+
Sbjct: 1267 EMWDQIITKSTARK 1280



 Score = 33.9 bits (74), Expect = 3.0
 Identities = 17/68 (25%), Positives = 39/68 (57%)
 Frame = -3

Query: 237 LQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAER 58
           L+++ + QQ+ R  ++ + W+SE + +  ++D   D T++    +KH   E +++++  R
Sbjct: 572 LEDSNRYQQFERDCDETKGWISE-KLKFATDDSYLDPTNLNGKMQKHQNFEHELNANKSR 630

Query: 57  IDAIREPG 34
           I+ I   G
Sbjct: 631 IEDITNVG 638



 Score = 33.5 bits (73), Expect = 3.9
 Identities = 19/66 (28%), Positives = 34/66 (51%)
 Frame = -3

Query: 240  KLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAE 61
            +L++    Q Y R  E  E W+S  E  L ++D      +V+ L KKH   +  ++ H +
Sbjct: 1388 QLEQNLDLQLYMRDCELAESWMSAREAFLNADDDANAGGNVEALIKKHEDFDKAINGHEQ 1447

Query: 60   RIDAIR 43
            +I A++
Sbjct: 1448 KIAALQ 1453



 Score = 33.1 bits (72), Expect = 5.2
 Identities = 15/60 (25%), Positives = 33/60 (55%)
 Frame = -1

Query: 425 VQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEELGGIWERLVQSSS*R 246
           ++KH++FE+ L A + ++  +     +L++ +H+A   ++ R + L      L + SS R
Sbjct: 509 IKKHEDFEKSLAAQEEKIKALDIFATKLIDGQHYAADDVAQRRQMLLARRAALQEKSSKR 568



 Score = 32.7 bits (71), Expect = 6.9
 Identities = 19/69 (27%), Positives = 33/69 (47%), Gaps = 1/69 (1%)
 Frame = -3

Query: 243  NKLQEAAQQQQYNRAVEDIELWLSEVEGQL-LSEDYGKDLTSVQNLQKKHALLEADVSSH 67
            NKL E  +     R   D+  W+ + E    +++  G+DL  V+ LQKK      D+ ++
Sbjct: 1067 NKLNETVKAYVLVREAADLAQWIRDKENHAQIADVVGEDLEEVEVLQKKFDDFNDDLKAN 1126

Query: 66   AERIDAIRE 40
              R+  + E
Sbjct: 1127 EVRLANMNE 1135



 Score = 32.7 bits (71), Expect = 6.9
 Identities = 15/77 (19%), Positives = 39/77 (50%)
 Frame = -1

Query: 497  LGKRES*KFATDDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQ 318
            +  RE+   A DD+     N+   ++KH++F++ +  ++ ++  +  V  +L+   H+A 
Sbjct: 1409 MSAREAFLNADDDANAGG-NVEALIKKHEDFDKAINGHEQKIAALQTVADQLIAQNHYAS 1467

Query: 317  PQISSRVEELGGIWERL 267
              +  + +++   W  L
Sbjct: 1468 NLVDEKRKQVLERWRHL 1484


>UniRef50_Q13813 Cluster: Spectrin alpha chain, brain; n=70;
           Eumetazoa|Rep: Spectrin alpha chain, brain - Homo
           sapiens (Human)
          Length = 2472

 Score =  116 bits (279), Expect = 4e-25
 Identities = 55/70 (78%), Positives = 62/70 (88%)
 Frame = -3

Query: 255 ELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADV 76
           ELKG KL+EA QQQQ+NR VEDIELWL EVEG L S+DYGKDLT+VQNLQKKHALLEADV
Sbjct: 668 ELKGIKLREANQQQQFNRNVEDIELWLYEVEGHLASDDYGKDLTNVQNLQKKHALLEADV 727

Query: 75  SSHAERIDAI 46
           ++H +RID I
Sbjct: 728 AAHQDRIDGI 737



 Score = 88.6 bits (210), Expect = 1e-16
 Identities = 39/65 (60%), Positives = 49/65 (75%)
 Frame = -3

Query: 249  KGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSS 70
            K  KL+EA +QQ +N  ++D + WLSEVE  L SEDYGKDL SV NL KKH LLEAD+S+
Sbjct: 1650 KSQKLKEANKQQNFNTGIKDFDFWLSEVEALLASEDYGKDLASVNNLLKKHQLLEADISA 1709

Query: 69   HAERI 55
            H +R+
Sbjct: 1710 HEDRL 1714



 Score = 85.4 bits (202), Expect = 9e-16
 Identities = 33/77 (42%), Positives = 59/77 (76%)
 Frame = -1

Query: 485 ES*KFATDDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQIS 306
           E  K ATD++Y DP+NL GKVQKHQ FE EL AN+ R+D +   G++L+++ H+A+ +++
Sbjct: 591 EKMKTATDEAYKDPSNLQGKVQKHQAFEAELSANQSRIDALEKAGQKLIDVNHYAKDEVA 650

Query: 305 SRVEELGGIWERLVQSS 255
           +R+ E+  +W++L++++
Sbjct: 651 ARMNEVISLWKKLLEAT 667



 Score = 69.3 bits (162), Expect = 6e-11
 Identities = 32/76 (42%), Positives = 48/76 (63%)
 Frame = -1

Query: 488 RES*KFATDDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQI 309
           +E  + A+D++Y DPTNL GK+QKHQ FE E+QAN   + ++   G  ++   HFA   I
Sbjct: 61  QEKLQIASDENYKDPTNLQGKLQKHQAFEAEVQANSGAIVKLDETGNLMISEGHFASETI 120

Query: 308 SSRVEELGGIWERLVQ 261
            +R+ EL   WE L++
Sbjct: 121 RTRLMELHRQWELLLE 136



 Score = 66.5 bits (155), Expect = 5e-10
 Identities = 31/73 (42%), Positives = 48/73 (65%)
 Frame = -3

Query: 240  KLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAE 61
            KL E+ +  Q+ R ++D E W+ E +  + SEDYG+DLT VQNL+KKH  LEA++++H  
Sbjct: 1759 KLNESHRLHQFFRDMDDEESWIKEKKLLVGSEDYGRDLTGVQNLRKKHKRLEAELAAHEP 1818

Query: 60   RIDAIREPGRASS 22
             I  + + G+  S
Sbjct: 1819 AIQGVLDTGKKLS 1831



 Score = 64.1 bits (149), Expect = 2e-09
 Identities = 32/71 (45%), Positives = 43/71 (60%)
 Frame = -3

Query: 240 KLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAE 61
           KL ++ + QQ  R VED E W+ E E    S + GKDL  VQNL KKH  L+A+++ H  
Sbjct: 779 KLADSLRLQQLFRDVEDEETWIREKEPIAASTNRGKDLIGVQNLLKKHQALQAEIAGHEP 838

Query: 60  RIDAIREPGRA 28
           RI A+ + G A
Sbjct: 839 RIKAVTQKGNA 849



 Score = 59.7 bits (138), Expect = 5e-08
 Identities = 31/75 (41%), Positives = 44/75 (58%), Gaps = 2/75 (2%)
 Frame = -1

Query: 470  ATDDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFA--QPQISSRV 297
            A+D+SY DPTN+  K QKHQ FE EL AN  R+  +  +G  L+E    A  +  + +R+
Sbjct: 1574 ASDESYKDPTNIQSKHQKHQAFEAELHANADRIRGVIDMGNSLIERGACAGSEDAVKARL 1633

Query: 296  EELGGIWERLVQSSS 252
              L   W+ LVQ S+
Sbjct: 1634 AALADQWQFLVQKSA 1648



 Score = 59.7 bits (138), Expect = 5e-08
 Identities = 26/73 (35%), Positives = 44/73 (60%)
 Frame = -3

Query: 249  KGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSS 70
            +G +L+E+ + QQ+   VE+ E W++E    + SEDYG  L ++Q L KKH   E D + 
Sbjct: 1862 RGQRLEESLEYQQFVANVEEEEAWINEKMTLVASEDYGDTLAAIQGLLKKHEAFETDFTV 1921

Query: 69   HAERIDAIREPGR 31
            H +R++ +   G+
Sbjct: 1922 HKDRVNDVCTNGQ 1934



 Score = 57.2 bits (132), Expect = 3e-07
 Identities = 28/74 (37%), Positives = 48/74 (64%)
 Frame = -3

Query: 267 GAVFELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALL 88
           G   + +G KL  AA+ Q++NR V++   W+ E E  + S+D+G+DL SVQ L +KH  L
Sbjct: 242 GLALQRQG-KLFGAAEVQRFNRDVDETISWIKEKEQLMASDDFGRDLASVQALLRKHEGL 300

Query: 87  EADVSSHAERIDAI 46
           E D+++  +++ A+
Sbjct: 301 ERDLAALEDKVKAL 314



 Score = 56.8 bits (131), Expect = 4e-07
 Identities = 26/70 (37%), Positives = 44/70 (62%)
 Frame = -3

Query: 249 KGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSS 70
           KG KL +A +  QY R  ED+  W+++ E  + SE+ G+DL  V+ LQKK    + D+++
Sbjct: 141 KGIKLLQAQKLVQYLRECEDVMDWINDKEAIVTSEELGQDLEHVEVLQKKFEEFQTDMAA 200

Query: 69  HAERIDAIRE 40
           H ER++ + +
Sbjct: 201 HEERVNEVNQ 210



 Score = 55.2 bits (127), Expect = 1e-06
 Identities = 27/70 (38%), Positives = 41/70 (58%)
 Frame = -3

Query: 237  LQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAER 58
            L+++ Q QQY     + E W+ E E  + S DYGKD  S + L KKH  L +D+S++   
Sbjct: 886  LEDSLQAQQYFADANEAESWMREKEPIVGSTDYGKDEDSAEALLKKHEALMSDLSAYGSS 945

Query: 57   IDAIREPGRA 28
            I A+RE  ++
Sbjct: 946  IQALREQAQS 955



 Score = 54.8 bits (126), Expect = 1e-06
 Identities = 27/74 (36%), Positives = 49/74 (66%)
 Frame = -3

Query: 249  KGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSS 70
            K +KL E+   QQ++R V++IE W+SE + Q  S++  KD T++Q+  +KH   EA++ +
Sbjct: 1543 KRSKLGESQTLQQFSRDVDEIEAWISE-KLQTASDESYKDPTNIQSKHQKHQAFEAELHA 1601

Query: 69   HAERIDAIREPGRA 28
            +A+RI  + + G +
Sbjct: 1602 NADRIRGVIDMGNS 1615



 Score = 53.2 bits (122), Expect = 5e-06
 Identities = 26/74 (35%), Positives = 43/74 (58%)
 Frame = -3

Query: 261 VFELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEA 82
           ++EL+  + ++    Q + R  E ++ W+S+ E  LL+ED G  L SV+ L KKH   E 
Sbjct: 455 LWELRRQQYEQCMDLQLFYRDTEQVDNWMSKQEAFLLNEDLGDSLDSVEALLKKHEDFEK 514

Query: 81  DVSSHAERIDAIRE 40
            +S+  E+I A+ E
Sbjct: 515 SLSAQEEKITALDE 528



 Score = 50.0 bits (114), Expect = 4e-05
 Identities = 22/72 (30%), Positives = 44/72 (61%)
 Frame = -3

Query: 255  ELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADV 76
            E +   L  A + Q+++R  ++ + W+ E    L +++YG DL SVQ LQ+KH   E D+
Sbjct: 1223 EERSQLLGSAHEVQRFHRDADETKEWIEEKNQALNTDNYGHDLASVQALQRKHEGFERDL 1282

Query: 75   SSHAERIDAIRE 40
            ++  ++++++ E
Sbjct: 1283 AALGDKVNSLGE 1294



 Score = 46.0 bits (104), Expect = 7e-04
 Identities = 21/57 (36%), Positives = 33/57 (57%)
 Frame = -3

Query: 240  KLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSS 70
            KL E +   Q+N   + +E W+ E E  L ++DYG+DL+SVQ L  K    +A + +
Sbjct: 1971 KLDENSAFLQFNWKADVVESWIGEKENSLKTDDYGRDLSSVQTLLTKQETFDAGLQA 2027



 Score = 45.6 bits (103), Expect = 0.001
 Identities = 20/68 (29%), Positives = 36/68 (52%)
 Frame = -1

Query: 449  DPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEELGGIWER 270
            D   +   ++KHQ  + E+  ++PR+  +T  G  ++E  HFA   + +++ EL   WE 
Sbjct: 815  DLIGVQNLLKKHQALQAEIAGHEPRIKAVTQKGNAMVEEGHFAAEDVKAKLHELNQKWEA 874

Query: 269  LVQSSS*R 246
            L   +S R
Sbjct: 875  LKAKASQR 882



 Score = 44.4 bits (100), Expect = 0.002
 Identities = 23/73 (31%), Positives = 44/73 (60%)
 Frame = -3

Query: 252 LKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVS 73
           L+  KL+++ + Q + R  E++E W+ E + Q+ S++  KD T++Q   +KH   EA+V 
Sbjct: 35  LRRQKLEDSYRFQFFQRDAEELEKWIQE-KLQIASDENYKDPTNLQGKLQKHQAFEAEVQ 93

Query: 72  SHAERIDAIREPG 34
           +++  I  + E G
Sbjct: 94  ANSGAIVKLDETG 106



 Score = 42.7 bits (96), Expect = 0.006
 Identities = 21/70 (30%), Positives = 42/70 (60%)
 Frame = -3

Query: 240 KLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAE 61
           +L ++   QQ+ R  ++++ W++E       E Y KD +++Q   +KH   EA++S++  
Sbjct: 568 QLADSFHLQQFFRDSDELKSWVNEKMKTATDEAY-KDPSNLQGKVQKHQAFEAELSANQS 626

Query: 60  RIDAIREPGR 31
           RIDA+ + G+
Sbjct: 627 RIDALEKAGQ 636



 Score = 41.9 bits (94), Expect = 0.011
 Identities = 20/72 (27%), Positives = 39/72 (54%)
 Frame = -3

Query: 255  ELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADV 76
            E +   L+++ ++    R   +++ W++E E  L SE+ G DL  V+ LQKK    + D+
Sbjct: 1081 EKRKGMLEKSCKKFMLFREANELQQWINEKEAALTSEEVGADLEQVEVLQKKFDDFQKDL 1140

Query: 75   SSHAERIDAIRE 40
             ++  R+  I +
Sbjct: 1141 KANESRLKDINK 1152



 Score = 39.9 bits (89), Expect = 0.045
 Identities = 21/65 (32%), Positives = 35/65 (53%)
 Frame = -3

Query: 237  LQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAER 58
            L +  + Q ++R  E  E W++  E  L +ED G  L SV+ L KKH   +  ++   E+
Sbjct: 1441 LDQCLELQLFHRDCEQAENWMAAREAFLNTEDKGDSLDSVEALIKKHEDFDKAINVQEEK 1500

Query: 57   IDAIR 43
            I A++
Sbjct: 1501 IAALQ 1505



 Score = 38.7 bits (86), Expect = 0.10
 Identities = 21/68 (30%), Positives = 34/68 (50%)
 Frame = -1

Query: 470 ATDDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEE 291
           A+DD   D TN+    +KH   E ++ A++ R+D IT   ++  +  HF    I  + E 
Sbjct: 702 ASDDYGKDLTNVQNLQKKHALLEADVAAHQDRIDGITIQARQFQDAGHFDAENIKKKQEA 761

Query: 290 LGGIWERL 267
           L   +E L
Sbjct: 762 LVARYEAL 769



 Score = 38.7 bits (86), Expect = 0.10
 Identities = 17/67 (25%), Positives = 36/67 (53%)
 Frame = -1

Query: 467  TDDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEEL 288
            T+D      ++   ++KH++F++ +   + ++  + A   +L+   H+A+  ISSR  E+
Sbjct: 1470 TEDKGDSLDSVEALIKKHEDFDKAINVQEEKIAALQAFADQLIAAGHYAKGDISSRRNEV 1529

Query: 287  GGIWERL 267
               W RL
Sbjct: 1530 LDRWRRL 1536



 Score = 37.1 bits (82), Expect = 0.32
 Identities = 20/68 (29%), Positives = 36/68 (52%)
 Frame = -1

Query: 470 ATDDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEE 291
           A+DD   D  ++   ++KH+  E++L A + +V  + A   RL +    +  QI  + EE
Sbjct: 279 ASDDFGRDLASVQALLRKHEGLERDLAALEDKVKALCAEADRLQQSHPLSATQIQVKREE 338

Query: 290 LGGIWERL 267
           L   WE++
Sbjct: 339 LITNWEQI 346



 Score = 37.1 bits (82), Expect = 0.32
 Identities = 19/74 (25%), Positives = 37/74 (50%)
 Frame = -1

Query: 467  TDDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEEL 288
            ++D   D T +    +KH+  E EL A++P +  +   GK+L +     + +I  R+ + 
Sbjct: 1789 SEDYGRDLTGVQNLRKKHKRLEAELAAHEPAIQGVLDTGKKLSDDNTIGKEEIQQRLAQF 1848

Query: 287  GGIWERLVQSSS*R 246
               W+ L Q ++ R
Sbjct: 1849 VEHWKELKQLAAAR 1862



 Score = 36.7 bits (81), Expect = 0.42
 Identities = 15/52 (28%), Positives = 32/52 (61%)
 Frame = -1

Query: 437  LNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEELGG 282
            + G ++KH+ FE +   +K RV+++   G+ L++  +  +  ISS+++ L G
Sbjct: 1905 IQGLLKKHEAFETDFTVHKDRVNDVCTNGQDLIKKNNHHEENISSKMKGLNG 1956



 Score = 35.9 bits (79), Expect = 0.74
 Identities = 24/86 (27%), Positives = 45/86 (52%), Gaps = 1/86 (1%)
 Frame = -1

Query: 497  LGKRES*KFATDDSYLDPTNLNGKVQKHQNFEQELQA-NKPRVDEITAVGKRLLELEHFA 321
            +G++E+    TDD   D +++   + K + F+  LQA  +  +  ITA+  +LL  +H  
Sbjct: 1992 IGEKEN-SLKTDDYGRDLSSVQTLLTKQETFDAGLQAFQQEGIANITALKDQLLAAKHVQ 2050

Query: 320  QPQISSRVEELGGIWERLVQSSS*RE 243
               I +R   L   W +L+ +S+ R+
Sbjct: 2051 SKAIEARHASLMKRWSQLLANSAARK 2076



 Score = 34.7 bits (76), Expect = 1.7
 Identities = 15/70 (21%), Positives = 35/70 (50%)
 Frame = -3

Query: 240  KLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAE 61
            KL ++   Q++     D+  W++ + G + S++  KD+T  + L ++H     ++ + A 
Sbjct: 1334 KLGDSHDLQRFLSDFRDLMSWINGIRGLVSSDELAKDVTGAEALLERHQEHRTEIDARAG 1393

Query: 60   RIDAIREPGR 31
               A  + G+
Sbjct: 1394 TFQAFEQFGQ 1403



 Score = 33.1 bits (72), Expect = 5.2
 Identities = 11/46 (23%), Positives = 28/46 (60%)
 Frame = -1

Query: 425 VQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEEL 288
           ++KH++FE+ L A + ++  +     +L++  H+A   +++R + L
Sbjct: 506 LKKHEDFEKSLSAQEEKITALDEFATKLIQNNHYAMEDVATRRDAL 551



 Score = 33.1 bits (72), Expect = 5.2
 Identities = 15/61 (24%), Positives = 29/61 (47%)
 Frame = -1

Query: 470  ATDDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEE 291
            ++D+   D T     +++HQ    E+ A           G++LL   H+A P+I  +++ 
Sbjct: 1363 SSDELAKDVTGAEALLERHQEHRTEIDARAGTFQAFEQFGQQLLAHGHYASPEIKQKLDI 1422

Query: 290  L 288
            L
Sbjct: 1423 L 1423



 Score = 32.3 bits (70), Expect = 9.1
 Identities = 16/67 (23%), Positives = 32/67 (47%)
 Frame = -1

Query: 467  TDDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEEL 288
            TD+   D  ++    +KH+ FE++L A   +V+ +    +RL++    +   +  +  EL
Sbjct: 1258 TDNYGHDLASVQALQRKHEGFERDLAALGDKVNSLGETAERLIQSHPESAEDLQEKCTEL 1317

Query: 287  GGIWERL 267
               W  L
Sbjct: 1318 NQAWSSL 1324


>UniRef50_Q4T9R5 Cluster: Chromosome undetermined SCAF7505, whole
           genome shotgun sequence; n=2; Euteleostomi|Rep:
           Chromosome undetermined SCAF7505, whole genome shotgun
           sequence - Tetraodon nigroviridis (Green puffer)
          Length = 1589

 Score =  101 bits (241), Expect = 2e-20
 Identities = 46/58 (79%), Positives = 53/58 (91%)
 Frame = -3

Query: 240 KLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSH 67
           +++EA QQQQ+NR VEDIELWL EVEG L S+DYGKDLTSVQNLQKKHALLEADV++H
Sbjct: 734 RMEEANQQQQFNRNVEDIELWLYEVEGHLASDDYGKDLTSVQNLQKKHALLEADVAAH 791



 Score = 76.2 bits (179), Expect = 6e-13
 Identities = 34/65 (52%), Positives = 47/65 (72%)
 Frame = -1

Query: 485 ES*KFATDDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQIS 306
           E  K ATD++Y DP+NL GKVQKHQ FE EL AN+ R+D +   G+ LLE +H+A  +++
Sbjct: 673 EKMKTATDEAYKDPSNLQGKVQKHQAFEAELSANQSRIDALQKSGQDLLERKHYASSEVA 732

Query: 305 SRVEE 291
            R+EE
Sbjct: 733 RRMEE 737



 Score = 73.7 bits (173), Expect = 3e-12
 Identities = 33/78 (42%), Positives = 51/78 (65%)
 Frame = -1

Query: 488 RES*KFATDDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQI 309
           +E  + A+D++Y DP+NL GK+QKHQ FE E+QAN   + ++   G  ++   HFA   I
Sbjct: 61  QEKLQIASDENYKDPSNLQGKLQKHQAFEAEVQANAGTIIKLDETGNLMISEGHFASETI 120

Query: 308 SSRVEELGGIWERLVQSS 255
            SR+EEL  +W+ L+Q +
Sbjct: 121 RSRLEELHRLWDLLLQKT 138



 Score = 61.7 bits (143), Expect = 1e-08
 Identities = 31/69 (44%), Positives = 41/69 (59%)
 Frame = -3

Query: 240  KLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAE 61
            KL ++ + QQ  R VED E W+ E E    S + GKDL  VQNL KKH  L+A++  H  
Sbjct: 880  KLSDSLRLQQLFRDVEDEETWIREKEPIAASTNRGKDLIGVQNLLKKHQALQAEIVGHEP 939

Query: 60   RIDAIREPG 34
            RI A+ + G
Sbjct: 940  RIKAVTQKG 948



 Score = 55.2 bits (127), Expect = 1e-06
 Identities = 26/70 (37%), Positives = 42/70 (60%)
 Frame = -3

Query: 249 KGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSS 70
           KG +L +A +  QY R  ED   W+S+ E    SE+ G+DL  V+ LQKK    + D+++
Sbjct: 141 KGLRLLQAQKLVQYLRECEDALDWISDKEAMATSEELGQDLEHVELLQKKFEEFQTDLAA 200

Query: 69  HAERIDAIRE 40
           H ER++ + +
Sbjct: 201 HEERVNEVNQ 210



 Score = 52.0 bits (119), Expect = 1e-05
 Identities = 25/74 (33%), Positives = 43/74 (58%)
 Frame = -3

Query: 261 VFELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEA 82
           ++E++  + ++    Q + R  E ++ W+S+ E  LL+ED G  L SV+ L KKH   E 
Sbjct: 537 LWEVRRQQYEQCMDLQLFYRDTEQVDNWMSKQEAFLLNEDLGDSLDSVEALLKKHEDFEK 596

Query: 81  DVSSHAERIDAIRE 40
            +S+  E+I A+ E
Sbjct: 597 SLSAQEEKITALDE 610



 Score = 50.8 bits (116), Expect = 2e-05
 Identities = 23/81 (28%), Positives = 47/81 (58%)
 Frame = -3

Query: 282  NMGATGAVFELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQK 103
            N      + E + + L  A + Q+++R  ++ + W+ E    L +++YG DL SVQ LQ+
Sbjct: 1328 NFNTIKQLAEDRSHMLGSAHEVQRFHRDADETKEWIEEKNQALNTDNYGHDLASVQALQR 1387

Query: 102  KHALLEADVSSHAERIDAIRE 40
            KH   E D+++  ++++++ E
Sbjct: 1388 KHEGFERDLAALGDKVNSLGE 1408



 Score = 47.6 bits (108), Expect = 2e-04
 Identities = 22/65 (33%), Positives = 42/65 (64%)
 Frame = -3

Query: 240 KLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAE 61
           +L  AA+ Q++NR V++   W+ E    + S+D+G+D  SVQ L +KH  LE D+++  +
Sbjct: 250 RLFGAAEVQRFNRDVDETISWIKERGALIGSDDFGRDPGSVQALLRKHEGLERDLAALED 309

Query: 60  RIDAI 46
           +++ +
Sbjct: 310 KVNTL 314



 Score = 46.0 bits (104), Expect = 7e-04
 Identities = 23/55 (41%), Positives = 32/55 (58%)
 Frame = -3

Query: 237  LQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVS 73
            L+++ Q QQY     + E W+ E E  + S DYGKD  S + L KKH  L +D+S
Sbjct: 987  LEDSLQAQQYFADANEAESWMREKEPIVGSTDYGKDEDSAEALLKKHEALMSDLS 1041



 Score = 44.8 bits (101), Expect = 0.002
 Identities = 20/69 (28%), Positives = 38/69 (55%)
 Frame = -1

Query: 449  DPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEELGGIWER 270
            D   +   ++KHQ  + E+  ++PR+  +T  G+ ++E  HFA   +  ++ EL G W+ 
Sbjct: 916  DLIGVQNLLKKHQALQAEIVGHEPRIKAVTQKGETMVEEGHFAGEDVKVKLTELHGRWDT 975

Query: 269  LVQSSS*RE 243
            L   +S R+
Sbjct: 976  LKLKASQRK 984



 Score = 44.4 bits (100), Expect = 0.002
 Identities = 21/69 (30%), Positives = 43/69 (62%)
 Frame = -3

Query: 237 LQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAER 58
           L+++   QQ+ R  ++++ W++E       E Y KD +++Q   +KH   EA++S++  R
Sbjct: 651 LEDSFHLQQFFRDSDELKSWINEKMKTATDEAY-KDPSNLQGKVQKHQAFEAELSANQSR 709

Query: 57  IDAIREPGR 31
           IDA+++ G+
Sbjct: 710 IDALQKSGQ 718



 Score = 43.2 bits (97), Expect = 0.005
 Identities = 22/73 (30%), Positives = 44/73 (60%)
 Frame = -3

Query: 252 LKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVS 73
           ++  KL+++ + Q + R  E++E W+ E + Q+ S++  KD +++Q   +KH   EA+V 
Sbjct: 35  MRRQKLEDSYRFQCFRRDAEELEKWIQE-KLQIASDENYKDPSNLQGKLQKHQAFEAEVQ 93

Query: 72  SHAERIDAIREPG 34
           ++A  I  + E G
Sbjct: 94  ANAGTIIKLDETG 106



 Score = 42.7 bits (96), Expect = 0.006
 Identities = 20/72 (27%), Positives = 40/72 (55%)
 Frame = -3

Query: 255  ELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADV 76
            E + + L+++ ++    R   +++ W+ E EG L +E+ G DL  V+ LQKK    + D+
Sbjct: 1201 EKRKDMLEKSCKKFMLFREANELQQWIHEKEGTLTNEEVGSDLEQVEVLQKKFDDFQKDL 1260

Query: 75   SSHAERIDAIRE 40
             ++  R+  I +
Sbjct: 1261 KANESRLRDINK 1272



 Score = 35.9 bits (79), Expect = 0.74
 Identities = 19/68 (27%), Positives = 33/68 (48%)
 Frame = -1

Query: 467  TDDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEEL 288
            TD+   D  ++    +KH+ FE++L A   +V+ +    +RL++    A   I  +  EL
Sbjct: 1372 TDNYGHDLASVQALQRKHEGFERDLAALGDKVNSLGETAERLIQSHPEAVEDIKEKCSEL 1431

Query: 287  GGIWERLV 264
               W  LV
Sbjct: 1432 NTAWSSLV 1439



 Score = 35.5 bits (78), Expect = 0.97
 Identities = 19/67 (28%), Positives = 35/67 (52%)
 Frame = -1

Query: 467 TDDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEEL 288
           +DD   DP ++   ++KH+  E++L A + +V+ +     RL E       QI  + +EL
Sbjct: 280 SDDFGRDPGSVQALLRKHEGLERDLAALEDKVNTLGGDAGRLQETHPQNASQILLKKDEL 339

Query: 287 GGIWERL 267
              WE++
Sbjct: 340 VANWEQI 346



 Score = 33.5 bits (73), Expect = 3.9
 Identities = 11/46 (23%), Positives = 29/46 (63%)
 Frame = -1

Query: 425 VQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEEL 288
           ++KH++FE+ L A + ++  +     +L++  H+A+  +++R + L
Sbjct: 588 LKKHEDFEKSLSAQEEKITALDEFATKLIQNNHYAKEDVATRRDAL 633



 Score = 32.3 bits (70), Expect = 9.1
 Identities = 13/49 (26%), Positives = 27/49 (55%)
 Frame = -3

Query: 243  NKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKH 97
            +KL  +   Q++     D+  W++ + G + SE+  KD+T  + L ++H
Sbjct: 1447 DKLANSHDLQRFLSDFRDLMSWINGIRGLVSSEELAKDVTGAEALLERH 1495


>UniRef50_Q7KV70 Cluster: CG12008-PC, isoform C; n=14;
            Endopterygota|Rep: CG12008-PC, isoform C - Drosophila
            melanogaster (Fruit fly)
          Length = 4207

 Score = 78.2 bits (184), Expect = 1e-13
 Identities = 36/72 (50%), Positives = 49/72 (68%)
 Frame = -3

Query: 255  ELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADV 76
            + K +KLQ+A     +NR+V++   W+ EVE QL SEDYGKDL +V NL KKH  LEADV
Sbjct: 2873 QTKKDKLQQAYDALAFNRSVDEFNNWMDEVELQLSSEDYGKDLAAVSNLLKKHERLEADV 2932

Query: 75   SSHAERIDAIRE 40
            + H E  D +++
Sbjct: 2933 AHHGELADQLKQ 2944



 Score = 68.5 bits (160), Expect = 1e-10
 Identities = 30/72 (41%), Positives = 48/72 (66%)
 Frame = -1

Query: 470  ATDDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEE 291
            A D++Y +P+NL  K+QKH  F+ EL +N PRV  +   G+RL+  +HFA+ +I+ +V+ 
Sbjct: 2801 ALDENYREPSNLQSKIQKHAAFDAELLSNSPRVQSVIHEGERLIRGDHFAKDEIAQQVQL 2860

Query: 290  LGGIWERLVQSS 255
            L G W +L  +S
Sbjct: 2861 LEGDWLKLKGAS 2872



 Score = 60.9 bits (141), Expect = 2e-08
 Identities = 38/116 (32%), Positives = 66/116 (56%)
 Frame = -1

Query: 476  KFATDDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRV 297
            + A D++Y D +NL  K+QKHQ FE+EL+AN+ ++  +T  G+ L++  +   P++ SRV
Sbjct: 1418 RIAGDENYRDLSNLPRKLQKHQAFERELRANEGQLRNVTKDGQALVQAGN-RVPEVESRV 1476

Query: 296  EELGGIWERLVQSSS*RETSCRKRLNNSSTTGPSRTLNFGSRKLKDSCSARTTGRI 129
             +L   W+ L+  S   E   RK    +S    +R+L    +K+ +  SA  +G +
Sbjct: 1477 ADLNKRWKDLLTLS---EDKGRKLEQAASQREHNRSLEDAKKKVDELDSALRSGDV 1529



 Score = 54.0 bits (124), Expect = 3e-06
 Identities = 25/74 (33%), Positives = 47/74 (63%)
 Frame = -3

Query: 255  ELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADV 76
            E KG KL++AA Q+++NR++ED +  + E++  L S D G DL S ++L  K  +LE+++
Sbjct: 1491 EDKGRKLEQAASQREHNRSLEDAKKKVDELDSALRSGDVGNDLRSCKDLINKQQILESEI 1550

Query: 75   SSHAERIDAIREPG 34
            +   +++  +   G
Sbjct: 1551 TIWDQKVAELVSTG 1564



 Score = 52.8 bits (121), Expect = 6e-06
 Identities = 28/74 (37%), Positives = 43/74 (58%)
 Frame = -3

Query: 252  LKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVS 73
            ++   L+++   QQ+ R  ED   WL+E +    S+D G  L SVQ LQKKH  LEA+++
Sbjct: 2980 IRRENLEDSLSLQQFLRDAEDELQWLAEKQLVAGSQDLGTSLLSVQGLQKKHNSLEAELT 3039

Query: 72   SHAERIDAIREPGR 31
            S    I A+ + G+
Sbjct: 3040 SQEPLIQALLQRGQ 3053



 Score = 50.0 bits (114), Expect = 4e-05
 Identities = 26/68 (38%), Positives = 40/68 (58%), Gaps = 3/68 (4%)
 Frame = -1

Query: 458  SYLDPTNLNGKV---QKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEEL 288
            SY + TNL+ K+   QKHQ F+ E+ AN+ R+ EI   G  LL  +H + P+I   +E +
Sbjct: 2271 SYAEVTNLDEKIKKLQKHQAFQAEVAANQGRIQEIQDTGVILLSKQHESSPEIKRAIEIV 2330

Query: 287  GGIWERLV 264
               W+ L+
Sbjct: 2331 LEAWQGLL 2338



 Score = 48.0 bits (109), Expect = 2e-04
 Identities = 24/70 (34%), Positives = 39/70 (55%)
 Frame = -3

Query: 249  KGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSS 70
            +   L EA Q Q +   VE +E+WL+  E  L ++D G   T+V+ L KKH   E +   
Sbjct: 2666 RARDLTEAHQLQLFKAQVEQVEIWLANKEAFLNNDDLGDSYTAVERLLKKHD--EFEKLL 2723

Query: 69   HAERIDAIRE 40
            HA+ +D +++
Sbjct: 2724 HADHVDTLQK 2733



 Score = 47.6 bits (108), Expect = 2e-04
 Identities = 21/64 (32%), Positives = 39/64 (60%)
 Frame = -3

Query: 237  LQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAER 58
            L  A Q   Y+R  ++    ++E +  L+SEDYG+DL S+Q L +KH + E+++     +
Sbjct: 3303 LAGAKQVHVYDRVADETIQLINEKDASLISEDYGQDLESIQALGRKHQVFESELVGIQGQ 3362

Query: 57   IDAI 46
            +D++
Sbjct: 3363 VDSV 3366



 Score = 46.0 bits (104), Expect = 7e-04
 Identities = 22/70 (31%), Positives = 41/70 (58%)
 Frame = -3

Query: 273 ATGAVFELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHA 94
           A  A+ EL+  +L++AA+  Q+     + E WL+E    + S DYG D  S Q L ++H 
Sbjct: 695 ALEALVELRRRQLEDAAEAYQFYTDANEAESWLNEKIALVNSRDYGNDEPSAQALLQRHR 754

Query: 93  LLEADVSSHA 64
            L+ ++++++
Sbjct: 755 DLQGELNAYS 764



 Score = 45.2 bits (102), Expect = 0.001
 Identities = 18/52 (34%), Positives = 32/52 (61%)
 Frame = -1

Query: 422 QKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEELGGIWERL 267
           QKH+  E E+++ KP+  +++  GKRL+  +H    +I SR++ L   W+ L
Sbjct: 645 QKHKALEDEIKSRKPKSGQMSTAGKRLIGEQHPRSSEIQSRIDSLAEHWQAL 696



 Score = 44.4 bits (100), Expect = 0.002
 Identities = 22/63 (34%), Positives = 35/63 (55%)
 Frame = -3

Query: 240  KLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAE 61
            +L E+  + +Y    +++E W+ E E    SEDYG+D   +Q LQ K   L+  V   A+
Sbjct: 1814 RLMESLYKHEYFLESDEVEQWIREQEQAASSEDYGQDFEHLQLLQNKFDDLKHRVEVGAD 1873

Query: 60   RID 52
            R+D
Sbjct: 1874 RVD 1876



 Score = 42.7 bits (96), Expect = 0.006
 Identities = 19/68 (27%), Positives = 39/68 (57%), Gaps = 1/68 (1%)
 Frame = -3

Query: 243  NKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSH- 67
            N+++    QQ +N + + +  W+  V+ QL +++  +D+ +  NL KKH  L  D+ +H 
Sbjct: 1180 NRIESEVGQQVFNNSAKVLLAWIDSVKDQLNADESARDVETANNLLKKHNDLGDDIRAHD 1239

Query: 66   AERIDAIR 43
             E ++ I+
Sbjct: 1240 TEFVEVIQ 1247



 Score = 41.5 bits (93), Expect = 0.015
 Identities = 20/62 (32%), Positives = 32/62 (51%)
 Frame = -3

Query: 249  KGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSS 70
            +  KL  + + QQY     +IE WL E    L S +YG+D  S   L  KH  +E ++ +
Sbjct: 1705 RSRKLDMSLKAQQYLFDAGEIESWLGERNNVLRSTEYGRDRDSAAKLLTKHKTIELELDT 1764

Query: 69   HA 64
            ++
Sbjct: 1765 YS 1766



 Score = 41.5 bits (93), Expect = 0.015
 Identities = 20/75 (26%), Positives = 39/75 (52%)
 Frame = -3

Query: 264  AVFELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLE 85
            A  E +G  L+EA    ++N  ++ IE W+ + E  + + D G+DL     L +K   ++
Sbjct: 2339 AELEQRGRGLEEAQDSLEFNSQLDKIEAWIRDKEMMVQASDTGRDLEHCNALMRKLDDVD 2398

Query: 84   ADVSSHAERIDAIRE 40
            +D+    +R+  I +
Sbjct: 2399 SDMRVDDQRVKHINQ 2413



 Score = 40.7 bits (91), Expect = 0.026
 Identities = 19/65 (29%), Positives = 35/65 (53%)
 Frame = -3

Query: 240  KLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAE 61
            +L +A + Q +     + + W+ E    L S DYG+D  SVQ  QKK  +L+ ++++   
Sbjct: 3090 RLLDAVESQLFYVEANEADAWMREKRPVLSSSDYGRDEVSVQGHQKKLEVLQRELTAFKP 3149

Query: 60   RIDAI 46
             I+ +
Sbjct: 3150 SIEKV 3154



 Score = 39.9 bits (89), Expect = 0.045
 Identities = 19/70 (27%), Positives = 41/70 (58%)
 Frame = -3

Query: 237  LQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAER 58
            L+ A+  + +NR  ++ ++W+SE   QL +     DL +VQ LQ++H  LE +++   ++
Sbjct: 1076 LEGASSVELFNRTCDEAKVWMSEKMLQLDTAVITPDLRTVQALQRRHQNLERELAPVEDK 1135

Query: 57   IDAIREPGRA 28
            ++ +   G +
Sbjct: 1136 VNRVTYLGNS 1145



 Score = 39.5 bits (88), Expect = 0.060
 Identities = 19/74 (25%), Positives = 46/74 (62%)
 Frame = -3

Query: 255  ELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADV 76
            E +  +L ++ Q Q++ R++ +I+ WL +     L E+Y ++ +++Q+  +KHA  +A++
Sbjct: 2768 EERKQRLTQSHQLQEFLRSLYEIDRWLVQKLQVALDENY-REPSNLQSKIQKHAAFDAEL 2826

Query: 75   SSHAERIDAIREPG 34
             S++ R+ ++   G
Sbjct: 2827 LSNSPRVQSVIHEG 2840



 Score = 38.3 bits (85), Expect = 0.14
 Identities = 23/101 (22%), Positives = 49/101 (48%), Gaps = 1/101 (0%)
 Frame = -3

Query: 333  RTFCSTSNIVSRG-RAGRNMGATGAVFELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQ 157
            R    +SNI  +  + G+       + + + ++L E  +  +Y R  E++  W+ +    
Sbjct: 3164 RNHFDSSNIAEKNAQVGQEYEDLLRLAKERESRLGECKKLFEYLRETEELHEWVGDQMAV 3223

Query: 156  LLSEDYGKDLTSVQNLQKKHALLEADVSSHAERIDAIREPG 34
              SEDYG+D+  V+ L        ++++++  R++A  E G
Sbjct: 3224 TASEDYGEDVEHVEQLILAFESFVSNLNANEARVEACLERG 3264



 Score = 37.9 bits (84), Expect = 0.18
 Identities = 20/78 (25%), Positives = 39/78 (50%)
 Frame = -3

Query: 240  KLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAE 61
            KL+E+    ++   ++    W++E      S + G++L   Q+L KKH  LEA++  H  
Sbjct: 1602 KLEESLNYHKFVFELDSEFQWINEHLPAAKSNELGQNLHQAQSLHKKHKKLEAEIKGHQP 1661

Query: 60   RIDAIREPGRASS*KREP 7
             I+     G++   ++ P
Sbjct: 1662 MINKALVAGQSLISQQHP 1679



 Score = 35.9 bits (79), Expect = 0.74
 Identities = 18/53 (33%), Positives = 32/53 (60%)
 Frame = -3

Query: 210  YNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAERID 52
            +NR V+D    ++E    + S D G+DL +V+ L ++   LE D+S+  ++ID
Sbjct: 2465 FNRDVDDTADRIAEKSLAMSSTDTGRDLAAVEALIRREEALERDMSAVKQKID 2517



 Score = 35.5 bits (78), Expect = 0.97
 Identities = 17/58 (29%), Positives = 30/58 (51%)
 Frame = -3

Query: 216  QQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAERIDAIR 43
            Q + +  E +E W+S  E QL     G  +  V++L ++H   E  V++  E+  AI+
Sbjct: 3522 QLFLKDAEILEQWISSREPQLKDTKLGDSIPQVEDLLRRHEDFEKTVAAQEEKFQAIK 3579



 Score = 34.7 bits (76), Expect = 1.7
 Identities = 22/83 (26%), Positives = 40/83 (48%), Gaps = 1/83 (1%)
 Frame = -1

Query: 488  RES*KFATDDSY-LDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQ 312
            RE  + A+ + Y  D  +L     K  + +  ++    RVD+   + K+L++ E     +
Sbjct: 1836 REQEQAASSEDYGQDFEHLQLLQNKFDDLKHRVEVGADRVDQCELLAKKLIDSESPYANE 1895

Query: 311  ISSRVEELGGIWERLVQSSS*RE 243
            +  R E+L   WE L+Q  + RE
Sbjct: 1896 VEKRQEQLRTSWENLLQLLNQRE 1918



 Score = 34.7 bits (76), Expect = 1.7
 Identities = 17/58 (29%), Positives = 30/58 (51%)
 Frame = -3

Query: 204  RAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAERIDAIREPGR 31
            R  + I+   S  +  L S D+G+ +  VQN  +KH   E  + +  E++  ++E GR
Sbjct: 2143 RDAKQIDNLSSSQQAALSSSDFGQTVEDVQNKIRKHDEFERLIQTQEEKVSLLQEHGR 2200



 Score = 33.9 bits (74), Expect = 3.0
 Identities = 20/80 (25%), Positives = 38/80 (47%)
 Frame = -3

Query: 240 KLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAE 61
           +L+EA     +    ++ E WL + +    +    KDL +V +LQ+KH  LE ++ S   
Sbjct: 600 RLEEARNFHHFMEDYDNEESWLVDKQRICKTGITAKDLRAVLSLQQKHKALEDEIKSRKP 659

Query: 60  RIDAIREPGRASS*KREPLS 1
           +   +   G+    ++ P S
Sbjct: 660 KSGQMSTAGKRLIGEQHPRS 679



 Score = 33.5 bits (73), Expect = 3.9
 Identities = 14/51 (27%), Positives = 28/51 (54%)
 Frame = -1

Query: 440  NLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEEL 288
            ++ G  +KH + E EL + +P +  +   G++++   HFA  Q+  + E L
Sbjct: 3023 SVQGLQKKHNSLEAELTSQEPLIQALLQRGQQMIRDNHFASEQLQYKSELL 3073



 Score = 33.1 bits (72), Expect = 5.2
 Identities = 12/46 (26%), Positives = 26/46 (56%)
 Frame = -1

Query: 440  NLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISS 303
            ++  K++KH  FE+ +Q  + +V  +   G++L+E  H+    I +
Sbjct: 2170 DVQNKIRKHDEFERLIQTQEEKVSLLQEHGRKLIEQRHYDSANIQT 2215


>UniRef50_UPI00015B6254 Cluster: PREDICTED: similar to beta chain
            spectrin; n=1; Nasonia vitripennis|Rep: PREDICTED:
            similar to beta chain spectrin - Nasonia vitripennis
          Length = 4265

 Score = 77.4 bits (182), Expect = 2e-13
 Identities = 35/72 (48%), Positives = 51/72 (70%)
 Frame = -3

Query: 255  ELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADV 76
            +LK N+L +A Q   ++R +++ E W+ E+E QL SED+GKDL+SV NL K+H  LE DV
Sbjct: 2932 KLKKNRLDDAYQALLFSRTLDEFEAWIDEIETQLQSEDHGKDLSSVANLLKRHTNLENDV 2991

Query: 75   SSHAERIDAIRE 40
             SH E  ++I+E
Sbjct: 2992 MSHNETCESIKE 3003



 Score = 75.4 bits (177), Expect = 1e-12
 Identities = 35/77 (45%), Positives = 50/77 (64%)
 Frame = -1

Query: 485  ES*KFATDDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQIS 306
            E  + A+D++Y D TNL  K+QKH  FE EL ANK RV  +T  G+ L++ +HFA  +I 
Sbjct: 2855 EKQQVASDENYRDSTNLQSKIQKHVAFESELAANKGRVSAVTTEGEALVKEDHFASKEIQ 2914

Query: 305  SRVEELGGIWERLVQSS 255
             R++EL   WE L ++S
Sbjct: 2915 ERLDELEAEWELLQETS 2931



 Score = 62.9 bits (146), Expect = 6e-09
 Identities = 28/73 (38%), Positives = 47/73 (64%)
 Frame = -3

Query: 249  KGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSS 70
            KG +L++AA Q  YNR +ED  L L E+E  L S++ G+DL + ++L KKH LLE  +  
Sbjct: 1556 KGRRLRQAAAQHGYNRIIEDARLDLEEIENSLASQEVGQDLRNCKDLLKKHQLLETKLGQ 1615

Query: 69   HAERIDAIREPGR 31
              ++++ + + G+
Sbjct: 1616 WEQKVNDLVQMGQ 1628



 Score = 59.3 bits (137), Expect = 7e-08
 Identities = 26/71 (36%), Positives = 44/71 (61%)
 Frame = -1

Query: 476  KFATDDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRV 297
            K A+D++Y D  NL  K+QKH+ FE+EL+AN+ ++  +   GK L+  E++    +   +
Sbjct: 1480 KTASDETYRDLNNLERKLQKHEAFERELRANEGQLRAVNKAGKALISEENYRSEDVGKVL 1539

Query: 296  EELGGIWERLV 264
            E+L   W+ LV
Sbjct: 1540 EDLNKQWDELV 1550



 Score = 55.6 bits (128), Expect = 9e-07
 Identities = 38/92 (41%), Positives = 51/92 (55%), Gaps = 7/92 (7%)
 Frame = -3

Query: 255  ELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEAD- 79
            +++ + L++A    Q+ R VED   WLSE E    S+D G  LT+VQ LQKKH  LEA+ 
Sbjct: 3038 QIRRDNLEDAKLLHQFARDVEDELHWLSEKEVLAGSKDLGSSLTTVQRLQKKHHALEAEL 3097

Query: 78   ------VSSHAERIDAIREPGRASS*KREPLS 1
                  V+S A R  A+   G  +S K E LS
Sbjct: 3098 ISREPVVASLASRATAMVRSGHFASEKIESLS 3129



 Score = 46.8 bits (106), Expect = 4e-04
 Identities = 23/72 (31%), Positives = 45/72 (62%)
 Frame = -3

Query: 243  NKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHA 64
            NKL E+ +  Q+ R V ++E WL E + Q+ S++  +D T++Q+  +KH   E++++++ 
Sbjct: 2831 NKLVESRRLHQFLRNVLEVEGWLHEKQ-QVASDENYRDSTNLQSKIQKHVAFESELAANK 2889

Query: 63   ERIDAIREPGRA 28
             R+ A+   G A
Sbjct: 2890 GRVSAVTTEGEA 2901



 Score = 43.2 bits (97), Expect = 0.005
 Identities = 20/62 (32%), Positives = 36/62 (58%)
 Frame = -3

Query: 252 LKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVS 73
           L+  +L+EAA+  Q+     + + W+ E    + SEDYG D  S Q L ++H  LE +++
Sbjct: 762 LRKKQLEEAAEALQFCADANEADSWMKEKMALVASEDYGVDEPSAQALLQRHKDLEGELN 821

Query: 72  SH 67
           ++
Sbjct: 822 AY 823



 Score = 43.2 bits (97), Expect = 0.005
 Identities = 21/67 (31%), Positives = 36/67 (53%)
 Frame = -3

Query: 240  KLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAE 61
            +L +A + Q +     + E W+ E +  L S DYGKD  SVQ+L KK   +E D+     
Sbjct: 3149 RLLDAVESQMFYAEAAEAEQWIKEKQPLLNSTDYGKDEDSVQSLFKKLEGVERDLCGFTS 3208

Query: 60   RIDAIRE 40
             ++ +++
Sbjct: 3209 TVENLKK 3215



 Score = 41.5 bits (93), Expect = 0.015
 Identities = 17/52 (32%), Positives = 32/52 (61%)
 Frame = -1

Query: 422 QKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEELGGIWERL 267
           QKH+  E E +  +P+ ++++  G+RL+  +H + P+I +R+E L   W  L
Sbjct: 705 QKHKALEDETKTRRPKSEQLSQAGRRLVCEQHPSAPEIENRLESLQEHWRVL 756



 Score = 41.5 bits (93), Expect = 0.015
 Identities = 20/65 (30%), Positives = 37/65 (56%)
 Frame = -3

Query: 249  KGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSS 70
            K   L+ A+  + +NR  ++   W+ E   QL + + G DL +VQ LQ++H  LE +++ 
Sbjct: 1134 KEKSLEGASSVELFNRTCDEAHDWMLEKITQLDTAELGPDLKTVQALQRRHQHLERELAP 1193

Query: 69   HAERI 55
              E++
Sbjct: 1194 VEEKV 1198



 Score = 41.5 bits (93), Expect = 0.015
 Identities = 23/70 (32%), Positives = 36/70 (51%)
 Frame = -3

Query: 255  ELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADV 76
            E +G  L+EA     +N  VE IE W+ + E  + + D GKD     +LQ+K   +++D+
Sbjct: 2405 ENRGRGLEEAQDILDFNNQVEKIEAWIRDKEMMVQAGDIGKDYEHCLSLQRKLDDVDSDM 2464

Query: 75   SSHAERIDAI 46
                 RI  I
Sbjct: 2465 RVDDARIKTI 2474



 Score = 41.1 bits (92), Expect = 0.020
 Identities = 18/58 (31%), Positives = 30/58 (51%)
 Frame = -3

Query: 216  QQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAERIDAIR 43
            Q + R  E +E W++  E  L  E YG+ +  V+ L  KH   E  + +  E+ +AI+
Sbjct: 3582 QTFKRDAETLENWIASREPMLRDEQYGESIPQVEELIMKHQDFEKTIEAQEEKFNAIK 3639



 Score = 39.9 bits (89), Expect = 0.045
 Identities = 19/70 (27%), Positives = 40/70 (57%)
 Frame = -3

Query: 237  LQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAER 58
            LQ +   QQ++  V+D++ WLS+       E Y +DL +++   +KH   E ++ ++  +
Sbjct: 1455 LQASEYYQQFSAEVDDLKDWLSDKMKTASDETY-RDLNNLERKLQKHEAFERELRANEGQ 1513

Query: 57   IDAIREPGRA 28
            + A+ + G+A
Sbjct: 1514 LRAVNKAGKA 1523



 Score = 39.1 bits (87), Expect = 0.079
 Identities = 19/67 (28%), Positives = 34/67 (50%)
 Frame = -3

Query: 240  KLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAE 61
            KL++A Q Q +       + WL+  E  L ++D G  L+ V+ L +KH   E  ++    
Sbjct: 2726 KLKQAHQLQLFKEQANQADSWLATKEAFLNNDDLGDSLSGVEKLMRKHEDFEKMLTPQLG 2785

Query: 60   RIDAIRE 40
            RI+ + +
Sbjct: 2786 RIEELEK 2792



 Score = 37.5 bits (83), Expect = 0.24
 Identities = 32/127 (25%), Positives = 59/127 (46%)
 Frame = -3

Query: 411 ELRTGAAGQQASRRRDNGRRQASA*ARTFCSTSNIVSRGRAGRNMGATGAVFELKGNKLQ 232
           EL+  A G+  S+RR   + QA   A +  +        +  +  G  G   + +  +L+
Sbjct: 605 ELQVTALGE--SQRRLARQAQAQPHALSKEAALLEAKLEQLNKAYGQLGEYSKERKARLE 662

Query: 231 EAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAERID 52
           +A    Q+ +  ED E WL E +    +    KDL ++ +LQ+KH  LE +  +   + +
Sbjct: 663 DARNFFQFLQDHEDEESWLVERQRICRAGIVAKDLRALISLQQKHKALEDETKTRRPKSE 722

Query: 51  AIREPGR 31
            + + GR
Sbjct: 723 QLSQAGR 729



 Score = 37.5 bits (83), Expect = 0.24
 Identities = 19/67 (28%), Positives = 34/67 (50%)
 Frame = -3

Query: 252  LKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVS 73
            L+  +L E+  + +Y     ++E W+ E E    SEDYG+D   +  LQ K    +  + 
Sbjct: 1873 LRQQRLMESMYRHEYFLESRELEQWIKEQEQTASSEDYGQDYEHLLLLQAKFNDFKHRIE 1932

Query: 72   SHAERID 52
            + +ER +
Sbjct: 1933 AGSERFN 1939



 Score = 35.9 bits (79), Expect = 0.74
 Identities = 17/61 (27%), Positives = 31/61 (50%)
 Frame = -3

Query: 249  KGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSS 70
            + + L  + + Q++     ++E WL E    L S DYG+D  +   L  KH  LE ++ +
Sbjct: 1768 RSHALDLSLKAQEFFFEAGEVESWLVEKNDVLNSTDYGRDRDAATKLLTKHKALELELDT 1827

Query: 69   H 67
            +
Sbjct: 1828 Y 1828



 Score = 35.1 bits (77), Expect = 1.3
 Identities = 22/69 (31%), Positives = 35/69 (50%)
 Frame = -3

Query: 276  GATGAVFELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKH 97
            GA GA  E     L  A +   +NR ++D    + E    + + D GKDL  V +LQ+K 
Sbjct: 2510 GALGAYRET----LAGALEIHLFNRDIDDTNQRVVEKSLAMNTNDVGKDLAGVDHLQRKQ 2565

Query: 96   ALLEADVSS 70
              +E D+++
Sbjct: 2566 EAMERDMTA 2574



 Score = 34.7 bits (76), Expect = 1.7
 Identities = 20/76 (26%), Positives = 41/76 (53%)
 Frame = -1

Query: 470  ATDDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEE 291
            A++D   D  ++   +Q  +NF   L +++ R+  I   G++LLE ++    +I S+++E
Sbjct: 3284 ASEDYGCDVEHVELLIQMFENFLSSLISSENRMTGIIEAGQKLLEEKNPESSKIHSKIDE 3343

Query: 290  LGGIWERLVQSSS*RE 243
                WE L + +  R+
Sbjct: 3344 TKQQWEDLKELAHARQ 3359



 Score = 33.1 bits (72), Expect = 5.2
 Identities = 18/47 (38%), Positives = 25/47 (53%), Gaps = 1/47 (2%)
 Frame = -3

Query: 192  DIEL-WLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAERI 55
            D EL W+++   Q  S   G++L   Q+L KKH   EA+V  H   I
Sbjct: 1680 DAELQWINDHLPQATSTMMGQNLHQTQSLHKKHKKFEAEVQGHEPMI 1726



 Score = 33.1 bits (72), Expect = 5.2
 Identities = 15/61 (24%), Positives = 32/61 (52%)
 Frame = -1

Query: 470  ATDDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEE 291
            + D+  +    ++ +V+KH  FE+ L   + ++  +   G +LL   HF    I+ R++E
Sbjct: 2224 SNDNFGVSVEEVDAQVKKHNEFEKLLITQEDKLAALQEHGSKLLSQNHFESRTIAKRLDE 2283

Query: 290  L 288
            +
Sbjct: 2284 V 2284


>UniRef50_A7RGP6 Cluster: Predicted protein; n=2; Nematostella
            vectensis|Rep: Predicted protein - Nematostella vectensis
          Length = 3582

 Score = 77.4 bits (182), Expect = 2e-13
 Identities = 34/62 (54%), Positives = 46/62 (74%)
 Frame = -3

Query: 249  KGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSS 70
            KGNKLQ+A +Q+Q NRA+ED+ +W++E E  L  ED G+DL  V+ L KKH LLE+D+  
Sbjct: 1054 KGNKLQQAERQRQLNRAMEDVRIWMNETEAVLGLEDTGRDLAGVKFLTKKHQLLESDIEM 1113

Query: 69   HA 64
            HA
Sbjct: 1114 HA 1115



 Score = 70.9 bits (166), Expect = 2e-11
 Identities = 30/74 (40%), Positives = 49/74 (66%)
 Frame = -3

Query: 267  GAVFELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALL 88
            G + + K  +L+EA Q+Q + R V +++ W+ EVE  L SEDYGKD+ SV NL K+H  L
Sbjct: 2425 GDLSDNKAQRLKEAIQKQTFERNVIELQAWIEEVENALASEDYGKDMRSVNNLIKRHQSL 2484

Query: 87   EADVSSHAERIDAI 46
            + D++ + +R+  +
Sbjct: 2485 QMDIARYEDRVSEL 2498



 Score = 70.5 bits (165), Expect = 3e-11
 Identities = 31/73 (42%), Positives = 48/73 (65%)
 Frame = -1

Query: 470  ATDDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEE 291
            ATD+S+ DP NL  K+QKHQ FE EL A++  +D +   G++L+   HFA  ++  R+E 
Sbjct: 1828 ATDESFKDPINLESKLQKHQAFESELTAHERAIDSVRDKGEQLISCGHFAASEVEVRIEA 1887

Query: 290  LGGIWERLVQSSS 252
            L   WE L+++S+
Sbjct: 1888 LYIQWEELLEASA 1900



 Score = 64.5 bits (150), Expect = 2e-09
 Identities = 27/79 (34%), Positives = 46/79 (58%)
 Frame = -1

Query: 488  RES*KFATDDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQI 309
            +E  + A D+S+ DP NL G +++H+ FE E+ ANK  +D I   GK L+  +HF   ++
Sbjct: 974  KEKSQIAEDESFKDPKNLQGNLKRHKAFEAEITANKDGIDRINKAGKDLIRTKHFGAQKV 1033

Query: 308  SSRVEELGGIWERLVQSSS 252
              +++ L   W  LV  ++
Sbjct: 1034 KDKLKGLNEAWLNLVADTT 1052



 Score = 60.1 bits (139), Expect = 4e-08
 Identities = 28/73 (38%), Positives = 42/73 (57%)
 Frame = -1

Query: 485  ES*KFATDDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQIS 306
            E  + A + SY + TNL  K+QKHQ FE E+ A+K  +D IT  G+ L+      Q  + 
Sbjct: 2352 EKLQIAAEASYREATNLQQKLQKHQTFEAEVSAHKSELDAITQTGQSLMRNSPSCQETVE 2411

Query: 305  SRVEELGGIWERL 267
            SR+++L  +W  L
Sbjct: 2412 SRLKDLADLWSLL 2424



 Score = 53.6 bits (123), Expect = 3e-06
 Identities = 26/68 (38%), Positives = 41/68 (60%)
 Frame = -3

Query: 249  KGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSS 70
            KG KLQEA   QQ+N+ V+  +  +++ E  +LS DYG+D      LQ+K    + D++ 
Sbjct: 1902 KGRKLQEARDHQQFNQEVDIADSCITDKETIVLSSDYGRDFEHCVRLQRKMKEFDQDLAV 1961

Query: 69   HAERIDAI 46
             A R++AI
Sbjct: 1962 DAARVEAI 1969



 Score = 48.8 bits (111), Expect = 1e-04
 Identities = 21/70 (30%), Positives = 38/70 (54%)
 Frame = -3

Query: 240  KLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAE 61
            +L ++   Q+Y     + + W+++  G   S+DYGKD  S + L  +H  L+ DV++ + 
Sbjct: 1269 RLHDSFLSQKYLSEANEADSWMNDKAGLAASQDYGKDGASAETLLTRHKALQVDVAAFST 1328

Query: 60   RIDAIREPGR 31
             ID + E  R
Sbjct: 1329 TIDELAEEAR 1338



 Score = 48.0 bits (109), Expect = 2e-04
 Identities = 22/71 (30%), Positives = 40/71 (56%)
 Frame = -3

Query: 255  ELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADV 76
            + +  KLQ +    QY   V +++ W+SE    + S DYG+D TS + L +KH  L+ ++
Sbjct: 2641 QTRNEKLQASLATHQYYDQVFEMDAWVSEKLSLVSSTDYGRDETSAETLLRKHDALQLEL 2700

Query: 75   SSHAERIDAIR 43
             ++  +I  +R
Sbjct: 2701 DANESKIRDLR 2711



 Score = 47.2 bits (107), Expect = 3e-04
 Identities = 23/74 (31%), Positives = 45/74 (60%)
 Frame = -3

Query: 249  KGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSS 70
            +  KL E+    Q+ R  +++E W++E + Q+ +E   ++ T++Q   +KH   EA+VS+
Sbjct: 2326 RSGKLGESKLLFQFLRDAKELESWMNE-KLQIAAEASYREATNLQQKLQKHQTFEAEVSA 2384

Query: 69   HAERIDAIREPGRA 28
            H   +DAI + G++
Sbjct: 2385 HKSELDAITQTGQS 2398



 Score = 46.4 bits (105), Expect = 5e-04
 Identities = 23/74 (31%), Positives = 39/74 (52%)
 Frame = -3

Query: 267  GAVFELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALL 88
            GA    +  +LQ   + Q++ R  + +E WL+  E  LLSED G  L +V+ L KK    
Sbjct: 3062 GASLRTRTQQLQHNKEIQRFKREADQLEAWLNAREHDLLSEDVGDSLEAVEELLKKQDEF 3121

Query: 87   EADVSSHAERIDAI 46
            E  + +  E+ +++
Sbjct: 3122 EKMLLTQGEKFNSL 3135



 Score = 45.6 bits (103), Expect = 0.001
 Identities = 24/69 (34%), Positives = 36/69 (52%)
 Frame = -3

Query: 237  LQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAER 58
            L++A    Q+   +E    W+ E   Q  S D G  L SVQ LQK+H   E ++++H  R
Sbjct: 1164 LEDAFALHQFIYDIEVEMTWVREHLQQASSGDLGTSLISVQRLQKRHLAFENELTNHQTR 1223

Query: 57   IDAIREPGR 31
            ID +   G+
Sbjct: 1224 IDTVLSSGQ 1232



 Score = 45.6 bits (103), Expect = 0.001
 Identities = 25/70 (35%), Positives = 42/70 (60%), Gaps = 1/70 (1%)
 Frame = -3

Query: 240  KLQEAAQQQQYNRAVEDIEL-WLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHA 64
            +LQ++    Q+  A   +E+ W+ + E    SEDYG++L  VQ+L KK   LE++++SH 
Sbjct: 2540 RLQDSLALHQF-LADTQVEVDWIKDKEPIAKSEDYGRNLLGVQSLMKKMEGLESEINSHE 2598

Query: 63   ERIDAIREPG 34
              + A+ E G
Sbjct: 2599 LLVQALLETG 2608



 Score = 44.4 bits (100), Expect = 0.002
 Identities = 18/42 (42%), Positives = 28/42 (66%)
 Frame = -1

Query: 488 RES*KFATDDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEI 363
           +E  + A D+S+ DP NL G +++H+ FE E+ ANK  +D I
Sbjct: 393 KEKSQIAEDESFKDPKNLQGNLKRHKAFEAEITANKDGIDRI 434



 Score = 43.2 bits (97), Expect = 0.005
 Identities = 19/76 (25%), Positives = 43/76 (56%)
 Frame = -1

Query: 470  ATDDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEE 291
            A++D   D  ++N  +++HQ+ + ++   + RV E+       +  EHF + +I+ R  +
Sbjct: 2463 ASEDYGKDMRSVNNLIKRHQSLQMDIARYEDRVSELLKQAGEFVAAEHFLKDEIADRAAD 2522

Query: 290  LGGIWERLVQSSS*RE 243
            +   +E+LV+ ++ RE
Sbjct: 2523 VAERFEQLVEPATERE 2538



 Score = 42.3 bits (95), Expect = 0.008
 Identities = 21/60 (35%), Positives = 34/60 (56%)
 Frame = -3

Query: 240  KLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAE 61
            +L E+ +  +Y R VE+I  ++SE      SEDYG D   +Q +Q +    +  V+S+AE
Sbjct: 1375 RLTESKKLHEYRREVEEISAYVSEQLQTAASEDYGTDFEHLQVIQGRFGDFQRSVASYAE 1434



 Score = 41.9 bits (94), Expect = 0.011
 Identities = 18/60 (30%), Positives = 36/60 (60%)
 Frame = -1

Query: 422  QKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEELGGIWERLVQSSS*RE 243
            ++H  FE EL  ++ R+D + + G+ L++  + A  ++  R EEL  +W+ LV  ++ R+
Sbjct: 1208 KRHLAFENELTNHQTRIDTVLSSGQDLIDSCYSATDKVEERCEELQNLWDELVDMAAQRK 1267



 Score = 41.9 bits (94), Expect = 0.011
 Identities = 19/69 (27%), Positives = 40/69 (57%)
 Frame = -3

Query: 252  LKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVS 73
            L+  +L  A +  ++NR + ++   + E +  +  ED G+DL S Q LQ+KH + E ++ 
Sbjct: 1477 LRQKRLTSAEEIHRFNRDLNELISRIQEKDAAINLEDLGRDLASTQVLQRKHEVFECELV 1536

Query: 72   SHAERIDAI 46
            +  ++I+ +
Sbjct: 1537 TLEKQIEEL 1545



 Score = 41.1 bits (92), Expect = 0.020
 Identities = 20/77 (25%), Positives = 45/77 (58%)
 Frame = -3

Query: 264  AVFELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLE 85
            A  + +  KLQ + +  Q+ + V + E W+ E + Q  +++  KD  ++++  +KH   E
Sbjct: 1792 AELDKRREKLQNSHKIMQFYQDVVESESWIME-KLQTATDESFKDPINLESKLQKHQAFE 1850

Query: 84   ADVSSHAERIDAIREPG 34
            +++++H   ID++R+ G
Sbjct: 1851 SELTAHERAIDSVRDKG 1867



 Score = 39.9 bits (89), Expect = 0.045
 Identities = 19/67 (28%), Positives = 37/67 (55%)
 Frame = -3

Query: 240  KLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAE 61
            +L ++++   + R  +++  W+ E E  + S+D G+DL  V+ L +K  +   D+ S  E
Sbjct: 2752 RLLDSSRLFNFLREADELGAWVEEKEAIVSSDDCGRDLEHVEMLMQKFEVFTRDLVSSGE 2811

Query: 60   RIDAIRE 40
            RI  + E
Sbjct: 2812 RIAKLTE 2818



 Score = 37.1 bits (82), Expect = 0.32
 Identities = 17/72 (23%), Positives = 37/72 (51%)
 Frame = -3

Query: 255 ELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADV 76
           E++   LQ+A +   +    ED++LW+S  E Q  S +    L ++Q +++K      ++
Sbjct: 550 EMRRLSLQKAIKYYHFCHECEDMDLWMSNKERQFKSIESQNTLDAIQTVRQKLERFATEI 609

Query: 75  SSHAERIDAIRE 40
           ++   R+  I +
Sbjct: 610 ATKCSRVSDINQ 621



 Score = 35.9 bits (79), Expect = 0.74
 Identities = 12/56 (21%), Positives = 34/56 (60%)
 Frame = -3

Query: 195 EDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAERIDAIREPGRA 28
           E++  W+ E +  L  E+ GKD+ +V+   ++H  +E D+++  +++  +++  ++
Sbjct: 676 EEMRSWIQEKDAALCKEELGKDIETVRAQLRRHQGIERDLAAVEDKVAKLQDQAKS 731



 Score = 34.7 bits (76), Expect = 1.7
 Identities = 17/56 (30%), Positives = 31/56 (55%)
 Frame = -3

Query: 240  KLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVS 73
            KL EA +   +NR   D+   ++E      S + G+DL +V+ L +KH  +E +++
Sbjct: 2011 KLAEACEIHAFNRNCRDVSSMINEKAAVQTSGEVGRDLPAVEALIRKHDDVERELT 2066



 Score = 34.7 bits (76), Expect = 1.7
 Identities = 15/58 (25%), Positives = 30/58 (51%)
 Frame = -1

Query: 440  NLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEELGGIWERL 267
            N+   ++ H NFE+ L   +  +  + +  K+ L+++H+    I S+  E+   WE L
Sbjct: 2262 NVESLLKSHINFEKSLSTYEENIRSLESSAKQFLQVKHYHAEAIRSKYLEILDKWEAL 2319


>UniRef50_UPI0000ECB960 Cluster: Spectrin beta chain, brain 4
            (Spectrin, non-erythroid beta chain 4) (Beta-V spectrin)
            (BSPECV).; n=3; Tetrapoda|Rep: Spectrin beta chain, brain
            4 (Spectrin, non-erythroid beta chain 4) (Beta-V
            spectrin) (BSPECV). - Gallus gallus
          Length = 3857

 Score = 76.6 bits (180), Expect = 4e-13
 Identities = 33/76 (43%), Positives = 51/76 (67%)
 Frame = -1

Query: 485  ES*KFATDDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQIS 306
            E    A DDS+ DP+NL  K+QKHQ+F+ E+ ANK R+D I + G++++   H+A   I 
Sbjct: 2799 EKNSIAQDDSWRDPSNLQTKLQKHQSFQAEIMANKNRLDSIKSEGEKMIRERHYAPEAIQ 2858

Query: 305  SRVEELGGIWERLVQS 258
            SR++E+  +WE L+ S
Sbjct: 2859 SRLQEMEELWEELLAS 2874



 Score = 54.4 bits (125), Expect = 2e-06
 Identities = 25/73 (34%), Positives = 43/73 (58%)
 Frame = -1

Query: 485  ES*KFATDDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQIS 306
            E  K A+D+SY DPTN+  K++ H+  E+E+ AN+     +   G +L++ +H+A   I 
Sbjct: 1409 EKYKIASDESYRDPTNVLRKLKWHEAAEKEMMANEKHFITLIKKGNQLIQDDHYAAASIQ 1468

Query: 305  SRVEELGGIWERL 267
             ++ EL   W+ L
Sbjct: 1469 KKMSELEKKWKEL 1481



 Score = 51.2 bits (117), Expect = 2e-05
 Identities = 25/63 (39%), Positives = 37/63 (58%)
 Frame = -3

Query: 240  KLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAE 61
            KL +A   Q++   VE  E WLS  E  L +ED G  ++SV++LQ+KH   E  + +  E
Sbjct: 2670 KLFQAQDLQKFYGYVEQTESWLSSKEAFLANEDLGDSVSSVESLQRKHMQFEKSLEAQME 2729

Query: 60   RID 52
            +ID
Sbjct: 2730 KID 2732



 Score = 50.8 bits (116), Expect = 2e-05
 Identities = 24/68 (35%), Positives = 39/68 (57%)
 Frame = -3

Query: 249  KGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSS 70
            K  KLQ+A +   + R++ED E WL +VE +L +     DL  + +  KK   LE D++S
Sbjct: 2878 KRAKLQDAYKALHFQRSIEDTEKWLEDVENELKAPYSSDDLVVLNSHLKKQEELEQDIAS 2937

Query: 69   HAERIDAI 46
            H +R+  +
Sbjct: 2938 HRDRLQEL 2945



 Score = 50.0 bits (114), Expect = 4e-05
 Identities = 22/68 (32%), Positives = 42/68 (61%)
 Frame = -3

Query: 243 NKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHA 64
           N+LQ AA  +QY   +++   WL E +  + S+DYGKD +S + L  +H  LE ++++++
Sbjct: 706 NRLQAAALIKQYFADIDEANSWLQERQTLVASKDYGKDESSAEALLHRHLRLEKEIAAYS 765

Query: 63  ERIDAIRE 40
             +  ++E
Sbjct: 766 TEMRRLKE 773



 Score = 47.2 bits (107), Expect = 3e-04
 Identities = 29/78 (37%), Positives = 39/78 (50%), Gaps = 1/78 (1%)
 Frame = -1

Query: 473  FATDDSYLDPTNLNGKVQK-HQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRV 297
            F   D   D  +    +QK HQ FEQ L   K R++     G  L+E  HFA   I  R+
Sbjct: 1307 FLRGDDLGDHVDAVRSLQKQHQEFEQLLMVLKRRIEAFNENGADLIESGHFASHAIKERM 1366

Query: 296  EELGGIWERLVQSSS*RE 243
              L   WERLV+++S R+
Sbjct: 1367 ATLRQRWERLVENNSKRK 1384



 Score = 46.8 bits (106), Expect = 4e-04
 Identities = 21/72 (29%), Positives = 40/72 (55%)
 Frame = -3

Query: 255  ELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADV 76
            E +  +LQ +   Q++     D+E W++E    ++S+DYGKD      L +KH +LE ++
Sbjct: 1697 EERTKQLQHSVGFQEFLMNTSDLEAWIAEKRPLVMSKDYGKDEDGTLKLLQKHKVLEHEI 1756

Query: 75   SSHAERIDAIRE 40
            + + + I  + E
Sbjct: 1757 AVYQDLIKELNE 1768



 Score = 46.0 bits (104), Expect = 7e-04
 Identities = 22/68 (32%), Positives = 42/68 (61%)
 Frame = -3

Query: 249  KGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSS 70
            +G+KL++A QQ+Q    ++D +  + ++E  L   + G DL S ++L K+H  LE +   
Sbjct: 1488 RGDKLRQAGQQEQLMELLQDAKKKIEKIEKVLQEAETGHDLRSSRDLLKQHRQLENETHE 1547

Query: 69   HAERIDAI 46
             AE++++I
Sbjct: 1548 LAEKMNSI 1555



 Score = 45.2 bits (102), Expect = 0.001
 Identities = 25/75 (33%), Positives = 42/75 (56%)
 Frame = -3

Query: 255  ELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADV 76
            E +G+ L+ +  Q ++ R V++   W+ E      S DYG+ L +VQ+LQ+KH  LE ++
Sbjct: 2983 ERRGS-LEASRLQYEFFRDVDEELAWVHEKLPMASSRDYGQSLATVQSLQEKHQNLENEI 3041

Query: 75   SSHAERIDAIREPGR 31
            SS      A+   G+
Sbjct: 3042 SSRDALTKAVLSTGQ 3056



 Score = 44.4 bits (100), Expect = 0.002
 Identities = 25/76 (32%), Positives = 41/76 (53%)
 Frame = -3

Query: 261  VFELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEA 82
            ++E +  KLQ+  + Q++NR  + I   LS  E  L  +D G  + +V++LQK+H   E 
Sbjct: 1273 MWEQRWKKLQDGLELQKFNREGDRINAALSSHEAFLRGDDLGDHVDAVRSLQKQHQEFEQ 1332

Query: 81   DVSSHAERIDAIREPG 34
             +     RI+A  E G
Sbjct: 1333 LLMVLKRRIEAFNENG 1348



 Score = 44.0 bits (99), Expect = 0.003
 Identities = 24/84 (28%), Positives = 43/84 (51%)
 Frame = -3

Query: 252  LKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVS 73
            ++  +L ++ +  Q+   + D+E WL+E    L + DYGK+  S Q L +K    + D+ 
Sbjct: 3089 VRRQRLMQSYEAHQFLTELLDVETWLAERSFILETSDYGKNEESTQALLRKLEATKLDME 3148

Query: 72   SHAERIDAIREPGRASS*KREPLS 1
                RI+ ++E G +   K  P S
Sbjct: 3149 GFRPRIEKVQETGASLINKDNPES 3172



 Score = 43.6 bits (98), Expect = 0.004
 Identities = 21/71 (29%), Positives = 39/71 (54%)
 Frame = -3

Query: 255  ELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADV 76
            + +   L+ A Q  QY+  V++++ W+ E E  +  +DYG DL  VQ L  +   +E D+
Sbjct: 3301 QTRTENLRAAQQVHQYDHDVDEVKGWMQEKEAVVDIDDYGYDLPGVQTLLSQLEGVERDL 3360

Query: 75   SSHAERIDAIR 43
             +  + ++ IR
Sbjct: 3361 GAIMKELERIR 3371



 Score = 43.2 bits (97), Expect = 0.005
 Identities = 20/52 (38%), Positives = 31/52 (59%)
 Frame = -3

Query: 255  ELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKK 100
            E +  +LQE  Q  Q+ R  + ++ WLS  +    S+DYG+DL  V+ L+KK
Sbjct: 3194 ETQRKRLQEQFQLYQFEREFQLVDAWLSSKQSIAESDDYGQDLDGVEVLEKK 3245



 Score = 40.3 bits (90), Expect = 0.034
 Identities = 18/66 (27%), Positives = 36/66 (54%), Gaps = 3/66 (4%)
 Frame = -1

Query: 446  PTNLN---GKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEELGGIW 276
            P +LN     +++HQ  ++E++A   R + ++  G++L    H+A P+I   +  L   W
Sbjct: 2598 PKSLNEAESMIEEHQQRKEEIEARVERFNSLSNYGQQLANSGHYATPEIHQSLSRLQKAW 2657

Query: 275  ERLVQS 258
              L+Q+
Sbjct: 2658 TELIQA 2663



 Score = 39.1 bits (87), Expect = 0.079
 Identities = 24/79 (30%), Positives = 40/79 (50%), Gaps = 1/79 (1%)
 Frame = -3

Query: 240  KLQEAAQQQQYNRAVEDIEL-WLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHA 64
            KL EAA          D+EL W++E      S + GK L   Q+L +KH   +A+V++H 
Sbjct: 1595 KLLEAAVDLYEFYHYHDMELNWINERLPIASSTNCGKSLDVAQSLLQKHKEFQAEVNAHK 1654

Query: 63   ERIDAIREPGRASS*KREP 7
            +++  + + GR     + P
Sbjct: 1655 QQVQRVLDKGRTMIVNQHP 1673



 Score = 39.1 bits (87), Expect = 0.079
 Identities = 19/65 (29%), Positives = 38/65 (58%)
 Frame = -3

Query: 240  KLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAE 61
            KL+ A +     R ++DI   ++E    + + DYGKD+ SV+NL ++H  +E +++    
Sbjct: 2458 KLEGALEIHALIREIDDITERITEKSVLIQALDYGKDVESVENLIRRHEEMEREINVIKS 2517

Query: 60   RIDAI 46
            +I+ +
Sbjct: 2518 KIEPL 2522



 Score = 38.3 bits (85), Expect = 0.14
 Identities = 15/59 (25%), Positives = 38/59 (64%)
 Frame = -1

Query: 422  QKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEELGGIWERLVQSSS*R 246
            +KH  FE+ L+A   ++DE+ +  ++L++ +H+    I++R + +    E+L+++++ R
Sbjct: 2715 RKHMQFEKSLEAQMEKIDEMASFAQQLIQNKHYDSDNITNRCQAVLRRKEKLLENAAAR 2773



 Score = 36.3 bits (80), Expect = 0.56
 Identities = 18/59 (30%), Positives = 34/59 (57%)
 Frame = -3

Query: 243 NKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSH 67
           ++L+EA +  ++ R  ++ E W+SE      +   GKD++ +    +KH  LEA+ +SH
Sbjct: 600 SQLEEALKLFEFFRDCKEEEAWISEKWKIARTTTLGKDVSQITASIQKHKALEAECNSH 658



 Score = 35.5 bits (78), Expect = 0.97
 Identities = 15/68 (22%), Positives = 39/68 (57%)
 Frame = -3

Query: 237  LQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAER 58
            L+E+   Q+  +   ++  W++E +  +  +D  +D +++Q   +KH   +A++ ++  R
Sbjct: 2777 LEESRLLQKLLKNSYEVATWINE-KNSIAQDDSWRDPSNLQTKLQKHQSFQAEIMANKNR 2835

Query: 57   IDAIREPG 34
            +D+I+  G
Sbjct: 2836 LDSIKSEG 2843



 Score = 35.1 bits (77), Expect = 1.3
 Identities = 17/55 (30%), Positives = 33/55 (60%)
 Frame = -3

Query: 204 RAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAERIDAIRE 40
           R ++ I   L E++  + S+D GK L  V +L +KH L++  +SS+ +++  I +
Sbjct: 507 RDIDAIMEELKELQALVNSQDCGKQLLEVVDLLQKHNLIDLQISSYDDKLTHITQ 561



 Score = 35.1 bits (77), Expect = 1.3
 Identities = 17/66 (25%), Positives = 34/66 (51%), Gaps = 1/66 (1%)
 Frame = -3

Query: 249  KGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSV-QNLQKKHALLEADVS 73
            +G KL E     ++ R  ED++ W+++ +    SEDYG +   V + L+ K+      + 
Sbjct: 1806 RGKKLDETLVLHEFLREYEDLQDWMAQQKQAASSEDYGNNYEHVLKQLRAKYDTFRHQLE 1865

Query: 72   SHAERI 55
            +  +R+
Sbjct: 1866 ATGKRV 1871



 Score = 34.7 bits (76), Expect = 1.7
 Identities = 12/50 (24%), Positives = 29/50 (58%)
 Frame = -1

Query: 437  LNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEEL 288
            LN  ++K +  EQ++ +++ R+ E+    +   + +HF   ++  RV++L
Sbjct: 2921 LNSHLKKQEELEQDIASHRDRLQELVNTAQEFQQEKHFLADELEERVDQL 2970



 Score = 34.3 bits (75), Expect = 2.3
 Identities = 19/73 (26%), Positives = 36/73 (49%)
 Frame = -3

Query: 258  FELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEAD 79
            ++ K   L    Q+Q + +    ++  L+  E  L S D G  +  V+ L +KH   E  
Sbjct: 2122 WQQKKKWLDRIHQEQMFYKDWNHLDKLLNSQEVYLKSSDLGSSVDEVEQLIRKHEAFEKL 2181

Query: 78   VSSHAERIDAIRE 40
            ++S  E+I +++E
Sbjct: 2182 LASQDEKITSLQE 2194



 Score = 34.3 bits (75), Expect = 2.3
 Identities = 18/59 (30%), Positives = 29/59 (49%)
 Frame = -3

Query: 234  QEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAER 58
            +E  + Q   R +E  E WL+  E  L    YG  ++ V+ L KKH   E  +++  E+
Sbjct: 3520 EENWEIQLLRRELEQAEAWLAAKESFLSDPSYGDSVSEVEELLKKHHDFENMLAAQEEK 3578


>UniRef50_UPI000069E88E Cluster: Spectrin beta chain, brain 4
            (Spectrin, non-erythroid beta chain 4) (Beta-V spectrin)
            (BSPECV).; n=3; Xenopus tropicalis|Rep: Spectrin beta
            chain, brain 4 (Spectrin, non-erythroid beta chain 4)
            (Beta-V spectrin) (BSPECV). - Xenopus tropicalis
          Length = 1865

 Score = 73.7 bits (173), Expect = 3e-12
 Identities = 30/70 (42%), Positives = 52/70 (74%)
 Frame = -1

Query: 470  ATDDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEE 291
            A D+S+ DP+NL  K+QKHQ FE E++AN+ R+D+I + G+++L+  H+A   I +R++E
Sbjct: 1081 ALDNSWRDPSNLQAKLQKHQTFEAEIKANRNRLDDIKSDGEKMLKDHHYASDIIHTRLQE 1140

Query: 290  LGGIWERLVQ 261
            +  +WE L++
Sbjct: 1141 MEELWEELLE 1150



 Score = 54.0 bits (124), Expect = 3e-06
 Identities = 27/73 (36%), Positives = 44/73 (60%)
 Frame = -3

Query: 249  KGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSS 70
            K   LQEA +  Q+ R++ED E WL +VE +L + + GKDL +++ L +    +E D++S
Sbjct: 1155 KAANLQEAYKALQFQRSLEDSEKWLDQVEAKLEAANKGKDLMTLEKLGE----MEEDITS 1210

Query: 69   HAERIDAIREPGR 31
            H ER+  +    R
Sbjct: 1211 HGERLQVLVNKAR 1223



 Score = 44.4 bits (100), Expect = 0.002
 Identities = 22/78 (28%), Positives = 41/78 (52%)
 Frame = -3

Query: 237  LQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAER 58
            L  A Q  +++  V+++  W+ E    + S+DYG DL  VQ L  +H + E D+++  + 
Sbjct: 1583 LATAHQVHEFDHEVDELMSWIQEKGVAVNSDDYGYDLPGVQALLSQHEVFEGDLAAIKKE 1642

Query: 57   IDAIREPGRASS*KREPL 4
            ++ I   G+  S    P+
Sbjct: 1643 VERIMNRGQFISQLHPPV 1660



 Score = 43.2 bits (97), Expect = 0.005
 Identities = 20/59 (33%), Positives = 37/59 (62%)
 Frame = -3

Query: 240 KLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHA 64
           +L+ AA  +QY    ++ + WL E    L +EDYGKD +S + + ++H  LE +++++A
Sbjct: 521 RLEVAALIKQYFADADEADSWLRERLPLLSNEDYGKDESSAEAMLQRHLRLEKEIAAYA 579



 Score = 42.3 bits (95), Expect = 0.008
 Identities = 23/77 (29%), Positives = 39/77 (50%)
 Frame = -1

Query: 443  TNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEELGGIWERLV 264
            T     ++KHQN E E+ + +     +   G++L++  HFA  +I  R+++L    E L 
Sbjct: 1300 TTAQALLEKHQNLENEISSREALTKAVMGTGRKLVKGNHFASHEIEDRLQQLEVAAETLK 1359

Query: 263  QSSS*RETSCRKRLNNS 213
              +  R    RKRLN +
Sbjct: 1360 AEADRR----RKRLNQA 1372



 Score = 40.7 bits (91), Expect = 0.026
 Identities = 25/86 (29%), Positives = 41/86 (47%)
 Frame = -3

Query: 258  FELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEAD 79
            +E K   L++  Q+Q + R V+ +E  L+  E  L S D G     ++ L KKH   E  
Sbjct: 940  WEQKRKLLEQVHQEQVFYRDVDHLEKILNSQEVSLKSSDLGTSSGEIEQLIKKHEAFEKL 999

Query: 78   VSSHAERIDAIREPGRASS*KREPLS 1
             +S  E++ A  + G +   +  P S
Sbjct: 1000 FASQEEKVFAYVQKGNSLLSQHHPKS 1025



 Score = 40.7 bits (91), Expect = 0.026
 Identities = 16/72 (22%), Positives = 40/72 (55%)
 Frame = -3

Query: 249  KGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSS 70
            +G  L++     ++ + V+ +E W+ E +  +  ++  +D +++Q   +KH   EA++ +
Sbjct: 1049 RGKMLEDNRDFLEFLQKVDQVEAWIREKKNTIALDNSWRDPSNLQAKLQKHQTFEAEIKA 1108

Query: 69   HAERIDAIREPG 34
            +  R+D I+  G
Sbjct: 1109 NRNRLDDIKSDG 1120



 Score = 39.5 bits (88), Expect = 0.060
 Identities = 23/76 (30%), Positives = 41/76 (53%), Gaps = 2/76 (2%)
 Frame = -3

Query: 276 GATGAVFELKGNK--LQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQK 103
           G  G +  L+  K  L+E        R ++ +   L  ++  L S+D+GK L  V++L +
Sbjct: 295 GWNGLIELLRKQKVLLEEKRHVLTLLRDIDSVVEELKSMQELLGSKDFGKQLPEVEDLLQ 354

Query: 102 KHALLEADVSSHAERI 55
           KH+L E+ + S+ ER+
Sbjct: 355 KHSLYESQIVSYGERV 370



 Score = 39.5 bits (88), Expect = 0.060
 Identities = 16/71 (22%), Positives = 37/71 (52%)
 Frame = -3

Query: 240  KLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAE 61
            KL +A Q Q Y     ++ +W  E++  ++SE+   D++  + + K+H   + ++  H  
Sbjct: 1688 KLSQAEQAQMYFDDCGELMVWAKEMQALVVSEELANDVSGAELMIKRHIEYKREIDKHWI 1747

Query: 60   RIDAIREPGRA 28
            + + ++  G A
Sbjct: 1748 KYEELQRTGEA 1758



 Score = 38.3 bits (85), Expect = 0.14
 Identities = 21/61 (34%), Positives = 32/61 (52%)
 Frame = -3

Query: 213  QYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAERIDAIREPG 34
            Q+ R V+D   W+ E      S++ G+ LT+ Q L +KH  LE ++SS      A+   G
Sbjct: 1271 QFFRDVDDELAWIKEKMPLASSKECGQSLTTAQALLEKHQNLENEISSREALTKAVMGTG 1330

Query: 33   R 31
            R
Sbjct: 1331 R 1331



 Score = 38.3 bits (85), Expect = 0.14
 Identities = 21/70 (30%), Positives = 36/70 (51%)
 Frame = -3

Query: 240  KLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAE 61
            +L +A + QQ+   + + E WL+E    + S D GK+  S Q L +K      D+   A 
Sbjct: 1368 RLNQACEAQQFLTELLEAEAWLAERGFVIKSTDNGKNEESTQALLRKLDTTRRDLDGFAH 1427

Query: 60   RIDAIREPGR 31
            RI+ + + G+
Sbjct: 1428 RINKLIDTGK 1437



 Score = 35.9 bits (79), Expect = 0.74
 Identities = 17/61 (27%), Positives = 32/61 (52%)
 Frame = -1

Query: 449 DPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEELGGIWER 270
           +P NL    QK++N   +L A K R DEI  + + L+++    + +I +  +++   W  
Sbjct: 665 NPENLEVMQQKYENLLTDLAAGKARHDEINDLAEDLIKIAPNRKKEIQAHQKDIDNSWNH 724

Query: 269 L 267
           L
Sbjct: 725 L 725



 Score = 34.7 bits (76), Expect = 1.7
 Identities = 18/64 (28%), Positives = 33/64 (51%)
 Frame = -3

Query: 234  QEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAERI 55
            +E  + Q   R +E  + WL+  E  LL ++YG  ++ V+ L KK    E  +++  E+ 
Sbjct: 1796 EENLEIQIMRRELEQADGWLNTREPYLLDQNYGDSISIVEQLLKKQEDFEKMLAAQEEKF 1855

Query: 54   DAIR 43
              +R
Sbjct: 1856 ALLR 1859



 Score = 33.1 bits (72), Expect = 5.2
 Identities = 16/52 (30%), Positives = 30/52 (57%)
 Frame = -3

Query: 255  ELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKK 100
            E + ++L E  Q  Q+ +  + +E WL+  +    S+D G+DL  V+ L+K+
Sbjct: 1470 EDRRSQLIEQHQLFQFKKEADLVETWLASKKATAKSDDLGQDLEGVKVLEKE 1521


>UniRef50_P02549 Cluster: Spectrin alpha chain, erythrocyte; n=32;
           Euteleostomi|Rep: Spectrin alpha chain, erythrocyte -
           Homo sapiens (Human)
          Length = 2418

 Score = 73.3 bits (172), Expect = 4e-12
 Identities = 32/70 (45%), Positives = 47/70 (67%)
 Frame = -3

Query: 249 KGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSS 70
           KG +L EA QQ Q+    ED++ WL +VE Q+ SEDYGK L  VQN  +KH LLE+ V++
Sbjct: 679 KGTQLHEANQQLQFENNAEDLQRWLEDVEWQVTSEDYGKGLAEVQNRLRKHGLLESAVAA 738

Query: 69  HAERIDAIRE 40
             +++D + +
Sbjct: 739 RQDQVDILTD 748



 Score = 66.9 bits (156), Expect = 3e-10
 Identities = 28/79 (35%), Positives = 49/79 (62%)
 Frame = -1

Query: 476 KFATDDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRV 297
           K A D+ Y D  NL  +VQK Q FE+EL  NK +++ I   G+ ++E  H+A   +++R+
Sbjct: 603 KLADDEDYKDIQNLKSRVQKQQVFEKELAVNKTQLENIQKTGQEMIEGGHYASDNVTTRL 662

Query: 296 EELGGIWERLVQSSS*RET 240
            E+  +WE L++++  + T
Sbjct: 663 SEVASLWEELLEATKQKGT 681



 Score = 66.1 bits (154), Expect = 6e-10
 Identities = 32/70 (45%), Positives = 46/70 (65%)
 Frame = -3

Query: 249  KGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSS 70
            KG KL EA++QQ++N ++ D E WLSE E  L  +D  +DL S  NL KKH LLE ++ +
Sbjct: 1598 KGKKLNEASRQQRFNTSIRDFEFWLSEAETLLAMKDQARDLASAGNLLKKHQLLEREMLA 1657

Query: 69   HAERIDAIRE 40
               R DA+++
Sbjct: 1658 ---REDALKD 1664



 Score = 58.8 bits (136), Expect = 9e-08
 Identities = 29/81 (35%), Positives = 43/81 (53%), Gaps = 2/81 (2%)
 Frame = -1

Query: 497 LGK--RES*KFATDDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHF 324
           LGK   E     TD SY DPTN+ GK QKHQ+ E E+Q     + E+    +    + H 
Sbjct: 65  LGKWIMEKVNILTDKSYEDPTNIQGKYQKHQSLEAEVQTKSRLMSELEKTREERFTMGHS 124

Query: 323 AQPQISSRVEELGGIWERLVQ 261
           A  +  + +EEL  +W+ L++
Sbjct: 125 AHEETKAHIEELRHLWDLLLE 145



 Score = 53.2 bits (122), Expect = 5e-06
 Identities = 26/65 (40%), Positives = 40/65 (61%)
 Frame = -3

Query: 240  KLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAE 61
            KL+EA    Q+ + ++D E W+ E   ++ S+DYG+DL  VQNL KKH  LE ++ +H  
Sbjct: 1707 KLKEAYALFQFFQDLDDEESWIEEKLIRVSSQDYGRDLQGVQNLLKKHKRLEGELVAHEP 1766

Query: 60   RIDAI 46
             I  +
Sbjct: 1767 AIQNV 1771



 Score = 45.6 bits (103), Expect = 0.001
 Identities = 22/61 (36%), Positives = 35/61 (57%)
 Frame = -3

Query: 237 LQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAER 58
           L  AA  Q++ R V +   W+ E E  L SEDYGKDL + + L   H  LE +++  +++
Sbjct: 260 LSNAANLQRFKRDVTEAIQWIKEKEPVLTSEDYGKDLVASEGLFHSHKGLERNLAVMSDK 319

Query: 57  I 55
           +
Sbjct: 320 V 320



 Score = 45.6 bits (103), Expect = 0.001
 Identities = 22/72 (30%), Positives = 37/72 (51%)
 Frame = -3

Query: 249  KGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSS 70
            +G KL+E+ +  Q+ +  E+ E W++E     +  D G  L + Q+L  KH  LE D + 
Sbjct: 1810 RGLKLEESLEYLQFMQNAEEEEAWINEKNALAVRGDCGDTLAATQSLLMKHEALENDFAV 1869

Query: 69   HAERIDAIREPG 34
            H  R+  +   G
Sbjct: 1870 HETRVQNVCAQG 1881



 Score = 45.2 bits (102), Expect = 0.001
 Identities = 24/69 (34%), Positives = 34/69 (49%)
 Frame = -3

Query: 240 KLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAE 61
           KL +    Q   R  ED E W+ E E    S   GKDL + + L  +H ++  +++SH  
Sbjct: 788 KLLDLLHLQLICRDTEDEEAWIQETEPSATSTYLGKDLIASKKLLNRHRVILENIASHEP 847

Query: 60  RIDAIREPG 34
           RI  I E G
Sbjct: 848 RIQEITERG 856



 Score = 43.6 bits (98), Expect = 0.004
 Identities = 27/99 (27%), Positives = 48/99 (48%), Gaps = 1/99 (1%)
 Frame = -3

Query: 321  STSNIVSRGRA-GRNMGATGAVFELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSE 145
            +  ++ SR ++  +NM +  A    + N L+   Q QQY   + + E W+ E E  + + 
Sbjct: 866  AAEDVASRVKSLNQNMESLRARAARRQNDLEANVQFQQYLADLHEAETWIREKEPIVDNT 925

Query: 144  DYGKDLTSVQNLQKKHALLEADVSSHAERIDAIREPGRA 28
            +YG D  +   L KKH     D++S  + + A+R    A
Sbjct: 926  NYGADEEAAGALLKKHEAFLLDLNSFGDSMKALRNQANA 964



 Score = 43.6 bits (98), Expect = 0.004
 Identities = 26/88 (29%), Positives = 43/88 (48%), Gaps = 1/88 (1%)
 Frame = -1

Query: 470  ATDDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQ-ISSRVE 294
            A D+SY D TN+  K  KHQ F  E+     +V  +  +G  L+E       + +  ++E
Sbjct: 1523 ACDESYKDATNIQRKYLKHQTFAHEVDGRSEQVHGVINLGNSLIERSCDGNEEAMKEQLE 1582

Query: 293  ELGGIWERLVQSSS*RETSCRKRLNNSS 210
            +L   W+ L++    R     K+LN +S
Sbjct: 1583 QLKEHWDHLLE----RTNDKGKKLNEAS 1606



 Score = 41.5 bits (93), Expect = 0.015
 Identities = 21/71 (29%), Positives = 37/71 (52%)
 Frame = -3

Query: 240  KLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAE 61
            KL + A  +Q+ R +E++E W+SE+      E Y KD T++Q    KH     +V   +E
Sbjct: 1495 KLGDYANLKQFYRDLEELEEWISEMLPTACDESY-KDATNIQRKYLKHQTFAHEVDGRSE 1553

Query: 60   RIDAIREPGRA 28
            ++  +   G +
Sbjct: 1554 QVHGVINLGNS 1564



 Score = 40.3 bits (90), Expect = 0.034
 Identities = 19/70 (27%), Positives = 38/70 (54%)
 Frame = -3

Query: 249 KGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSS 70
           +G KL+++   Q + R  +D+  W+ E    L  + Y +D T++Q   +KH  LEA+V +
Sbjct: 45  RGQKLEDSYHLQVFKRDADDLGKWIMEKVNILTDKSY-EDPTNIQGKYQKHQSLEAEVQT 103

Query: 69  HAERIDAIRE 40
            +  +  + +
Sbjct: 104 KSRLMSELEK 113



 Score = 39.5 bits (88), Expect = 0.060
 Identities = 17/53 (32%), Positives = 32/53 (60%)
 Frame = -1

Query: 425 VQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEELGGIWERL 267
           + +H+   + + +++PR+ EIT  G +++E  HFA   ++SRV+ L    E L
Sbjct: 832 LNRHRVILENIASHEPRIQEITERGNKMVEEGHFAAEDVASRVKSLNQNMESL 884



 Score = 39.5 bits (88), Expect = 0.060
 Identities = 17/66 (25%), Positives = 35/66 (53%)
 Frame = -3

Query: 237  LQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAER 58
            L EA +   +     D++ W+S + G + S++  +DLT ++ L ++H    AD+ + A  
Sbjct: 1285 LNEAQKFYLFLSKARDLQNWISSIGGMVSSQELAEDLTGIEILLERHQEHRADMEAEAPT 1344

Query: 57   IDAIRE 40
              A+ +
Sbjct: 1345 FQALED 1350



 Score = 34.3 bits (75), Expect = 2.3
 Identities = 17/52 (32%), Positives = 27/52 (51%)
 Frame = -3

Query: 210 YNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAERI 55
           + R  E ++ W+S  E  L +ED G  L S + L +KH   E   ++  E+I
Sbjct: 481 FYRDSEQVDSWMSRQEAFLENEDLGNSLGSAEALLQKHEDFEEAFTAQEEKI 532



 Score = 33.5 bits (73), Expect = 3.9
 Identities = 18/70 (25%), Positives = 34/70 (48%)
 Frame = -3

Query: 249 KGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSS 70
           KG++L  A + QQY +   DI  W+ + E    S + G+D    + L KK    + ++ +
Sbjct: 150 KGDQLLRALKFQQYVQECADILEWIGDKEAIATSVELGEDWERTEVLHKKFEDFQVELVA 209

Query: 69  HAERIDAIRE 40
              R+  + +
Sbjct: 210 KEGRVVEVNQ 219


>UniRef50_UPI0000D99C5B Cluster: PREDICTED: spectrin, alpha,
           erythrocytic 1 (elliptocytosis 2) isoform 1; n=3;
           Eutheria|Rep: PREDICTED: spectrin, alpha, erythrocytic 1
           (elliptocytosis 2) isoform 1 - Macaca mulatta
          Length = 2440

 Score = 72.1 bits (169), Expect = 9e-12
 Identities = 32/70 (45%), Positives = 47/70 (67%)
 Frame = -3

Query: 249 KGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSS 70
           KG +L EA Q+ Q+    ED++ WL EVE Q+ SEDYGK L  VQN  +KH LLE+ V++
Sbjct: 679 KGTQLDEANQRLQFENNAEDLQRWLEEVEWQVASEDYGKGLADVQNRLRKHGLLESAVAA 738

Query: 69  HAERIDAIRE 40
             ++++ + E
Sbjct: 739 RQDQVNILTE 748



 Score = 67.3 bits (157), Expect = 3e-10
 Identities = 32/70 (45%), Positives = 47/70 (67%)
 Frame = -3

Query: 249  KGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSS 70
            KG KL EA++QQ++N +++D E WLSE E  L  +D  +DL S  NL KKH LLE ++ +
Sbjct: 1622 KGQKLNEASRQQRFNTSIQDFEFWLSEAETLLAMKDQARDLASAGNLLKKHQLLETEMLA 1681

Query: 69   HAERIDAIRE 40
               R DA+++
Sbjct: 1682 ---REDALKD 1688



 Score = 60.9 bits (141), Expect = 2e-08
 Identities = 25/79 (31%), Positives = 48/79 (60%)
 Frame = -1

Query: 476 KFATDDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRV 297
           K A D+ Y D  NL  +VQK Q FE+EL  N+  ++ I   G+ +++  H+A   +++R+
Sbjct: 603 KLADDEDYKDTQNLKSRVQKQQVFEKELADNEIVLENIQKTGQEMIDSGHYASDNVTTRL 662

Query: 296 EELGGIWERLVQSSS*RET 240
            E+  +W+ L++++  + T
Sbjct: 663 SEVASLWKELLEATKQKGT 681



 Score = 59.7 bits (138), Expect = 5e-08
 Identities = 29/81 (35%), Positives = 44/81 (54%), Gaps = 2/81 (2%)
 Frame = -1

Query: 497 LGK--RES*KFATDDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHF 324
           LGK   E      D+SY DPTN+ GK QKHQ+FE E+Q     + E+    +    + H 
Sbjct: 65  LGKWIMEKVNILNDESYGDPTNIQGKYQKHQSFEAEVQTKSRVMSELEKTREERFTMGHS 124

Query: 323 AQPQISSRVEELGGIWERLVQ 261
           A  +  + +EEL  +W+ L++
Sbjct: 125 AHEETKAHIEELRRLWDLLLE 145



 Score = 53.2 bits (122), Expect = 5e-06
 Identities = 26/65 (40%), Positives = 40/65 (61%)
 Frame = -3

Query: 240  KLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAE 61
            KL+EA    Q+ + ++D E W+ E   ++ S+DYG+DL  VQNL KKH  LE ++ +H  
Sbjct: 1731 KLKEAYALFQFFQDLDDEESWIEEKLLRVSSQDYGRDLQGVQNLLKKHRRLEGELVAHEP 1790

Query: 60   RIDAI 46
             I  +
Sbjct: 1791 AIQNV 1795



 Score = 46.0 bits (104), Expect = 7e-04
 Identities = 22/61 (36%), Positives = 35/61 (57%)
 Frame = -3

Query: 237 LQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAER 58
           L  AA  Q++ R + D   W+ E E  L SEDYGKDL + + L   H  LE +++  +++
Sbjct: 260 LSSAADLQRFKRDMTDAIQWIKEKEPVLTSEDYGKDLVASEGLFHSHKGLERNLAVMSDK 319

Query: 57  I 55
           +
Sbjct: 320 V 320



 Score = 45.6 bits (103), Expect = 0.001
 Identities = 24/69 (34%), Positives = 34/69 (49%)
 Frame = -3

Query: 240 KLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAE 61
           KL +    Q   R  ED E W+ E E    S   GKDL + + L  +H ++  +++SH  
Sbjct: 788 KLLDLLHLQLICRDTEDEEAWIQETEPSATSTYLGKDLIASKKLLNRHKVILENIASHEP 847

Query: 60  RIDAIREPG 34
           RI  I E G
Sbjct: 848 RIQVITERG 856



 Score = 44.8 bits (101), Expect = 0.002
 Identities = 21/72 (29%), Positives = 37/72 (51%)
 Frame = -3

Query: 249  KGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSS 70
            +G +L+E+ +  Q+ +  E+ E W++E     +  D G  L + Q+L  KH  LE D + 
Sbjct: 1834 RGLQLEESLEYLQFMQNAEEEEAWINEKNAMAVRGDSGDTLAATQSLLMKHEALENDFAV 1893

Query: 69   HAERIDAIREPG 34
            H  R+  +   G
Sbjct: 1894 HETRVQNVCAQG 1905



 Score = 41.9 bits (94), Expect = 0.011
 Identities = 26/99 (26%), Positives = 48/99 (48%), Gaps = 1/99 (1%)
 Frame = -3

Query: 321  STSNIVSRGRA-GRNMGATGAVFELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSE 145
            +  ++ SR ++  +NM +  A    + N L+   Q QQY   + + E W+ E E  + + 
Sbjct: 866  AAEDVASRVKSLNQNMESLRARAARRQNDLEANVQFQQYLADLHEAETWIREKEPIVDNT 925

Query: 144  DYGKDLTSVQNLQKKHALLEADVSSHAERIDAIREPGRA 28
            +YG D  +   L KKH     D++S  + + A++    A
Sbjct: 926  NYGADEEAAGALLKKHEAFLLDLNSFGDSMKALQNQAEA 964



 Score = 41.1 bits (92), Expect = 0.020
 Identities = 20/60 (33%), Positives = 33/60 (55%)
 Frame = -3

Query: 249 KGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSS 70
           +G KL+++   Q + R  +D+  W+ E    L  E YG D T++Q   +KH   EA+V +
Sbjct: 45  RGQKLEDSYHLQVFKRDADDLGKWIMEKVNILNDESYG-DPTNIQGKYQKHQSFEAEVQT 103



 Score = 40.7 bits (91), Expect = 0.026
 Identities = 25/76 (32%), Positives = 44/76 (57%), Gaps = 5/76 (6%)
 Frame = -3

Query: 240  KLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQ--NLQK---KHALLEADV 76
            KL + A  +Q+ R +E++E W+SE+      E Y KD T++Q  ++Q+   KH     +V
Sbjct: 1513 KLGDQADLKQFYRDLEELEEWISEMLPTACDESY-KDPTNIQASSIQRKYLKHQAFANEV 1571

Query: 75   SSHAERIDAIREPGRA 28
               A+++DA  + GR+
Sbjct: 1572 YGRADQVDATIDLGRS 1587



 Score = 40.3 bits (90), Expect = 0.034
 Identities = 18/68 (26%), Positives = 36/68 (52%)
 Frame = -3

Query: 237  LQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAER 58
            L EA +   +     D++ W+S + G + S++  +DLT ++ L ++H    AD+ + A  
Sbjct: 1303 LNEAQKFYLFLSKARDLQNWISSIGGMVSSQELAEDLTGIEILLERHQEHRADMEAEAPT 1362

Query: 57   IDAIREPG 34
              A+ + G
Sbjct: 1363 FQALEDFG 1370



 Score = 39.9 bits (89), Expect = 0.045
 Identities = 18/52 (34%), Positives = 29/52 (55%)
 Frame = -1

Query: 422 QKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEELGGIWERL 267
           +K ++F+ +L A + RVD++        E +H   P I S+ EE+   WERL
Sbjct: 198 KKFEDFQVDLVAKEGRVDDVNQYANECAEEKHPELPLIQSKQEEVNAAWERL 249



 Score = 39.1 bits (87), Expect = 0.079
 Identities = 28/98 (28%), Positives = 48/98 (48%), Gaps = 12/98 (12%)
 Frame = -1

Query: 470  ATDDSYLDPTNLNG-----KVQKHQNFEQELQANKPRVDEITAVGKRLLELE--HFAQPQ 312
            A D+SY DPTN+       K  KHQ F  E+     +VD    +G+ L+E       +  
Sbjct: 1541 ACDESYKDPTNIQASSIQRKYLKHQAFANEVYGRADQVDATIDLGRSLIERSTCDCDEEA 1600

Query: 311  ISSRVEELGGIWERLVQSSS*R-----ETSCRKRLNNS 213
            +  ++E+L   W+ L++ ++ +     E S ++R N S
Sbjct: 1601 MKEQLEQLKEHWDYLLEKTTDKGQKLNEASRQQRFNTS 1638



 Score = 38.7 bits (86), Expect = 0.10
 Identities = 22/81 (27%), Positives = 38/81 (46%)
 Frame = -3

Query: 249 KGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSS 70
           KG  L  A + QQY +   DI  W+ + E    S + G+D    + LQKK    + D+ +
Sbjct: 150 KGALLLRALKFQQYVQECADILEWIGDKEAIATSVELGEDWERTEVLQKKFEDFQVDLVA 209

Query: 69  HAERIDAIREPGRASS*KREP 7
              R+D + +     + ++ P
Sbjct: 210 KEGRVDDVNQYANECAEEKHP 230



 Score = 36.7 bits (81), Expect = 0.42
 Identities = 16/53 (30%), Positives = 31/53 (58%)
 Frame = -1

Query: 425 VQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEELGGIWERL 267
           + +H+   + + +++PR+  IT  G +++E  HFA   ++SRV+ L    E L
Sbjct: 832 LNRHKVILENIASHEPRIQVITERGNKMVEEGHFAAEDVASRVKSLNQNMESL 884



 Score = 35.5 bits (78), Expect = 0.97
 Identities = 19/79 (24%), Positives = 37/79 (46%)
 Frame = -3

Query: 282 NMGATGAVFELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQK 103
           N  A   +++ +  + ++      + R  E ++ W+S  E  L +ED G  L S + L +
Sbjct: 457 NWDALLELWDQRHRQYEQCLDFHLFYRDSEQVDSWMSRQEAFLENEDLGNSLGSAEALLQ 516

Query: 102 KHALLEADVSSHAERIDAI 46
           KH   E   ++  E+I  +
Sbjct: 517 KHDDFEEAFTAQEEKITTV 535



 Score = 33.9 bits (74), Expect = 3.0
 Identities = 13/52 (25%), Positives = 27/52 (51%)
 Frame = -1

Query: 449  DPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVE 294
            D T +   +++HQ    +++A  P    +   G  L++ EH A P+I  +++
Sbjct: 1338 DLTGIEILLERHQEHRADMEAEAPTFQALEDFGAELIDSEHRASPEIEKKLQ 1389


>UniRef50_UPI000065F0D4 Cluster: Spectrin beta chain, brain 4
            (Spectrin, non-erythroid beta chain 4) (Beta-V spectrin)
            (BSPECV).; n=3; Euteleostomi|Rep: Spectrin beta chain,
            brain 4 (Spectrin, non-erythroid beta chain 4) (Beta-V
            spectrin) (BSPECV). - Takifugu rubripes
          Length = 3557

 Score = 62.5 bits (145), Expect = 7e-09
 Identities = 30/90 (33%), Positives = 50/90 (55%)
 Frame = -1

Query: 497  LGKRES*KFATDDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQ 318
            L   E  + A D+SY DPTN+  K+++H+  E+E++AN+ R+D +  +G+ ++  EHF  
Sbjct: 1396 LWMEEKFQVAEDESYRDPTNILRKLKRHEATEKEMKANEVRLDTLVQLGEEMIAGEHFGS 1455

Query: 317  PQISSRVEELGGIWERLVQSSS*RETSCRK 228
              I  +  EL   W RL    + R    R+
Sbjct: 1456 RSIRIKTSELCSSWRRLENKMADRGDKLRQ 1485



 Score = 58.4 bits (135), Expect = 1e-07
 Identities = 27/71 (38%), Positives = 44/71 (61%)
 Frame = -1

Query: 470  ATDDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEE 291
            A D+++ +PTNL  K+ KHQ+FE E+ AN+ RVD +T   + LL     A+ ++  R++E
Sbjct: 2792 ALDENWREPTNLQAKLLKHQSFEAEVLANRYRVDSLTKEAQELLSECPSAEAKVGPRLKE 2851

Query: 290  LGGIWERLVQS 258
            L   W  L+ +
Sbjct: 2852 LTDSWAALIHN 2862



 Score = 48.0 bits (109), Expect = 2e-04
 Identities = 27/67 (40%), Positives = 38/67 (56%)
 Frame = -3

Query: 255  ELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADV 76
            E K  +L EA Q  Q  R+++D+E  +  VE +L +ED G DL SV  L K    LE ++
Sbjct: 2864 EEKKIRLHEAHQALQLQRSLDDVEQSVVLVEKELANEDCGADLPSVNRLLKALQALEEEL 2923

Query: 75   SSHAERI 55
              H +RI
Sbjct: 2924 DGHRDRI 2930



 Score = 47.6 bits (108), Expect = 2e-04
 Identities = 24/68 (35%), Positives = 41/68 (60%)
 Frame = -3

Query: 249  KGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSS 70
            +G+KL++A QQ+Q    ++D EL +  ++  L +   G DL S + L K+H  LE +   
Sbjct: 1479 RGDKLRQAGQQEQLMELLQDAELKIETIQWILNNAAKGHDLRSSRQLLKEHQQLEQEAKE 1538

Query: 69   HAERIDAI 46
             AE+I++I
Sbjct: 1539 LAEKINSI 1546



 Score = 45.2 bits (102), Expect = 0.001
 Identities = 20/66 (30%), Positives = 38/66 (57%)
 Frame = -3

Query: 237  LQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAER 58
            L++A   Q +  +VE  E W+S  E  L +++ G  +T V+ LQ+K A  E D+ +  +R
Sbjct: 2659 LEQARTLQSFLVSVEQCESWISNKEAFLSNQNLGNSVTEVEALQRKQAQFEEDLEAQLDR 2718

Query: 57   IDAIRE 40
            +  +++
Sbjct: 2719 VHEVQK 2724



 Score = 43.6 bits (98), Expect = 0.004
 Identities = 21/74 (28%), Positives = 40/74 (54%)
 Frame = -3

Query: 243 NKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHA 64
           ++LQ A   +QY     +   WL + +  L SEDYGKD +    L ++H  +E ++ +++
Sbjct: 698 HRLQAALTIKQYFADAAEANSWLGDRKPLLTSEDYGKDESHTAVLLQRHLWVEKEIVAYS 757

Query: 63  ERIDAIREPGRASS 22
             I  + E  R+++
Sbjct: 758 SEIGRLSEQARSAA 771



 Score = 41.5 bits (93), Expect = 0.015
 Identities = 23/59 (38%), Positives = 36/59 (61%), Gaps = 3/59 (5%)
 Frame = -3

Query: 213 QYNRAVEDIELW---LSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAERIDAI 46
           Q+   + DIEL    L+ ++ Q  S + GK+L  V++L +K  LLEA +S+H E I +I
Sbjct: 492 QHLHVLRDIELVCQELNNLQAQAGSTELGKELAEVESLLQKQDLLEAQISAHGETIGSI 550



 Score = 39.5 bits (88), Expect = 0.060
 Identities = 19/69 (27%), Positives = 36/69 (52%)
 Frame = -1

Query: 425  VQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEELGGIWERLVQSSS*R 246
            + +HQ   QE+++ +P V  +   G  L+   HFA   I  R++EL  + E L   ++ +
Sbjct: 3011 LHRHQAVVQEIRSRRPLVQAVQEAGHSLVRGRHFASHDIQERLQELKMLHEELTTEAAQK 3070

Query: 245  ETSCRKRLN 219
            E   ++ L+
Sbjct: 3071 EKLLQEALS 3079



 Score = 39.5 bits (88), Expect = 0.060
 Identities = 21/70 (30%), Positives = 40/70 (57%), Gaps = 1/70 (1%)
 Frame = -3

Query: 237  LQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAE- 61
            L++      + R  ++++ WL+  +    S+D G+DL  V+ LQKK  +L ++VS   + 
Sbjct: 3180 LEDQLHLYVFEREAKELQTWLTSKKTAAESQDCGQDLEDVEVLQKKLEVLVSEVSGLGQT 3239

Query: 60   RIDAIREPGR 31
            R+  I++ GR
Sbjct: 3240 RLTEIQQLGR 3249



 Score = 38.3 bits (85), Expect = 0.14
 Identities = 16/61 (26%), Positives = 33/61 (54%)
 Frame = -3

Query: 237  LQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAER 58
            LQEA + Q + +  +++  W+  +E +LL E    D+ S  +L ++H  L+ ++     R
Sbjct: 1169 LQEARRLQSFQQQAKELRHWMESIEERLLQEGKATDVASAISLFEQHLELQQEMEEQRSR 1228

Query: 57   I 55
            +
Sbjct: 1229 L 1229



 Score = 37.5 bits (83), Expect = 0.24
 Identities = 21/83 (25%), Positives = 40/83 (48%)
 Frame = -3

Query: 249  KGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSS 70
            K   LQEA     +   V +++LW+ E +  L SED G+   + + L +K   ++ ++ +
Sbjct: 3070 KEKLLQEALSIYTFLTKVSELDLWMEEQKAGLESEDCGRSEEAAEALLRKLDGVDVELEN 3129

Query: 69   HAERIDAIREPGRASS*KREPLS 1
                +  ++E G      R P+S
Sbjct: 3130 QRRIVAKLQEDGAPLQHLRHPIS 3152



 Score = 37.1 bits (82), Expect = 0.32
 Identities = 30/120 (25%), Positives = 58/120 (48%), Gaps = 7/120 (5%)
 Frame = -1

Query: 593  LEKSRTKRPRSPWKDRPTKYQQFETRL**N*RLGKRES*KFATDDSYLDPTNLNGKV--- 423
            LE+++++  R+ W+ R T  +Q  T       + + ES   +  +++L   NL   V   
Sbjct: 2641 LEEAKSRLERA-WQKRHTTLEQARTLQSFLVSVEQCES-WISNKEAFLSNQNLGNSVTEV 2698

Query: 422  ----QKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEELGGIWERLVQSS 255
                +K   FE++L+A   RV E+  + + L++ +H+    I ++   L   W +L Q S
Sbjct: 2699 EALQRKQAQFEEDLEAQLDRVHEVQKLAEELIQQKHYDSDNIRAKSRALTLRWGQLQQQS 2758



 Score = 36.3 bits (80), Expect = 0.56
 Identities = 18/51 (35%), Positives = 28/51 (54%)
 Frame = -3

Query: 252  LKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKK 100
            L+G +LQEA Q   + R   ++E W+++      S+D G D   VQ L+ K
Sbjct: 1793 LRGQRLQEALQLHLFMRESSEMEDWMNQQRQTAESQDLGNDYQHVQVLRGK 1843



 Score = 35.5 bits (78), Expect = 0.97
 Identities = 17/56 (30%), Positives = 31/56 (55%)
 Frame = -3

Query: 195 EDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAERIDAIREPGRA 28
           E++E WL E   +LL+   G+DL  ++    KH +LEA++ +       + + G+A
Sbjct: 607 EELEAWLYECWLRLLAVRLGRDLNHIRLSLHKHKVLEAELQAQESLYQTVLKRGQA 662



 Score = 35.5 bits (78), Expect = 0.97
 Identities = 19/56 (33%), Positives = 32/56 (57%), Gaps = 1/56 (1%)
 Frame = -3

Query: 192  DIEL-WLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAERIDAIREPGRA 28
            D+EL W++E      S  + K L    +L +KH  L+A+V++H   ++ I E GR+
Sbjct: 1602 DLELSWMAEHVPASGSTAHEKSLAGALSLMQKHKELQAEVTAHKTHLNLILEKGRS 1657



 Score = 34.3 bits (75), Expect = 2.3
 Identities = 19/74 (25%), Positives = 32/74 (43%)
 Frame = -3

Query: 249  KGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSS 70
            +G +L EA   Q+Y     ++  WL E+   +  E    D T  + L KKH      +  
Sbjct: 3383 RGVRLCEAEDVQKYLSHWTELMTWLKEMMSLVRGEPLIMDGTDPEQLMKKHQEFRLQIDR 3442

Query: 69   HAERIDAIREPGRA 28
               +   ++E GR+
Sbjct: 3443 QLGKSQLVKEEGRS 3456



 Score = 32.3 bits (70), Expect = 9.1
 Identities = 18/64 (28%), Positives = 36/64 (56%)
 Frame = -3

Query: 237  LQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAER 58
            L E+ Q  Q+  +   + +WL+E     L E++ ++ T++Q    KH   EA+V ++  R
Sbjct: 2765 LVESLQLLQFLSSSYQVSVWLNERNVVALDENW-REPTNLQAKLLKHQSFEAEVLANRYR 2823

Query: 57   IDAI 46
            +D++
Sbjct: 2824 VDSL 2827


>UniRef50_A7S1C0 Cluster: Predicted protein; n=1; Nematostella
            vectensis|Rep: Predicted protein - Nematostella vectensis
          Length = 2297

 Score = 62.5 bits (145), Expect = 7e-09
 Identities = 30/77 (38%), Positives = 49/77 (63%)
 Frame = -1

Query: 485  ES*KFATDDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQIS 306
            E  + A+++SY D +N+ GKV KH+ FE ELQANK R+D+I+  G+ L + +   +P+I 
Sbjct: 1273 EKHQVASEESYRDLSNIQGKVMKHEAFEAELQANKERLDQISESGRDLADEKPENKPEID 1332

Query: 305  SRVEELGGIWERLVQSS 255
              +++L   W  L + S
Sbjct: 1333 ELLQKLDQKWLELAEVS 1349



 Score = 58.8 bits (136), Expect = 9e-08
 Identities = 30/72 (41%), Positives = 43/72 (59%)
 Frame = -3

Query: 249  KGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSS 70
            KG +L +A Q  Q++R V+D E W++E E  L S +YG +L  VQ LQKKH  L A++  
Sbjct: 1458 KGAELDQAMQFFQFDRDVDDEETWINEKEPLLQSTNYGNNLFEVQKLQKKHQTLCAEIDI 1517

Query: 69   HAERIDAIREPG 34
            H +  + I   G
Sbjct: 1518 HQKHKERICNQG 1529



 Score = 58.4 bits (135), Expect = 1e-07
 Identities = 26/71 (36%), Positives = 47/71 (66%)
 Frame = -3

Query: 240 KLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAE 61
           +L++  Q Q+  + + +I  W+ E++  LLSEDYGK L  V++L +KH+L+EAD+++ A+
Sbjct: 492 RLEKCMQLQRVFQEMINIIDWMDEIKIGLLSEDYGKHLLGVEDLLQKHSLVEADIAAQAD 551

Query: 60  RIDAIREPGRA 28
           R+  +     A
Sbjct: 552 RVKTVNAQAEA 562



 Score = 55.2 bits (127), Expect = 1e-06
 Identities = 21/65 (32%), Positives = 44/65 (67%)
 Frame = -3

Query: 249  KGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSS 70
            KG+KL++A +Q+++N  V+ ++ W+ E+E  +++++   DLT+   L +KH  LE  +++
Sbjct: 1352 KGSKLKDAQRQEEFNAGVQTMQEWVKELETVIITQEKATDLTTATRLYQKHKQLEKQINA 1411

Query: 69   HAERI 55
              ER+
Sbjct: 1412 KKERL 1416



 Score = 54.8 bits (126), Expect = 1e-06
 Identities = 27/70 (38%), Positives = 46/70 (65%)
 Frame = -3

Query: 240  KLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAE 61
            +L++A Q QQ+ +  ED+  WL+E + Q+ SE+  +DL+++Q    KH   EA++ ++ E
Sbjct: 1250 RLRDALQLQQFIQDAEDMYDWLNE-KHQVASEESYRDLSNIQGKVMKHEAFEAELQANKE 1308

Query: 60   RIDAIREPGR 31
            R+D I E GR
Sbjct: 1309 RLDQISESGR 1318



 Score = 46.4 bits (105), Expect = 5e-04
 Identities = 21/67 (31%), Positives = 38/67 (56%)
 Frame = -3

Query: 240  KLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAE 61
            +L  + Q +QY     + E W+SE E  ++ ++ GKD  S   + K+H  LEA ++ +AE
Sbjct: 1567 QLDLSLQAKQYYFDAAEAESWMSEQELNMMGDERGKDEASATEMLKRHETLEAAIADYAE 1626

Query: 60   RIDAIRE 40
             ++ + E
Sbjct: 1627 TVNELGE 1633



 Score = 44.0 bits (99), Expect = 0.003
 Identities = 18/56 (32%), Positives = 35/56 (62%)
 Frame = -3

Query: 213 QYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAERIDAI 46
           +++R     E WL+E +  +  +++G DL +V+   KKH  +E D+ ++ ER++AI
Sbjct: 395 KFDRKYAMRETWLNENQRLVAVDNFGNDLAAVEAATKKHEAIETDIMAYEERVNAI 450



 Score = 44.0 bits (99), Expect = 0.003
 Identities = 21/74 (28%), Positives = 41/74 (55%)
 Frame = -3

Query: 261  VFELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEA 82
            + E +   L+ A +  +Y    +++   + E +  L++E+ G+DL SVQ LQ+ H   EA
Sbjct: 1773 LIETRTKMLEAALELHKYYHDAKEVLAMIQEKDN-LMTEELGRDLNSVQQLQRTHQSFEA 1831

Query: 81   DVSSHAERIDAIRE 40
            D++    ++  I+E
Sbjct: 1832 DLAPLGHQVSGIQE 1845



 Score = 43.2 bits (97), Expect = 0.005
 Identities = 19/69 (27%), Positives = 39/69 (56%)
 Frame = -3

Query: 240 KLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAE 61
           +L+E+ + Q + R  ++ E+W++E +  + S DYG DL +   L  KH  +E ++++   
Sbjct: 606 RLEESLKLQSFYRNADEEEMWVTEKDYFVQSTDYGHDLNTAMILLTKHEAVEREMTARNA 665

Query: 60  RIDAIREPG 34
           +  A+   G
Sbjct: 666 QTKAVARNG 674



 Score = 41.1 bits (92), Expect = 0.020
 Identities = 20/52 (38%), Positives = 31/52 (59%)
 Frame = -3

Query: 255  ELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKK 100
            E +  KL E  +  Q NR V+D+ELW+++ E    S+D G+DL   + L +K
Sbjct: 1668 EERRGKLDETLKLYQLNREVDDLELWIADKEQVAGSQDIGQDLAHCELLIEK 1719



 Score = 39.1 bits (87), Expect = 0.079
 Identities = 20/64 (31%), Positives = 32/64 (50%)
 Frame = -3

Query: 240 KLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAE 61
           K+QE  + QQ+     DI  W   +E  + ++D G D  S + L KKH  +E  +  +A 
Sbjct: 712 KIQENLKLQQFIAEYNDIMSWCDMMERIVANDDLGYDEHSAEVLVKKHHAVEEGIQGYAS 771

Query: 60  RIDA 49
            + A
Sbjct: 772 EVKA 775



 Score = 38.3 bits (85), Expect = 0.14
 Identities = 20/72 (27%), Positives = 37/72 (51%), Gaps = 3/72 (4%)
 Frame = -3

Query: 240  KLQEAAQQQQYNRAVEDIELWLSEVEGQL---LSEDYGKDLTSVQNLQKKHALLEADVSS 70
            KLQ+A    + NR    +E W+ E E +L   L+ D G DL   Q ++++    + ++ +
Sbjct: 817  KLQDALSLHKLNREAYIVETWIDERENRLDTALTVDKGMDLEECQVIEQRFEGFQQELDA 876

Query: 69   HAERIDAIREPG 34
            +  R+  + E G
Sbjct: 877  NERRVQLVNELG 888



 Score = 37.1 bits (82), Expect = 0.32
 Identities = 15/68 (22%), Positives = 34/68 (50%)
 Frame = -3

Query: 237  LQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAER 58
            L E+ + Q++   ++D ++WL     ++ SED    L+  +   K+H  ++ ++ +H   
Sbjct: 1038 LAESGELQRFVIDLDDFQIWLRHTHNEVASEDIPNSLSEAERSLKEHEDIKDEIDTHEPD 1097

Query: 57   IDAIREPG 34
               + E G
Sbjct: 1098 FQKLIEDG 1105



 Score = 36.3 bits (80), Expect = 0.56
 Identities = 19/56 (33%), Positives = 28/56 (50%)
 Frame = -3

Query: 213  QYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAERIDAI 46
            Q+ R     E W+   E  L +E+ G DL  V+ L +KH   E  V++  ER  A+
Sbjct: 2001 QFARDAYTAEAWIMAQESYLRNENLGIDLAEVEKLLEKHGNFEKVVAAQEERFLAL 2056



 Score = 35.5 bits (78), Expect = 0.97
 Identities = 16/66 (24%), Positives = 35/66 (53%)
 Frame = -1

Query: 419 KHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEELGGIWERLVQSSS*RET 240
           KH+  E+E+ A   +   +   G+ LLE   +A   I +R++ +   W++L  +++ R+ 
Sbjct: 652 KHEAVEREMTARNAQTKAVARNGEELLEAVPYATDTIQNRLDTIRSKWDKLHDNAAYRKK 711

Query: 239 SCRKRL 222
             ++ L
Sbjct: 712 KIQENL 717



 Score = 33.9 bits (74), Expect = 3.0
 Identities = 16/70 (22%), Positives = 36/70 (51%)
 Frame = -3

Query: 243  NKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHA 64
            +KL +A    ++  AV+D  LW++++   +L+ +  KD++ V+ L  +H     ++    
Sbjct: 1885 DKLHDADDLYRFLIAVQDQMLWMNDMLKHILTYEKAKDVSGVEVLMDQHQSRHVEIEGRE 1944

Query: 63   ERIDAIREPG 34
            E    + + G
Sbjct: 1945 ESFFGVIKMG 1954


>UniRef50_O02425 Cluster: Putative uncharacterized protein sma-1; n=2;
            Caenorhabditis|Rep: Putative uncharacterized protein
            sma-1 - Caenorhabditis elegans
          Length = 4063

 Score = 59.3 bits (137), Expect = 7e-08
 Identities = 27/75 (36%), Positives = 44/75 (58%)
 Frame = -1

Query: 476  KFATDDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRV 297
            + A D+S+LD TNL  K+QKH  F+ EL  N+ R+  +   G++L+   HF   Q+ +++
Sbjct: 2749 QLAYDESFLDHTNLRSKLQKHMAFDSELVENEKRLSTVERQGEQLVTDNHFMSEQVKAQL 2808

Query: 296  EELGGIWERLVQSSS 252
             EL   W+ L   S+
Sbjct: 2809 VELRSGWDELRTKSA 2823



 Score = 58.8 bits (136), Expect = 9e-08
 Identities = 27/74 (36%), Positives = 46/74 (62%)
 Frame = -3

Query: 252  LKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVS 73
            LK  +L+EA +     R VEDIE WL +VEG+L S+D+G+D+ S + L KK   L+ +++
Sbjct: 2824 LKTQRLREAFELHSLQRKVEDIEKWLDKVEGELSSDDHGRDILSTELLIKKLDTLQTEIA 2883

Query: 72   SHAERIDAIREPGR 31
              ++ +  + +  R
Sbjct: 2884 GRSDAVVEMMKKAR 2897



 Score = 55.2 bits (127), Expect = 1e-06
 Identities = 27/73 (36%), Positives = 46/73 (63%)
 Frame = -3

Query: 249  KGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSS 70
            KG +L++AA Q+  +R +ED    L E++  L S+D G DL SV++L +KHA+LE ++  
Sbjct: 1446 KGLRLRQAADQKGLDRILEDAHAKLDEMQTALNSKDQGLDLRSVKDLLQKHAVLEQEMGL 1505

Query: 69   HAERIDAIREPGR 31
            +  ++  I   G+
Sbjct: 1506 YGNKLSDIENRGK 1518



 Score = 51.6 bits (118), Expect = 1e-05
 Identities = 21/63 (33%), Positives = 37/63 (58%)
 Frame = -1

Query: 464  DDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEELG 285
            DDS L P+ +  ++ KH+ FE E+ AN+PR+ +I + G  L+  +H+  P +   V ++ 
Sbjct: 1374 DDSALAPSAIPHRLLKHEAFEAEIIANEPRIQQINSEGDGLVSKKHYESPNVEKIVRQVN 1433

Query: 284  GIW 276
              W
Sbjct: 1434 AQW 1436



 Score = 47.6 bits (108), Expect = 2e-04
 Identities = 27/79 (34%), Positives = 44/79 (55%)
 Frame = -3

Query: 240  KLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAE 61
            +L  A +   +NR VED +  + E    + S+DYGKD  SV+ L +K + LE D+S+  +
Sbjct: 2405 ELLAAMEVHTFNRDVEDTDERIHEKVAAMKSDDYGKDFASVELLVRKQSALERDMSAIHQ 2464

Query: 60   RIDAIREPGRASS*KREPL 4
            ++ A  +  +    KR PL
Sbjct: 2465 KLIAHDKDAQKILEKRPPL 2483



 Score = 46.8 bits (106), Expect = 4e-04
 Identities = 22/69 (31%), Positives = 38/69 (55%)
 Frame = -3

Query: 246 GNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSH 67
           GN L EA   QQY +   + E W+ E    + S+D G+D  + ++L ++HA LE ++ ++
Sbjct: 730 GNWLSEARHAQQYFQDANEAESWIREKMPLVKSDDLGRDEGAAESLLQRHARLEEEIRAY 789

Query: 66  AERIDAIRE 40
              I  + E
Sbjct: 790 KSDISRLEE 798



 Score = 42.7 bits (96), Expect = 0.006
 Identities = 18/59 (30%), Positives = 34/59 (57%)
 Frame = -3

Query: 222  QQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAERIDAI 46
            ++QQY     ++E W++E    L SEDYG D  + + L  KH  L  D++++ + ++ +
Sbjct: 1667 KEQQYLFDAAEVESWMNEKRNALASEDYGNDEDAARKLLSKHRALCEDMTTYRQWLEKL 1725



 Score = 42.7 bits (96), Expect = 0.006
 Identities = 22/54 (40%), Positives = 32/54 (59%)
 Frame = -1

Query: 428  KVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEELGGIWERL 267
            ++Q HQ  E E+ ANKP VD+I   G +L  L     P+I++R +EL   W +L
Sbjct: 2238 RLQTHQALEAEVTANKPVVDQILQRGNQLKNLHR--NPKIANRCDELSYKWNQL 2289



 Score = 41.5 bits (93), Expect = 0.015
 Identities = 17/63 (26%), Positives = 31/63 (49%)
 Frame = -1

Query: 449  DPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEELGGIWER 270
            D  +    V++H  +  E+Q  KP VD+    G+R+++  H    +I  +V+ L   W  
Sbjct: 3398 DVASCESLVRRHDEYNLEMQGRKPFVDDFARQGRRMIQSSHVLSQEIQEKVDILEKSWAM 3457

Query: 269  LVQ 261
            L +
Sbjct: 3458 LCE 3460



 Score = 40.3 bits (90), Expect = 0.034
 Identities = 17/66 (25%), Positives = 38/66 (57%)
 Frame = -3

Query: 240  KLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAE 61
            ++ +A++  ++ R  +D+  WL E E    +EDYG+DL   Q + ++      ++++  E
Sbjct: 3146 QIVDASKYHKFVRQADDLSDWLREKERSASAEDYGQDLEDCQQIIEQFESTVRELAAAGE 3205

Query: 60   RIDAIR 43
            R+ A++
Sbjct: 3206 RVAAVQ 3211



 Score = 39.9 bits (89), Expect = 0.045
 Identities = 20/50 (40%), Positives = 30/50 (60%), Gaps = 1/50 (2%)
 Frame = -3

Query: 192  DIEL-WLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAERIDAI 46
            D EL W++E +    S+D G+ LT   N+ KK   LEA+V+ H  +ID +
Sbjct: 1570 DCELQWIAEKKPIASSQDCGRTLTEALNMVKKQEQLEAEVNQHGGQIDKV 1619



 Score = 36.3 bits (80), Expect = 0.56
 Identities = 21/75 (28%), Positives = 38/75 (50%)
 Frame = -3

Query: 255  ELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADV 76
            +++   L +A    Q+ +A E+   WLS+      S + G  L S  +LQKKHA LE ++
Sbjct: 2929 QIRRENLVDAQAFFQWVKAAEEDLEWLSDRMMLASSGESGDSLQSALSLQKKHATLEKEL 2988

Query: 75   SSHAERIDAIREPGR 31
             +    ++   + G+
Sbjct: 2989 DTRQSAMNDTEQRGK 3003



 Score = 35.5 bits (78), Expect = 0.97
 Identities = 21/77 (27%), Positives = 38/77 (49%)
 Frame = -3

Query: 279  MGATGAVFELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKK 100
            M +   ++  +   L++    Q +NR  E I+      E  L  ++ G  + SV+NL K+
Sbjct: 1223 MASLRDLYRRRDTILKQQLDLQLFNRESERIDAATKGHEAFLEFDNLGDSVESVENLLKR 1282

Query: 99   HALLEADVSSHAERIDA 49
            H  LEA + +   R++A
Sbjct: 1283 HRDLEAKLDAQEARLEA 1299



 Score = 35.1 bits (77), Expect = 1.3
 Identities = 17/71 (23%), Positives = 35/71 (49%)
 Frame = -3

Query: 252  LKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVS 73
            L+ + LQEA    +Y     + E WL E     +S++ G+D    ++  ++  +L+ +V 
Sbjct: 3036 LRRDLLQEAIDAHEYYTEETEAEQWLREQMPLAMSQEMGRDQAGAESHLRRLTVLDKEVE 3095

Query: 72   SHAERIDAIRE 40
                 ID +++
Sbjct: 3096 LFKNEIDRLKK 3106



 Score = 32.7 bits (71), Expect = 6.9
 Identities = 14/70 (20%), Positives = 31/70 (44%)
 Frame = -3

Query: 240  KLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAE 61
            KL+     Q Y +   ++  W+  ++  + SE   +D+ S ++L ++H     ++     
Sbjct: 3362 KLRHMQSLQSYFQEYREMMQWMKNMQSTMTSEQLPRDVASCESLVRRHDEYNLEMQGRKP 3421

Query: 60   RIDAIREPGR 31
             +D     GR
Sbjct: 3422 FVDDFARQGR 3431


>UniRef50_O15020 Cluster: Spectrin beta chain, brain 2; n=55;
            Eukaryota|Rep: Spectrin beta chain, brain 2 - Homo
            sapiens (Human)
          Length = 2390

 Score = 58.8 bits (136), Expect = 9e-08
 Identities = 30/71 (42%), Positives = 44/71 (61%)
 Frame = -3

Query: 240  KLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAE 61
            +LQ + +Q Q++R VED  LW++E      S ++GKDL SVQ L KK+  L+ ++  H  
Sbjct: 1483 RLQASREQHQFHRDVEDEILWVTERLPMASSMEHGKDLPSVQLLMKKNQTLQKEIQGHEP 1542

Query: 60   RIDAIREPGRA 28
            RI  +RE  RA
Sbjct: 1543 RIADLRERQRA 1553



 Score = 54.4 bits (125), Expect = 2e-06
 Identities = 26/76 (34%), Positives = 46/76 (60%)
 Frame = -3

Query: 255  ELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADV 76
            + K   L +A + + + ++   +E WL  ++ QL S+DYGKDLTSV  L KK  +LE ++
Sbjct: 1373 QAKARSLFDANRAELFAQSCCALESWLESLQAQLHSDDYGKDLTSVNILLKKQQMLEWEM 1432

Query: 75   SSHAERIDAIREPGRA 28
            +   + ++AI+   +A
Sbjct: 1433 AVREKEVEAIQAQAKA 1448



 Score = 52.0 bits (119), Expect = 1e-05
 Identities = 24/71 (33%), Positives = 41/71 (57%)
 Frame = -3

Query: 267  GAVFELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALL 88
            G   EL+G +L++A + QQ+ R   + E W+ E E  ++ ++  KD  S Q   KKH +L
Sbjct: 1574 GHELELRGKRLEDALRAQQFYRDAAEAEAWMGEQELHMMGQEKAKDELSAQAEVKKHQVL 1633

Query: 87   EADVSSHAERI 55
            E  ++ +A+ I
Sbjct: 1634 EQALADYAQTI 1644



 Score = 51.6 bits (118), Expect = 1e-05
 Identities = 26/79 (32%), Positives = 41/79 (51%)
 Frame = -3

Query: 264 AVFELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLE 85
           A+ E +  +L +AA   Q+     D+E WL +    + S + G D  S Q L ++H  LE
Sbjct: 734 ALAEERAQRLAQAASLYQFQADANDMEAWLVDALRLVSSPELGHDEFSTQALARQHRALE 793

Query: 84  ADVSSHAERIDAIREPGRA 28
            ++ SH   +DA+RE   A
Sbjct: 794 EEIRSHRPTLDALREQAAA 812



 Score = 48.4 bits (110), Expect = 1e-04
 Identities = 19/45 (42%), Positives = 33/45 (73%)
 Frame = -3

Query: 180 WLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAERIDAI 46
           W+ E++G+L S+D G+ L  V++L + H L+EAD++  AER+ A+
Sbjct: 546 WMEEMKGRLQSQDLGRHLAGVEDLLQLHELVEADIAVQAERVRAV 590



 Score = 43.6 bits (98), Expect = 0.004
 Identities = 24/68 (35%), Positives = 37/68 (54%)
 Frame = -1

Query: 470  ATDDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEE 291
            A D SY +  NL+ K QKHQ F  EL ANK  +D++   G+ L   +   +  +S ++ +
Sbjct: 1301 AQDVSYDEARNLHTKWQKHQAFMAELAANKDWLDKVDKEGRELTLEKPELKALVSEKLRD 1360

Query: 290  LGGIWERL 267
            L   W+ L
Sbjct: 1361 LHRRWDEL 1368



 Score = 40.3 bits (90), Expect = 0.034
 Identities = 18/69 (26%), Positives = 41/69 (59%)
 Frame = -3

Query: 252 LKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVS 73
           ++  KL++ A +  ++R     E WLSE +  +  +++G +L +V+   +KH  +E D+ 
Sbjct: 418 IRQEKLEQLAAR--FDRKAAMRETWLSENQRLVSQDNFGLELAAVEAAVRKHEAIETDIV 475

Query: 72  SHAERIDAI 46
           +++ R+ A+
Sbjct: 476 AYSGRVQAV 484



 Score = 38.3 bits (85), Expect = 0.14
 Identities = 20/70 (28%), Positives = 34/70 (48%)
 Frame = -3

Query: 240 KLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAE 61
           +L+E+ +  ++   V + E W+ E +  L S D G+DLT    L  KH  L  ++S    
Sbjct: 636 RLEESRRLWRFLWEVGEAEAWVREQQHLLASADTGRDLTGALRLLNKHTALRGEMSGRLG 695

Query: 60  RIDAIREPGR 31
            +    E G+
Sbjct: 696 PLKLTLEQGQ 705



 Score = 36.3 bits (80), Expect = 0.56
 Identities = 21/65 (32%), Positives = 33/65 (50%), Gaps = 1/65 (1%)
 Frame = -3

Query: 240  KLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSS-HA 64
            +LQE  +  Q  R ++D+E W+ E E    S + G+D   V  L+ K      D S+   
Sbjct: 1689 RLQEHLRLCQLRRELDDLEQWIQEREVVAASHELGQDYEHVTMLRDKFREFSRDTSTIGQ 1748

Query: 63   ERIDA 49
            ER+D+
Sbjct: 1749 ERVDS 1753



 Score = 35.9 bits (79), Expect = 0.74
 Identities = 19/77 (24%), Positives = 33/77 (42%)
 Frame = -3

Query: 264  AVFELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLE 85
            A    +   L EA + Q + R+++D + WL   +  + SE+    L   + L  +HA L 
Sbjct: 1052 ATMRRREESLGEARRLQDFLRSLDDFQAWLGRTQTAVASEEGPATLPEAEALLAQHAALR 1111

Query: 84   ADVSSHAERIDAIREPG 34
             +V         +R  G
Sbjct: 1112 GEVERAQSEYSRLRALG 1128


>UniRef50_UPI0000E485B1 Cluster: PREDICTED: similar to beta chain
           spectrin, partial; n=4; Strongylocentrotus
           purpuratus|Rep: PREDICTED: similar to beta chain
           spectrin, partial - Strongylocentrotus purpuratus
          Length = 1847

 Score = 58.0 bits (134), Expect = 2e-07
 Identities = 27/76 (35%), Positives = 48/76 (63%)
 Frame = -3

Query: 258 FELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEAD 79
           F+ +G KLQ+A ++QQ  R +ED    + E+E  + S+D G DL SV++L K+  +L+ +
Sbjct: 706 FKERGKKLQQAVEEQQLIRGMEDAAGNIQEIEVAMASQDVGHDLRSVKSLLKRQQVLDTE 765

Query: 78  VSSHAERIDAIREPGR 31
           +S  AER+  + +  +
Sbjct: 766 MSLQAERMQKLSQDSK 781



 Score = 55.6 bits (128), Expect = 9e-07
 Identities = 26/73 (35%), Positives = 43/73 (58%)
 Frame = -1

Query: 485 ES*KFATDDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQIS 306
           E  + A D+SY + TNL GKV+KHQ FE E+ ANK R+D++   G  +++ ++    +I 
Sbjct: 630 EKFEIADDESYRELTNLPGKVKKHQAFEAEITANKERLDKLNETGAAIVKSDNANSEEIQ 689

Query: 305 SRVEELGGIWERL 267
             ++ +   W  L
Sbjct: 690 VLLKAINSRWTDL 702



 Score = 53.2 bits (122), Expect = 5e-06
 Identities = 25/68 (36%), Positives = 40/68 (58%)
 Frame = -3

Query: 255  ELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADV 76
            E +  KL+E+ + QQ+   V++   W+ +      S +YG+D TS Q++ KKH  LEA++
Sbjct: 813  EKRRKKLEESLRVQQFYHDVDNELQWIKDHSPAASSTNYGRDFTSTQSMVKKHQKLEAEI 872

Query: 75   SSHAERID 52
            S H   ID
Sbjct: 873  SGHQPVID 880



 Score = 48.0 bits (109), Expect = 2e-04
 Identities = 19/65 (29%), Positives = 38/65 (58%)
 Frame = -1

Query: 449  DPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEELGGIWER 270
            D T+    V+KHQ  E E+  ++P +D+  + G+ L++  HFA  ++  R ++L   W++
Sbjct: 854  DFTSTQSMVKKHQKLEAEISGHQPVIDKDLSTGQHLIDSGHFALHEVQERCQDLSLSWDQ 913

Query: 269  LVQSS 255
            L+  +
Sbjct: 914  LLDQA 918



 Score = 46.8 bits (106), Expect = 4e-04
 Identities = 21/76 (27%), Positives = 46/76 (60%)
 Frame = -3

Query: 255 ELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADV 76
           E +   L+E+ +  ++ R  ++I  WL+E + ++  ++  ++LT++    KKH   EA++
Sbjct: 602 EQRCKALKESQEHLEFVRDADEISSWLAE-KFEIADDESYRELTNLPGKVKKHQAFEAEI 660

Query: 75  SSHAERIDAIREPGRA 28
           +++ ER+D + E G A
Sbjct: 661 TANKERLDKLNETGAA 676



 Score = 40.7 bits (91), Expect = 0.026
 Identities = 22/72 (30%), Positives = 38/72 (52%)
 Frame = -3

Query: 258  FELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEAD 79
            ++ K  KL +A QQQQ+ R  + +E   S+ E  L S D G  +  V+   KKH   E  
Sbjct: 1342 WQTKKEKLDQAHQQQQFYREAKILETLSSQQEVYLQSSDMGATVEEVEAQIKKHEAFEKI 1401

Query: 78   VSSHAERIDAIR 43
            +++  E+ + ++
Sbjct: 1402 LATQEEKTNTLQ 1413



 Score = 39.9 bits (89), Expect = 0.045
 Identities = 20/55 (36%), Positives = 34/55 (61%)
 Frame = -3

Query: 240  KLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADV 76
            KL+ A Q  Q+NR  E+    + E +  ++ E+ GKD+ +VQ+L +KH   E+D+
Sbjct: 1136 KLEAARQIHQFNRDYEEAMSRIQE-KYAIIPEELGKDVNAVQSLVRKHEAFESDL 1189



 Score = 38.7 bits (86), Expect = 0.10
 Identities = 15/69 (21%), Positives = 37/69 (53%)
 Frame = -3

Query: 240 KLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAE 61
           +L ++     ++   +++  W +E+ G+LL  +  KD+   ++L K+H  L  D+ +H +
Sbjct: 396 QLAQSRDITTFHNESKELIAWCNEMNGKLLDTELAKDVAGSEDLLKRHGDLLQDIQAHGD 455

Query: 60  RIDAIREPG 34
           +   + + G
Sbjct: 456 KFTKLTKLG 464



 Score = 34.7 bits (76), Expect = 1.7
 Identities = 13/50 (26%), Positives = 29/50 (58%)
 Frame = -1

Query: 437  LNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEEL 288
            +  +++KH+ FE+ L   + + + +   G +L+E  HF  P I  +++E+
Sbjct: 1388 VEAQIKKHEAFEKILATQEEKTNTLQVFGSQLMEEGHFDAPGIQEKLKEV 1437



 Score = 33.5 bits (73), Expect = 3.9
 Identities = 17/65 (26%), Positives = 31/65 (47%)
 Frame = -3

Query: 240  KLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAE 61
            +L  A + Q+Y     + E W+ E     +  DYGKD  + + +  K+  LE ++  +  
Sbjct: 924  QLDMAFEAQKYYSEAAEAESWMIEKLSLAMITDYGKDEDATEKMLAKNKALELNIEHYNS 983

Query: 60   RIDAI 46
             I A+
Sbjct: 984  VIRAL 988


>UniRef50_Q9NRC6 Cluster: Spectrin beta chain, brain 4; n=25;
            Eutheria|Rep: Spectrin beta chain, brain 4 - Homo sapiens
            (Human)
          Length = 3674

 Score = 57.2 bits (132), Expect = 3e-07
 Identities = 31/87 (35%), Positives = 46/87 (52%)
 Frame = -1

Query: 488  RES*KFATDDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQI 309
            RE    A ++  LD   L  ++QK QNF+ EL A+  +  E+   G+RLL+  H A   I
Sbjct: 2699 REKNLVALEEGLLDTAMLPAQLQKQQNFQAELDASMHQQQELQREGQRLLQGGHPASEAI 2758

Query: 308  SSRVEELGGIWERLVQSSS*RETSCRK 228
              R+EELG +W  L  +S  +    +K
Sbjct: 2759 QERLEELGALWGELQDNSQKKVAKLQK 2785



 Score = 56.4 bits (130), Expect = 5e-07
 Identities = 27/68 (39%), Positives = 46/68 (67%)
 Frame = -3

Query: 249  KGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSS 70
            +G++LQ+A QQ+Q  R ++D +  L ++EG L S + G+DL S Q LQK+H  LE++  +
Sbjct: 1411 RGDELQQAGQQEQLLRQLQDAKEQLEQLEGALQSSETGQDLRSSQRLQKRHQQLESESRT 1470

Query: 69   HAERIDAI 46
             A ++ A+
Sbjct: 1471 LAAKMAAL 1478



 Score = 45.2 bits (102), Expect = 0.001
 Identities = 26/78 (33%), Positives = 43/78 (55%), Gaps = 1/78 (1%)
 Frame = -3

Query: 237 LQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSH-AE 61
           L++  Q+ ++ R  E+ E WL E   ++ +   G+DL+ +    +KH  LEA+V  H A 
Sbjct: 635 LEQTLQRAEFLRNCEEEEAWLKECGQRVGNAALGRDLSQIAGALQKHKALEAEVHRHQAV 694

Query: 60  RIDAIREPGRASS*KREP 7
            +D +R  GR  S +R P
Sbjct: 695 CVDLVRR-GRDLSARRPP 711



 Score = 43.2 bits (97), Expect = 0.005
 Identities = 24/70 (34%), Positives = 36/70 (51%)
 Frame = -3

Query: 240  KLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAE 61
            +LQ+A + Q +  +VE +E WL   E  L SE     L  ++ L  KH +LE D+   A 
Sbjct: 2571 QLQQALELQLFLSSVEKMERWLCSKEDSLASEGLWDPLAPMEPLLWKHKMLEWDLEVQAG 2630

Query: 60   RIDAIREPGR 31
            +I A+    R
Sbjct: 2631 KISALEATAR 2640



 Score = 41.5 bits (93), Expect = 0.015
 Identities = 23/73 (31%), Positives = 39/73 (53%), Gaps = 1/73 (1%)
 Frame = -3

Query: 255  ELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADV 76
            E +G+ LQE  Q  Q  R    ++ WL+       S+DYG+DL  V+ L++K      +V
Sbjct: 3095 EARGHGLQEQLQLHQLERETLLLDAWLTTKAATAESQDYGQDLEGVKVLEEKFDAFRKEV 3154

Query: 75   SSHAE-RIDAIRE 40
             S  + ++ A+R+
Sbjct: 3155 QSLGQAKVYALRK 3167



 Score = 40.7 bits (91), Expect = 0.026
 Identities = 20/61 (32%), Positives = 32/61 (52%)
 Frame = -3

Query: 255  ELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADV 76
            E +   LQ+A   QQY   V ++E W+ E    + S DYG+D  +   L  KH  L+ ++
Sbjct: 1616 EARAQCLQQAVTFQQYFLDVSELEGWVEEKRPLVSSRDYGRDEAATLRLINKHQALQEEL 1675

Query: 75   S 73
            +
Sbjct: 1676 A 1676



 Score = 40.3 bits (90), Expect = 0.034
 Identities = 23/71 (32%), Positives = 41/71 (57%), Gaps = 1/71 (1%)
 Frame = -3

Query: 240  KLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAE 61
            +L+ A +    +R ++++   + E E  + + D GKDL SVQ L +KH  LE +V     
Sbjct: 2359 QLEGALEIHVLSRELDNVTKRIQEKEALIQALDCGKDLESVQRLLRKHEELEREVHPIQA 2418

Query: 60   RIDAI-REPGR 31
            +++++ RE GR
Sbjct: 2419 QVESLEREVGR 2429



 Score = 39.9 bits (89), Expect = 0.045
 Identities = 25/77 (32%), Positives = 41/77 (53%)
 Frame = -3

Query: 240  KLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAE 61
            KLQ+A +  +  R++E++E WL  +E +L +   G+ L  V  L      LEA V   A 
Sbjct: 2782 KLQKACEALRLRRSMEELENWLEPIEVELRAPTVGQALPGVGELLGTQRELEAAVDKKAR 2841

Query: 60   RIDAIREPGRASS*KRE 10
            + +A+   G+A +  RE
Sbjct: 2842 QAEALL--GQAQAFVRE 2856



 Score = 39.5 bits (88), Expect = 0.060
 Identities = 22/76 (28%), Positives = 35/76 (46%)
 Frame = -3

Query: 249 KGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSS 70
           +G +LQ A    QY     +   WL E    L     G+D  + + L ++H  LE  + +
Sbjct: 737 RGARLQTALLVLQYFADAAEAASWLRERRSSLERASCGQDQAAAETLLRRHVRLERVLRA 796

Query: 69  HAERIDAIREPGRASS 22
            A  +  + E GRA+S
Sbjct: 797 FAAELRRLEEQGRAAS 812



 Score = 39.1 bits (87), Expect = 0.079
 Identities = 16/49 (32%), Positives = 33/49 (67%)
 Frame = -3

Query: 213  QYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSH 67
            ++ R  ++   W+ E      ++DYG+ L++V++LQ++H  LE+++SSH
Sbjct: 2897 KFFRDADEEMAWVQEKLPLAAAQDYGQSLSAVRHLQEQHQNLESEMSSH 2945



 Score = 37.9 bits (84), Expect = 0.18
 Identities = 20/65 (30%), Positives = 35/65 (53%)
 Frame = -3

Query: 252  LKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVS 73
            L+  +  E+   Q+  + +E  E WL+  EG LL  DYG  ++ V+ L  +H  LE  ++
Sbjct: 3411 LRWQRCAESWGLQKLRQRLEQAEAWLACWEGLLLKPDYGHSVSDVELLLHRHQDLEKLLA 3470

Query: 72   SHAER 58
            +  E+
Sbjct: 3471 AQEEK 3475



 Score = 36.7 bits (81), Expect = 0.42
 Identities = 13/45 (28%), Positives = 29/45 (64%)
 Frame = -1

Query: 422  QKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEEL 288
            ++HQN E E+ +++     +   G +L++  HFA  ++++RV++L
Sbjct: 2933 EQHQNLESEMSSHEALTRVVLGTGYKLVQAGHFAAHEVAARVQQL 2977



 Score = 36.3 bits (80), Expect = 0.56
 Identities = 18/58 (31%), Positives = 30/58 (51%)
 Frame = -1

Query: 440  NLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEELGGIWERL 267
            N+   +++H+  E EL A +  V+ +  VG+ LL      Q  I +R++ L   WE L
Sbjct: 1347 NILQTLKRHEAAESELLATRRHVEALQQVGRELLSRRPCGQEDIQTRLQGLRSKWEAL 1404



 Score = 34.7 bits (76), Expect = 1.7
 Identities = 19/76 (25%), Positives = 40/76 (52%), Gaps = 1/76 (1%)
 Frame = -3

Query: 252  LKGNKLQEAAQQQQYNRAVEDIEL-WLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADV 76
            ++G +LQ + +  Q+   + ++EL W++E         Y + L   Q+L +KH  L+ +V
Sbjct: 1511 IRGLQLQASVELHQFCH-LSNMELSWVAEHMPHGSPTSYTECLNGAQSLHRKHKELQVEV 1569

Query: 75   SSHAERIDAIREPGRA 28
             +H  ++  +   GR+
Sbjct: 1570 KAHQGQVQRVLSSGRS 1585



 Score = 34.7 bits (76), Expect = 1.7
 Identities = 20/79 (25%), Positives = 39/79 (49%)
 Frame = -3

Query: 237  LQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAER 58
            LQ+A + QQ+   + +   WL+E    L SED G    + Q L ++    + D+ + + R
Sbjct: 2995 LQQAQEAQQFLTELLEAGSWLAERGHVLDSEDMGHSAEATQALLRRLEATKRDLEAFSPR 3054

Query: 57   IDAIREPGRASS*KREPLS 1
            I+ +++       ++ P S
Sbjct: 3055 IERLQQTAALLESRKNPES 3073



 Score = 33.9 bits (74), Expect = 3.0
 Identities = 14/53 (26%), Positives = 30/53 (56%)
 Frame = -1

Query: 425  VQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEELGGIWERL 267
            +Q+H+ F + L    PR + + A G++L++ +H A   +  +++ +   W RL
Sbjct: 1247 LQQHREFGRLLSTLGPRAEALRAHGEKLVQSQHPAAHTVREQLQSIQAQWTRL 1299



 Score = 33.1 bits (72), Expect = 5.2
 Identities = 22/73 (30%), Positives = 35/73 (47%), Gaps = 2/73 (2%)
 Frame = -3

Query: 252 LKGNKLQEAAQQQQYN--RAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEAD 79
           L+G + Q A  Q   +  + VE     L E++    S   G+ L  V  L ++H LLEA 
Sbjct: 522 LQGQRKQVADMQAVLSLLQEVEAASHQLEELQEPARSTACGQQLAEVVELLQRHDLLEAQ 581

Query: 78  VSSHAERIDAIRE 40
           VS+H   +  + +
Sbjct: 582 VSAHGAHVSHLAQ 594


>UniRef50_Q01082 Cluster: Spectrin beta chain, brain 1; n=168;
            Euteleostomi|Rep: Spectrin beta chain, brain 1 - Homo
            sapiens (Human)
          Length = 2364

 Score = 56.4 bits (130), Expect = 5e-07
 Identities = 26/78 (33%), Positives = 46/78 (58%)
 Frame = -3

Query: 255  ELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADV 76
            + K  +L +A + + + ++  D++ WL  +E Q+ S+DYGKDLTSV  L KK  +LE  +
Sbjct: 1370 QTKAQRLFDANKAELFTQSCADLDKWLHGLESQIQSDDYGKDLTSVNILLKKQQMLENQM 1429

Query: 75   SSHAERIDAIREPGRASS 22
                + I+ ++   +A S
Sbjct: 1430 EVRKKEIEELQSQAQALS 1447



 Score = 54.4 bits (125), Expect = 2e-06
 Identities = 27/76 (35%), Positives = 43/76 (56%)
 Frame = -3

Query: 255  ELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADV 76
            E +  +L+EA + QQY     + E W+SE E  ++SE+  KD  S  ++ KKH +LE  V
Sbjct: 1582 EKRHRRLEEAHRAQQYYFDAAEAEAWMSEQELYMMSEEKAKDEQSAVSMLKKHQILEQAV 1641

Query: 75   SSHAERIDAIREPGRA 28
              +AE +  + +  RA
Sbjct: 1642 EDYAETVHQLSKTSRA 1657



 Score = 50.0 bits (114), Expect = 4e-05
 Identities = 20/45 (44%), Positives = 32/45 (71%)
 Frame = -3

Query: 180 WLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAERIDAI 46
           W+ E++  +LS+DYGK L  V++L +KH L+EAD+   AER+  +
Sbjct: 543 WMDEMKVLVLSQDYGKHLLGVEDLLQKHTLVEADIGIQAERVRGV 587



 Score = 48.0 bits (109), Expect = 2e-04
 Identities = 26/68 (38%), Positives = 38/68 (55%)
 Frame = -3

Query: 243  NKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHA 64
            + L  + +  Q+NR VED  LW+ E      S D+G +L +VQ L KK+  L+ ++  H 
Sbjct: 1479 HNLLASKEIHQFNRDVEDEILWVGERMPLATSTDHGHNLQTVQLLIKKNQTLQKEIQGHQ 1538

Query: 63   ERIDAIRE 40
             RID I E
Sbjct: 1539 PRIDDIFE 1546



 Score = 46.8 bits (106), Expect = 4e-04
 Identities = 21/69 (30%), Positives = 43/69 (62%)
 Frame = -3

Query: 252 LKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVS 73
           ++  KL++ A++  ++R     E WLSE +  +  +++G DL +V+   KKH  +E D++
Sbjct: 415 IRQEKLEQLARR--FDRKAAMRETWLSENQRLVSQDNFGFDLPAVEAATKKHEAIETDIA 472

Query: 72  SHAERIDAI 46
           ++ ER+ A+
Sbjct: 473 AYEERVQAV 481



 Score = 46.4 bits (105), Expect = 5e-04
 Identities = 25/68 (36%), Positives = 40/68 (58%), Gaps = 1/68 (1%)
 Frame = -3

Query: 240 KLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAE 61
           +L+E+ +  ++   + + E W+ E E  L S+DYGKDLTSV  L  KH   E ++S  + 
Sbjct: 633 RLEESRRLWKFFWEMAEEEGWIREKEKILSSDDYGKDLTSVMRLLSKHRAFEDEMSGRSG 692

Query: 60  RID-AIRE 40
             + AI+E
Sbjct: 693 HFEQAIKE 700



 Score = 45.6 bits (103), Expect = 0.001
 Identities = 20/75 (26%), Positives = 41/75 (54%)
 Frame = -3

Query: 252 LKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVS 73
           ++  +L+EA+   Q+    +DI+ W+ ++   + S D G D  S Q+L KKH  +  +++
Sbjct: 735 IRKKRLEEASLLHQFQADADDIDAWMLDILKIVSSSDVGHDEYSTQSLVKKHKDVAEEIA 794

Query: 72  SHAERIDAIREPGRA 28
           ++   +D + E   A
Sbjct: 795 NYRPTLDTLHEQASA 809



 Score = 44.8 bits (101), Expect = 0.002
 Identities = 20/68 (29%), Positives = 38/68 (55%)
 Frame = -3

Query: 237  LQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAER 58
            L EA++ QQ+ R ++D + WLS  +  + SED    LT  + L  +H  ++ ++ ++ E 
Sbjct: 1058 LGEASKLQQFLRDLDDFQSWLSRTQTAIASEDMPNTLTEAEKLLTQHENIKNEIDNYEED 1117

Query: 57   IDAIREPG 34
               +R+ G
Sbjct: 1118 YQKMRDMG 1125



 Score = 41.1 bits (92), Expect = 0.020
 Identities = 27/94 (28%), Positives = 44/94 (46%), Gaps = 1/94 (1%)
 Frame = -1

Query: 488 RES*KFATDDSY-LDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQ 312
           RE  K  + D Y  D T++   + KH+ FE E+       ++    G+ ++  EHF   +
Sbjct: 655 REKEKILSSDDYGKDLTSVMRLLSKHRAFEDEMSGRSGHFEQAIKEGEDMIAEEHFGSEK 714

Query: 311 ISSRVEELGGIWERLVQSSS*RETSCRKRLNNSS 210
           I  R+  +   W  L Q S+ R    +KRL  +S
Sbjct: 715 IRERIIYIREQWANLEQLSAIR----KKRLEEAS 744



 Score = 41.1 bits (92), Expect = 0.020
 Identities = 23/68 (33%), Positives = 36/68 (52%)
 Frame = -1

Query: 470  ATDDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEE 291
            A D SY +  NL+ K  KHQ F  EL +NK  +D+I   G +L+  +   +  +  ++  
Sbjct: 1298 AQDMSYDEARNLHSKWLKHQAFMAELASNKEWLDKIEKEGMQLISEKPETEAVVKEKLTG 1357

Query: 290  LGGIWERL 267
            L  +WE L
Sbjct: 1358 LHKMWEVL 1365



 Score = 39.1 bits (87), Expect = 0.079
 Identities = 23/71 (32%), Positives = 36/71 (50%), Gaps = 1/71 (1%)
 Frame = -3

Query: 255  ELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADV 76
            E +  KL E  +  Q NR V+D+E W++E E    S + G+D   V  LQ++      D 
Sbjct: 1688 EERRGKLDERHRLFQLNREVDDLEQWIAEREVVAGSHELGQDYEHVTMLQERFREFARDT 1747

Query: 75   SS-HAERIDAI 46
             +   ER+D +
Sbjct: 1748 GNIGQERVDTV 1758



 Score = 34.3 bits (75), Expect = 2.3
 Identities = 17/56 (30%), Positives = 27/56 (48%)
 Frame = -3

Query: 213  QYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAERIDAI 46
            Q++R     E WL   E  L S + G+ +  V+ L K+H   E   ++  ER  A+
Sbjct: 2021 QFSRDASVAEAWLLGQEPYLSSREIGQSVDEVEKLIKRHEAFEKSAATWDERFSAL 2076



 Score = 33.5 bits (73), Expect = 3.9
 Identities = 14/61 (22%), Positives = 35/61 (57%), Gaps = 1/61 (1%)
 Frame = -1

Query: 425  VQKHQNFEQELQANKPRVDEITAVGKRLL-ELEHFAQPQISSRVEELGGIWERLVQSSS* 249
            ++K+Q  ++E+Q ++PR+D+I    + ++ +    +   I  R+ +L  +W  L++ +  
Sbjct: 1524 IKKNQTLQKEIQGHQPRIDDIFERSQNIVTDSSSLSAEAIRQRLADLKQLWGLLIEETEK 1583

Query: 248  R 246
            R
Sbjct: 1584 R 1584


>UniRef50_Q4SRS6 Cluster: Chromosome undetermined SCAF14494, whole
            genome shotgun sequence; n=2; Euteleostomi|Rep:
            Chromosome undetermined SCAF14494, whole genome shotgun
            sequence - Tetraodon nigroviridis (Green puffer)
          Length = 2275

 Score = 55.2 bits (127), Expect = 1e-06
 Identities = 25/78 (32%), Positives = 45/78 (57%)
 Frame = -3

Query: 255  ELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADV 76
            + K   L +A + + + ++  D++ WL  +E QL S++YGKDLTSV  L KK  +LE+ V
Sbjct: 1502 QTKAKCLFDANKAELFTQSCADLDKWLGSLEAQLQSDEYGKDLTSVNILLKKQQILESQV 1561

Query: 75   SSHAERIDAIREPGRASS 22
                + ++ ++   +  S
Sbjct: 1562 EVRQKEVEELQNQSQVLS 1579



 Score = 51.2 bits (117), Expect = 2e-05
 Identities = 21/42 (50%), Positives = 32/42 (76%)
 Frame = -3

Query: 180 WLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAERI 55
           W+ E++  LLS+DYGK L  V++L +KHAL+EAD+   A+R+
Sbjct: 639 WMDEMKMLLLSQDYGKHLLGVEDLLQKHALVEADIGIQADRV 680



 Score = 50.4 bits (115), Expect = 3e-05
 Identities = 25/75 (33%), Positives = 42/75 (56%)
 Frame = -3

Query: 252  LKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVS 73
            ++ ++LQEA  + Q+    +DI+ W+ ++   + S D G D  S Q L KKH  +  ++ 
Sbjct: 831  VRKSRLQEACNKHQFQADADDIDTWMLDILRIVSSVDVGHDEFSTQALVKKHKDVAEEMG 890

Query: 72   SHAERIDAIREPGRA 28
            S+   IDA+ E  RA
Sbjct: 891  SYRPVIDALHEQSRA 905



 Score = 46.8 bits (106), Expect = 4e-04
 Identities = 21/69 (30%), Positives = 43/69 (62%)
 Frame = -3

Query: 252 LKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVS 73
           ++  KL++ A++  ++R     E WLSE +  +  +++G DL +V+   KKH  +E D++
Sbjct: 511 IRQEKLEQLARR--FDRKAAMRETWLSENQRLVSQDNFGCDLQAVEAATKKHEAIETDIA 568

Query: 72  SHAERIDAI 46
           ++ ER+ A+
Sbjct: 569 AYEERVQAV 577



 Score = 41.9 bits (94), Expect = 0.011
 Identities = 19/68 (27%), Positives = 37/68 (54%)
 Frame = -3

Query: 237  LQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAER 58
            L EA++ QQ+ R ++D + WLS  +  + SED    L   + L  +H  ++ ++ ++ E 
Sbjct: 1154 LGEASKLQQFLRDLDDFQSWLSRTQTAIASEDMPNTLAEAEKLLAQHEGIKNEIRNYEED 1213

Query: 57   IDAIREPG 34
               +R+ G
Sbjct: 1214 YQKMRDMG 1221



 Score = 41.5 bits (93), Expect = 0.015
 Identities = 25/71 (35%), Positives = 38/71 (53%), Gaps = 3/71 (4%)
 Frame = -3

Query: 243  NKLQEAAQQQQYNRAVED---IELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVS 73
            + L  + +  Q+NR VED     LW+ E     +S D+G +L +VQ L KK+  L+ ++ 
Sbjct: 1611 DNLMVSREIHQFNRDVEDEIVSLLWVEERLPVAMSTDHGHNLQTVQLLIKKNQTLQKEIQ 1670

Query: 72   SHAERIDAIRE 40
             H  R D I E
Sbjct: 1671 GHQPRYDDIFE 1681



 Score = 41.1 bits (92), Expect = 0.020
 Identities = 21/59 (35%), Positives = 34/59 (57%)
 Frame = -3

Query: 240 KLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHA 64
           +L+E+ +  ++   + + E W+ E E  L SED+GKDLT    L  +H  LE ++S  A
Sbjct: 729 RLEESRRLWKFFWEMAEEEGWIREKEQILSSEDHGKDLTGALRLLSQHKALEDEMSGRA 787



 Score = 40.7 bits (91), Expect = 0.026
 Identities = 24/79 (30%), Positives = 41/79 (51%)
 Frame = -1

Query: 470  ATDDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEE 291
            A D +Y +  NL+ K  KHQ F  ELQ+NK  +D+I   G+ L+  +   +  +  ++  
Sbjct: 1430 AQDMTYDEARNLHSKWLKHQAFMAELQSNKEWLDKIDKDGQTLMLEKPDTEAMVQEKLAW 1489

Query: 290  LGGIWERLVQSSS*RETSC 234
            L   W  L +S++  +  C
Sbjct: 1490 LKSTWAEL-ESTTQTKAKC 1507



 Score = 40.7 bits (91), Expect = 0.026
 Identities = 24/71 (33%), Positives = 37/71 (52%), Gaps = 1/71 (1%)
 Frame = -3

Query: 255  ELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADV 76
            E +  KL E  +  Q NR V+D+E W++E E    S + G+D   V  LQ++      D 
Sbjct: 1844 EERRGKLDERFRLFQLNREVDDLEQWIAEREVVAGSHELGQDYEHVTMLQERFREFARDT 1903

Query: 75   SS-HAERIDAI 46
             +   ER+DA+
Sbjct: 1904 GTIGQERVDAV 1914



 Score = 37.5 bits (83), Expect = 0.24
 Identities = 16/60 (26%), Positives = 34/60 (56%)
 Frame = -1

Query: 425  VQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEELGGIWERLVQSSS*R 246
            ++K+Q  ++E+Q ++PR D+I    + +L  +      I  R+ EL  +W+R+ + +  R
Sbjct: 1659 IKKNQTLQKEIQGHQPRYDDIFERSQHVLREDGPTAQLIGQRLAELTSLWQRIGEEAEKR 1718



 Score = 34.3 bits (75), Expect = 2.3
 Identities = 18/64 (28%), Positives = 30/64 (46%)
 Frame = -3

Query: 237  LQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAER 58
            L+   +  Q++R     E WL   E  L S + G++   V+ L K+H   E   ++  ER
Sbjct: 2197 LRLVLEVHQFSRDASVAESWLLGQEPYLSSREVGQNADEVEKLIKRHEAFEKSAATWEER 2256

Query: 57   IDAI 46
              A+
Sbjct: 2257 FSAL 2260


>UniRef50_Q00963 Cluster: Spectrin beta chain; n=16; Bilateria|Rep:
            Spectrin beta chain - Drosophila melanogaster (Fruit fly)
          Length = 2291

 Score = 54.8 bits (126), Expect = 1e-06
 Identities = 31/78 (39%), Positives = 41/78 (52%)
 Frame = -3

Query: 255  ELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADV 76
            E +   L E+ + QQY    ++ E W+SE E  ++ ED GKD  S QNL KKH  LE  V
Sbjct: 1583 ENRRKHLLESEKVQQYFFDAQEAESWMSEQELYMMVEDRGKDEISAQNLMKKHENLEQSV 1642

Query: 75   SSHAERIDAIREPGRASS 22
              +A  I  + E  R  S
Sbjct: 1643 EDYANTIRQLGEVARQFS 1660



 Score = 48.8 bits (111), Expect = 1e-04
 Identities = 26/69 (37%), Positives = 39/69 (56%)
 Frame = -3

Query: 237  LQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAER 58
            L++  +  Q+ R VED +LW+ E      S DYG  L +V  L+KK+  L  ++ +H  R
Sbjct: 1483 LEKKKEAFQFCRDVEDEKLWIDEKLPVANSPDYGNSLFNVHVLKKKNQSLATEIDNHEPR 1542

Query: 57   IDAIREPGR 31
            I+AI   GR
Sbjct: 1543 INAICNNGR 1551



 Score = 48.0 bits (109), Expect = 2e-04
 Identities = 25/86 (29%), Positives = 46/86 (53%)
 Frame = -1

Query: 470 ATDDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEE 291
           +TD+   D T +N  + KH+  E E+ ++ P++  +  VG  L+   HF   +I  R++E
Sbjct: 659 STDEVGHDLTTVNLMLSKHKALESEITSHDPQLQNVAKVGSELITEGHFGADRIKDRLKE 718

Query: 290 LGGIWERLVQSSS*RETSCRKRLNNS 213
           +   W+ L+  +  R    R+RL N+
Sbjct: 719 ILNKWDHLLDLTKYR----RQRLENA 740



 Score = 45.6 bits (103), Expect = 0.001
 Identities = 21/69 (30%), Positives = 41/69 (59%)
 Frame = -3

Query: 252 LKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVS 73
           ++  KL++ A +  ++R     E WLSE +  +  +++G DL +V+   KKH  +E D+ 
Sbjct: 411 IRQEKLEQLAAR--FDRKASMRETWLSENQRLVSQDNFGFDLAAVEAAAKKHEAIETDIF 468

Query: 72  SHAERIDAI 46
           ++ ER+ A+
Sbjct: 469 AYEERVQAV 477



 Score = 44.8 bits (101), Expect = 0.002
 Identities = 22/65 (33%), Positives = 42/65 (64%)
 Frame = -3

Query: 240 KLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAE 61
           +L+ + Q QQ  + +  I   + E++  L+++DYGK L  V++L +KH+L+EAD++   E
Sbjct: 519 RLEISLQLQQNFQEMLYILDNMEEIKQLLMTDDYGKHLMGVEDLLQKHSLVEADINILGE 578

Query: 60  RIDAI 46
           R+  +
Sbjct: 579 RVKVV 583



 Score = 44.8 bits (101), Expect = 0.002
 Identities = 20/70 (28%), Positives = 41/70 (58%)
 Frame = -3

Query: 243 NKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHA 64
           ++L+E+ +  Q+     D E W+ E E  + +++ G DLT+V  +  KH  LE++++SH 
Sbjct: 629 SRLEESRKLWQFYWDTADEENWIKEKEQIVSTDEVGHDLTTVNLMLSKHKALESEITSHD 688

Query: 63  ERIDAIREPG 34
            ++  + + G
Sbjct: 689 PQLQNVAKVG 698



 Score = 44.4 bits (100), Expect = 0.002
 Identities = 21/67 (31%), Positives = 40/67 (59%)
 Frame = -3

Query: 240 KLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAE 61
           +L+ A +  Q     +D++ W+ +    + SED G+D  +VQ+L KKH  +  ++ ++AE
Sbjct: 736 RLENAVEYFQLFADADDVDNWMLDTLRIVSSEDVGRDEANVQSLLKKHKDVADELKNYAE 795

Query: 60  RIDAIRE 40
            IDA+ +
Sbjct: 796 VIDALHK 802



 Score = 41.9 bits (94), Expect = 0.011
 Identities = 19/68 (27%), Positives = 41/68 (60%)
 Frame = -3

Query: 249  KGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSS 70
            KG  L +A ++    +  +DI+ +++++E Q++S D   DLTSV  L +K  +++  ++ 
Sbjct: 1372 KGAMLFDANREVLVQQTCDDIDSYITDLEKQIVSGDTANDLTSVNILMQKQQVIQTQMAV 1431

Query: 69   HAERIDAI 46
             A +++ I
Sbjct: 1432 KARQVEEI 1439



 Score = 41.9 bits (94), Expect = 0.011
 Identities = 23/71 (32%), Positives = 33/71 (46%)
 Frame = -3

Query: 258  FELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEAD 79
            +E +   LQ   +  Q+ R     E WL   E  LLS + G  +  V+NL KKH   E  
Sbjct: 2007 WEERWENLQLILEVYQFARDAAVAEAWLIAQEPYLLSSELGHTIDEVENLIKKHEAFEKS 2066

Query: 78   VSSHAERIDAI 46
             ++  ER  A+
Sbjct: 2067 AAAQEERFSAL 2077



 Score = 37.5 bits (83), Expect = 0.24
 Identities = 16/72 (22%), Positives = 36/72 (50%)
 Frame = -3

Query: 249  KGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSS 70
            + +KL+EA    ++ R ++  + WL++ +  + SED    L   + L  +H  +  ++ +
Sbjct: 1051 RDSKLEEAGDLHRFLRDLDHFQTWLTKTQTDVASEDTPTSLPEAEKLLNQHQSIREEIDN 1110

Query: 69   HAERIDAIREPG 34
            + E    + E G
Sbjct: 1111 YTEDYKNMMEYG 1122



 Score = 36.7 bits (81), Expect = 0.42
 Identities = 15/61 (24%), Positives = 33/61 (54%)
 Frame = -1

Query: 464  DDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEELG 285
            DD+ ++      ++++H+ F   ++AN  +++ +  V   L+E +HF   +I  R E + 
Sbjct: 1195 DDTPVNLEQAENQLKRHEAFLTTMEANDDKINTLLQVADTLVEKDHFDADKIGKRAENIT 1254

Query: 284  G 282
            G
Sbjct: 1255 G 1255



 Score = 35.5 bits (78), Expect = 0.97
 Identities = 21/65 (32%), Positives = 35/65 (53%), Gaps = 2/65 (3%)
 Frame = -1

Query: 476  KFAT--DDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISS 303
            K+AT  D+SY     ++ K  +HQ FE E+ ANK R+ E     + L + +   +  I  
Sbjct: 1294 KYATSQDESYRSAKTIHSKWTRHQAFEAEIAANKERLFEAEKSAQELSKEKPEFKDVIEP 1353

Query: 302  RVEEL 288
            +++EL
Sbjct: 1354 KLKEL 1358



 Score = 32.3 bits (70), Expect = 9.1
 Identities = 16/64 (25%), Positives = 32/64 (50%)
 Frame = -3

Query: 237  LQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAER 58
            L ++  QQ +NR     E+ LS+ E  L  +D   +L   +N  K+H      + ++ ++
Sbjct: 1165 LSQSLDQQLFNRDARQTEVLLSQQEHFLSKDDTPVNLEQAENQLKRHEAFLTTMEANDDK 1224

Query: 57   IDAI 46
            I+ +
Sbjct: 1225 INTL 1228


>UniRef50_UPI0000E25477 Cluster: PREDICTED: similar to beta V
           spectrin, partial; n=1; Pan troglodytes|Rep: PREDICTED:
           similar to beta V spectrin, partial - Pan troglodytes
          Length = 589

 Score = 54.4 bits (125), Expect = 2e-06
 Identities = 27/68 (39%), Positives = 45/68 (66%)
 Frame = -3

Query: 249 KGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSS 70
           +G++LQ+A QQ+Q  R ++D +  L ++EG L S + G+DL S Q LQK H  LE++  +
Sbjct: 64  RGDELQQAGQQEQLLRQLQDAKEQLEQLEGALQSSETGQDLRSSQRLQKWHQQLESESRT 123

Query: 69  HAERIDAI 46
            A ++ A+
Sbjct: 124 LAAKMAAL 131



 Score = 40.7 bits (91), Expect = 0.026
 Identities = 20/61 (32%), Positives = 32/61 (52%)
 Frame = -3

Query: 255 ELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADV 76
           E +   LQ+A   QQY   V ++E W+ E    + S DYG+D  +   L  KH  L+ ++
Sbjct: 483 EARAQCLQQAVAFQQYFLDVSELEGWVEEKRPLVSSRDYGRDEAATLRLINKHQALQEEL 542

Query: 75  S 73
           +
Sbjct: 543 A 543



 Score = 39.1 bits (87), Expect = 0.079
 Identities = 19/55 (34%), Positives = 29/55 (52%)
 Frame = -3

Query: 255 ELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHAL 91
           E +   LQ+A   QQY   V ++E W+ E +  + S DYG+D  +   L  KH +
Sbjct: 269 EARAQCLQQAVAFQQYFLDVSELEGWVEEKQPLVSSRDYGRDEAATLRLINKHQI 323



 Score = 35.5 bits (78), Expect = 0.97
 Identities = 17/53 (32%), Positives = 28/53 (52%)
 Frame = -1

Query: 425 VQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEELGGIWERL 267
           +++H+  E EL A +  V+ +  VG+ LL      Q  I +R++ L   WE L
Sbjct: 5   LKRHEAAESELLATRRHVEALQQVGRELLSRRPCGQEDIQTRLQGLRSKWEAL 57


>UniRef50_Q4RFW4 Cluster: Chromosome 16 SCAF15113, whole genome
           shotgun sequence; n=3; Eukaryota|Rep: Chromosome 16
           SCAF15113, whole genome shotgun sequence - Tetraodon
           nigroviridis (Green puffer)
          Length = 1673

 Score = 54.0 bits (124), Expect = 3e-06
 Identities = 21/47 (44%), Positives = 36/47 (76%)
 Frame = -3

Query: 180 WLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAERIDAIRE 40
           W+ + + QLLS+DYGK L  V++L +KH+L EAD++  AER++++ +
Sbjct: 117 WMEDTQVQLLSKDYGKHLLEVEDLLQKHSLQEADIAVQAERVESLNK 163



 Score = 50.4 bits (115), Expect = 3e-05
 Identities = 25/64 (39%), Positives = 36/64 (56%)
 Frame = -3

Query: 222  QQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAERIDAIR 43
            Q QQY     ++E WLSE E  +++E+ GKD  S   L KKH +LE  +  +AE I  + 
Sbjct: 1146 QAQQYFFDTAEVEAWLSEQELHMMNEEKGKDEPSTLQLLKKHLVLEQTIEDYAETIGLLS 1205

Query: 42   EPGR 31
            +  R
Sbjct: 1206 QQCR 1209



 Score = 44.4 bits (100), Expect = 0.002
 Identities = 21/66 (31%), Positives = 36/66 (54%)
 Frame = -3

Query: 237  LQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAER 58
            L  + +  Q  R +ED  LW+ E     +S+++G  L  VQ L KK+ +L+ ++  H  R
Sbjct: 1035 LLASKELHQVRRDLEDEILWIQERLPMAMSQEHGSTLQEVQQLMKKNQMLQRELQGHKGR 1094

Query: 57   IDAIRE 40
            I+ + E
Sbjct: 1095 IEDVLE 1100



 Score = 44.0 bits (99), Expect = 0.003
 Identities = 18/49 (36%), Positives = 32/49 (65%)
 Frame = -3

Query: 186 ELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAERIDAIRE 40
           + WL+E +  +  +++G DL +V+   KKH  +EAD++S+ ERI  + E
Sbjct: 9   QAWLNENQRLVSQDNFGYDLPAVEAAMKKHEAIEADIASYEERIGVVVE 57



 Score = 42.3 bits (95), Expect = 0.008
 Identities = 20/69 (28%), Positives = 38/69 (55%)
 Frame = -3

Query: 237 LQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAER 58
           L+E+ Q   + + +E+ + W+ E    L ++ +GKDLTSV  L +KH  L  ++ +H   
Sbjct: 207 LEESRQLWAFLQELEESDAWIREKSSILGAQGFGKDLTSVLKLLQKHKTLAGELLAHRSL 266

Query: 57  IDAIREPGR 31
           +    + G+
Sbjct: 267 LQNTIKQGK 275



 Score = 41.9 bits (94), Expect = 0.011
 Identities = 20/48 (41%), Positives = 29/48 (60%)
 Frame = -3

Query: 237 LQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHA 94
           LQEA    Q++  ++D+  WL +    + SED+G D  S Q+L KKHA
Sbjct: 313 LQEALNFFQFSTEMDDLVAWLQDAYRLVSSEDFGHDEYSTQSLLKKHA 360



 Score = 40.3 bits (90), Expect = 0.034
 Identities = 22/68 (32%), Positives = 36/68 (52%)
 Frame = -1

Query: 470  ATDDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEE 291
            A D S  +   L+ K  KHQ F  EL  NK  +D+I   G++L++ +    P +  ++EE
Sbjct: 852  ARDGSRDESQKLHKKWLKHQAFMAELAQNKDWLDKIEKEGQQLMQEKPELSPVVRRKLEE 911

Query: 290  LGGIWERL 267
            +   W+ L
Sbjct: 912  IRDCWQDL 919



 Score = 36.3 bits (80), Expect = 0.56
 Identities = 20/73 (27%), Positives = 37/73 (50%), Gaps = 1/73 (1%)
 Frame = -3

Query: 255  ELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADV 76
            E + ++L++     Q NR V+++E W+++ E    S + G+D   V  LQ K      + 
Sbjct: 1241 EERKSRLEQQYWLYQLNREVDELEQWIAQKEVVASSPELGQDFEHVTVLQDKFTKFATET 1300

Query: 75   SS-HAERIDAIRE 40
             S   ER+ A+ +
Sbjct: 1301 GSVGQERVTAVNQ 1313



 Score = 35.1 bits (77), Expect = 1.3
 Identities = 21/77 (27%), Positives = 36/77 (46%)
 Frame = -1

Query: 449 DPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEELGGIWER 270
           D T++   +QKH+    EL A++  +      GK++L  + F    I   + EL   W+R
Sbjct: 242 DLTSVLKLLQKHKTLAGELLAHRSLLQNTIKQGKQILSEKSFGTTGIQEHILELKNQWKR 301

Query: 269 LVQSSS*RETSCRKRLN 219
           L   +  R    ++ LN
Sbjct: 302 LEDQAGQRLGHLQEALN 318


>UniRef50_Q86FK0 Cluster: Antigen; n=1; Taenia solium|Rep: Antigen -
           Taenia solium (Pork tapeworm)
          Length = 420

 Score = 54.0 bits (124), Expect = 3e-06
 Identities = 29/76 (38%), Positives = 42/76 (55%)
 Frame = -3

Query: 243 NKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHA 64
           NKL EA + Q++ R  +    WL+E    L  ED G+DL SVQ LQ+KH  LE D+ +  
Sbjct: 262 NKLYEAHEIQRFFRETDKAISWLNEKSIPLAIEDCGRDLVSVQALQRKHEALERDLGTLE 321

Query: 63  ERIDAIREPGRASS*K 16
           +++  +     A S K
Sbjct: 322 DKVSQLTTDAEALSEK 337



 Score = 52.8 bits (121), Expect = 6e-06
 Identities = 24/69 (34%), Positives = 44/69 (63%)
 Frame = -3

Query: 240 KLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAE 61
           +L++A + Q + R  +++E W+ E       EDY KDLT++Q+ ++KH  LE +V++H E
Sbjct: 52  RLEDAKRYQYFKRDADELENWIQEKLQTYSGEDY-KDLTNLQSKKQKHQALELEVNAHFE 110

Query: 60  RIDAIREPG 34
            ++A+   G
Sbjct: 111 TLNALDASG 119



 Score = 51.2 bits (117), Expect = 2e-05
 Identities = 23/66 (34%), Positives = 38/66 (57%)
 Frame = -1

Query: 461 DSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEELGG 282
           + Y D TNL  K QKHQ  E E+ A+   ++ + A G+ ++   H+A   I   ++EL  
Sbjct: 83  EDYKDLTNLQSKKQKHQALELEVNAHFETLNALDASGEEMISQHHYASEIIRGILDELHA 142

Query: 281 IWERLV 264
           +WE+L+
Sbjct: 143 LWEKLM 148



 Score = 42.7 bits (96), Expect = 0.006
 Identities = 21/56 (37%), Positives = 32/56 (57%)
 Frame = -3

Query: 264 AVFELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKH 97
           A+F  K   L    +   Y R V++I  W+ E E  + SE++G+DL  V+ LQKK+
Sbjct: 149 AMFMQKARLLNLTLEYVNYLRRVDEILFWIREKETLVTSEEFGQDLEHVEALQKKY 204


>UniRef50_Q4REP5 Cluster: Chromosome 10 SCAF15123, whole genome
            shotgun sequence; n=4; Euteleostomi|Rep: Chromosome 10
            SCAF15123, whole genome shotgun sequence - Tetraodon
            nigroviridis (Green puffer)
          Length = 2235

 Score = 52.0 bits (119), Expect = 1e-05
 Identities = 28/81 (34%), Positives = 45/81 (55%), Gaps = 1/81 (1%)
 Frame = -3

Query: 249  KGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYG-KDLTSVQNLQKKHALLEADVS 73
            K   L +A + + +++++ D++ WL E++ QL S D   KDLTS   L KKH + E  V 
Sbjct: 1389 KARLLFDANRSELFDQSLADVKKWLGELQQQLQSGDEEVKDLTSANILLKKHQMTENQVR 1448

Query: 72   SHAERIDAIREPGRASS*KRE 10
              A  ++ ++E GR     RE
Sbjct: 1449 DRARELEELQEAGRKHGGARE 1469



 Score = 49.6 bits (113), Expect = 6e-05
 Identities = 19/42 (45%), Positives = 32/42 (76%)
 Frame = -3

Query: 180 WLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAERI 55
           W+ +++ +L+S D+GK L  V++L +KHALLE D++  AER+
Sbjct: 560 WMDDMKARLMSPDFGKHLLEVEDLLQKHALLEKDIALQAERV 601



 Score = 47.2 bits (107), Expect = 3e-04
 Identities = 24/68 (35%), Positives = 38/68 (55%)
 Frame = -1

Query: 470  ATDDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEE 291
            A D SY +  NL+ K  KHQ F  EL ANK  + ++   G+ L+E +   +P +  R+ +
Sbjct: 1315 AQDTSYDEARNLHSKWLKHQAFMAELAANKGWLQKVDQQGQALMEAKPEFEPIVRERLAK 1374

Query: 290  LGGIWERL 267
            L  +W+ L
Sbjct: 1375 LHQLWDEL 1382



 Score = 46.8 bits (106), Expect = 4e-04
 Identities = 25/88 (28%), Positives = 45/88 (51%)
 Frame = -3

Query: 303  SRGRAGRNMGATGAVFELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLT 124
            + G  GR   A G   + +G +L  +   QQY    ++ E W+ E E  +++E+  KD  
Sbjct: 1552 AEGAGGRLGPAAGRDVQAQG-RLDGSNLAQQYYNDADEAEAWIWEQELYMIAEEKAKDEQ 1610

Query: 123  SVQNLQKKHALLEADVSSHAERIDAIRE 40
            S   + K+H +L+ DV  +A+ I  + +
Sbjct: 1611 SAMLMLKRHTILKQDVDDYADSIQKLSD 1638



 Score = 44.8 bits (101), Expect = 0.002
 Identities = 20/69 (28%), Positives = 43/69 (62%)
 Frame = -3

Query: 252 LKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVS 73
           ++  KL++ A++  ++R     E WL E +  +  +++G DL++V+  +KKH  +E D++
Sbjct: 432 IRQEKLEQMARR--FDRKAAMRETWLLENQRLVAQDNFGYDLSAVEAAKKKHDAIETDIA 489

Query: 72  SHAERIDAI 46
           +  ER+ A+
Sbjct: 490 AFEERVQAL 498



 Score = 44.8 bits (101), Expect = 0.002
 Identities = 22/70 (31%), Positives = 37/70 (52%)
 Frame = -3

Query: 237 LQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAER 58
           LQ+  +  Q+    +D+  WL E + Q+ S+D G D  + Q L KKH  L+ + + +   
Sbjct: 756 LQDTQRFFQFQGDADDLRAWLLEAKRQMSSDDVGHDEYTTQRLLKKHNGLKNEAAKNGAT 815

Query: 57  IDAIREPGRA 28
           IDA+ +   A
Sbjct: 816 IDALSKQANA 825



 Score = 41.9 bits (94), Expect = 0.011
 Identities = 20/55 (36%), Positives = 31/55 (56%)
 Frame = -3

Query: 198 VEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAERIDAIREPG 34
           V +++ W+ E E    S DYGKDLTSV  LQ KH   E ++++    ++ +   G
Sbjct: 663 VVELDGWIREKEHIFSSLDYGKDLTSVLVLQSKHGAFEDELAARRANLEQVVPEG 717



 Score = 41.5 bits (93), Expect = 0.015
 Identities = 19/77 (24%), Positives = 41/77 (53%)
 Frame = -1

Query: 473 FATDDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVE 294
           F++ D   D T++     KH  FE EL A +  ++++   G+ ++  EH   P++   +E
Sbjct: 677 FSSLDYGKDLTSVLVLQSKHGAFEDELAARRANLEQVVPEGEEMVRSEHLGSPKVQEALE 736

Query: 293 ELGGIWERLVQSSS*RE 243
            +   W++L + ++ R+
Sbjct: 737 NIRRQWQQLEELAAFRK 753



 Score = 39.5 bits (88), Expect = 0.060
 Identities = 21/88 (23%), Positives = 43/88 (48%), Gaps = 1/88 (1%)
 Frame = -3

Query: 300  RGRAGRNMGATGAVFELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLS-EDYGKDLT 124
            + R  +   A  A+ E K  K+  A     Y    ++ + W+ +    + S +D G DL 
Sbjct: 946  QARLNKRWEAFKAMVEDKKRKVDSAVSLNNYGLECDETDAWIRDKTRVIQSTQDLGNDLA 1005

Query: 123  SVQNLQKKHALLEADVSSHAERIDAIRE 40
            +V  +Q+K   +E D+++   ++D +R+
Sbjct: 1006 AVMTIQRKLFGMERDLAAIGAKLDFLRD 1033



 Score = 36.3 bits (80), Expect = 0.56
 Identities = 16/70 (22%), Positives = 34/70 (48%)
 Frame = -3

Query: 243  NKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHA 64
            + L E ++ Q + + ++D + WL + +  + SE+    L   +     H  +  D+S+H 
Sbjct: 1072 DSLGEVSKLQTFLQDMDDFQSWLYKTQKAVASEEIPATLPEAEQQLSLHDAMREDISNHE 1131

Query: 63   ERIDAIREPG 34
            E    +R+ G
Sbjct: 1132 EDYHRVRDTG 1141



 Score = 33.5 bits (73), Expect = 3.9
 Identities = 22/86 (25%), Positives = 38/86 (44%), Gaps = 1/86 (1%)
 Frame = -3

Query: 300  RGRAGRNMGATGAVFELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTS 121
            +G+  +       + E +  KL         +R VED+E W+SE +    S++ G+DL  
Sbjct: 1658 QGQVDKQYAGLRELAEDRRRKLDHTYHHFLLSREVEDLEHWISERDLVASSQEMGQDLDH 1717

Query: 120  VQNLQKKHALLEADVSS-HAERIDAI 46
            V  L+ K      +      ER+D +
Sbjct: 1718 VTLLRDKFREFARETGMVGQERVDLV 1743



 Score = 33.5 bits (73), Expect = 3.9
 Identities = 25/122 (20%), Positives = 58/122 (47%)
 Frame = -3

Query: 396  AAGQQASRRRDNGRRQASA*ARTFCSTSNIVSRGRAGRNMGATGAVFELKGNKLQEAAQQ 217
            A GQQ  + ++   R  +  A +   +     R  A    G   A  + +  +L + A++
Sbjct: 1840 ALGQQVQQFQETASRLHTQYAGSRADSIRAAEREVAEAWKGLLDAC-DGRRAQLVDTAEK 1898

Query: 216  QQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAERIDAIREP 37
             ++  AV ++  W+  +  Q+ + +  +D++SV+ LQK H  + +++ +   +  A  + 
Sbjct: 1899 FRFFTAVRELMAWMESIIQQIETPEKPRDVSSVELLQKYHQGICSEIEAREAKFAACVQL 1958

Query: 36   GR 31
            G+
Sbjct: 1959 GQ 1960


>UniRef50_Q9H254 Cluster: Spectrin beta chain, brain 3; n=43;
           cellular organisms|Rep: Spectrin beta chain, brain 3 -
           Homo sapiens (Human)
          Length = 2564

 Score = 52.0 bits (119), Expect = 1e-05
 Identities = 25/75 (33%), Positives = 44/75 (58%)
 Frame = -3

Query: 270 TGAVFELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHAL 91
           TG V   +    Q  A Q+ +   V  ++ W+ E++ QLLS + G+ L    +L +KH L
Sbjct: 521 TGLVGARRTRLEQNLALQKVFQEMVYMVD-WMEEMQAQLLSRECGQHLVEADDLLQKHGL 579

Query: 90  LEADVSSHAERIDAI 46
           LE D+++ +ER++A+
Sbjct: 580 LEGDIAAQSERVEAL 594



 Score = 51.6 bits (118), Expect = 1e-05
 Identities = 30/76 (39%), Positives = 39/76 (51%)
 Frame = -3

Query: 255  ELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADV 76
            E +   L  A Q +QY   V ++E WL E E  ++SED GKD  S   L KKH  LE  V
Sbjct: 1611 ERRQQVLDAAFQVEQYYFDVAEVEAWLGEQELLMMSEDKGKDEQSTLQLLKKHLQLEQGV 1670

Query: 75   SSHAERIDAIREPGRA 28
             ++ E I  +    RA
Sbjct: 1671 ENYEESIAQLSRQCRA 1686



 Score = 46.4 bits (105), Expect = 5e-04
 Identities = 22/75 (29%), Positives = 45/75 (60%)
 Frame = -3

Query: 252 LKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVS 73
           ++  KL+  AQ+  +  A+   E WL+E +  +  +++G +L +V+   KKH  +EAD++
Sbjct: 422 IRQEKLELLAQRFDHKVAMR--ESWLNENQRLVSQDNFGYELPAVEAAMKKHEAIEADIA 479

Query: 72  SHAERIDAIREPGRA 28
           ++ ER+  + E  +A
Sbjct: 480 AYEERVQGVAELAQA 494



 Score = 36.3 bits (80), Expect = 0.56
 Identities = 17/66 (25%), Positives = 32/66 (48%)
 Frame = -3

Query: 240 KLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAE 61
           +LQEA    Q+   ++ +  WL +      + D+G D  S + L ++H  L  +V +H  
Sbjct: 768 RLQEARALHQFGADLDGLLDWLRDAYRLAAAGDFGHDEASSRRLARQHRALTGEVEAHRG 827

Query: 60  RIDAIR 43
            +  +R
Sbjct: 828 PVSGLR 833


>UniRef50_UPI00005A51E2 Cluster: PREDICTED: similar to Spectrin beta
            chain, brain 4 (Spectrin, non-erythroid beta chain 4)
            (Beta-V spectrin) (BSPECV); n=9; Eutheria|Rep: PREDICTED:
            similar to Spectrin beta chain, brain 4 (Spectrin,
            non-erythroid beta chain 4) (Beta-V spectrin) (BSPECV) -
            Canis familiaris
          Length = 3612

 Score = 51.2 bits (117), Expect = 2e-05
 Identities = 28/84 (33%), Positives = 45/84 (53%)
 Frame = -1

Query: 488  RES*KFATDDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQI 309
            RE    A ++ + DP  L  ++ K Q+ + EL AN      +   G+RLL+  H A   I
Sbjct: 2612 REKNSVALEEGWRDPALLQAQLWKQQSLQAELDANVHEQQRLQMEGQRLLQEGHPASETI 2671

Query: 308  SSRVEELGGIWERLVQSSS*RETS 237
              R+ ELG +W+ L Q++S R+ +
Sbjct: 2672 QERLRELGELWDEL-QANSRRKAA 2694



 Score = 45.2 bits (102), Expect = 0.001
 Identities = 22/67 (32%), Positives = 42/67 (62%)
 Frame = -3

Query: 246  GNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSH 67
            G++L++A QQ Q    ++D +  + ++EG L S + G+DL S + LQ++H  LE +  + 
Sbjct: 1328 GDQLRQARQQAQLLGLLQDAKKKMEQLEGALQSAETGQDLGSSRGLQRQHCQLERESQAL 1387

Query: 66   AERIDAI 46
            A ++ A+
Sbjct: 1388 ASKMAAL 1394



 Score = 43.6 bits (98), Expect = 0.004
 Identities = 29/117 (24%), Positives = 53/117 (45%)
 Frame = -3

Query: 378  SRRRDNGRRQASA*ARTFCSTSNIVSRGRAGRNMGATGAVFELKGNKLQEAAQQQQYNRA 199
            S  R  G+R  +A   +  +T   ++     + + +    ++L   +LQ+  + Q    +
Sbjct: 2440 SLARSTGQRLLAARLPSAAATRQALAA--LDQELNSLEGAWQLHQRQLQQDLELQLVLSS 2497

Query: 198  VEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAERIDAIREPGRA 28
            VE +E WL   E     +  G  L +V+ L  KH  LE D+ + AE+I  +    R+
Sbjct: 2498 VEQMESWLCSQEACPAGDGLGDSLANVETLLWKHKGLERDLEAQAEKISTLEAAARS 2554



 Score = 41.5 bits (93), Expect = 0.015
 Identities = 25/113 (22%), Positives = 53/113 (46%)
 Frame = -1

Query: 470  ATDDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEE 291
            A D+   +P+ +  ++++H+  E+EL AN   V+ +  VG++LL     AQ  + S ++ 
Sbjct: 1253 AADEPSREPSKVLQQLRQHEAAERELLANLGHVEGLQQVGRQLLSSRPQAQEDVQSSLQG 1312

Query: 290  LGGIWERLVQSSS*RETSCRKRLNNSSTTGPSRTLNFGSRKLKDSCSARTTGR 132
            L   WE + +  +      R+    +   G  +       +L+ +  +  TG+
Sbjct: 1313 LRNKWEAVKRKMAEHGDQLRQARQQAQLLGLLQDAKKKMEQLEGALQSAETGQ 1365



 Score = 41.1 bits (92), Expect = 0.020
 Identities = 21/61 (34%), Positives = 33/61 (54%)
 Frame = -3

Query: 213  QYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAERIDAIREPG 34
            Q+ R  ++   W+ E      + D G+ L SV+ LQ+KH  LE ++SSH     A+ + G
Sbjct: 2810 QFFRDADEELAWVQEKLPLATARDCGQSLISVRRLQEKHQNLERELSSHEALAQAVVDAG 2869

Query: 33   R 31
            R
Sbjct: 2870 R 2870



 Score = 37.9 bits (84), Expect = 0.18
 Identities = 17/57 (29%), Positives = 32/57 (56%)
 Frame = -3

Query: 237 LQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSH 67
           L++  Q  ++  + E+ E W+ E E  +  E  G+DL +++   +KH  LEA++  H
Sbjct: 638 LEQTLQHAEFLDSCEEEEAWVREHERLVEGEALGRDLGTLRAALRKHKALEAEIRRH 694



 Score = 37.1 bits (82), Expect = 0.32
 Identities = 20/66 (30%), Positives = 35/66 (53%), Gaps = 1/66 (1%)
 Frame = -3

Query: 234  QEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSS-HAER 58
            +E  Q  +  R    +E WL+       S+D+G+DL +V+ L+KK      +V S    +
Sbjct: 3013 REQLQLHRAEREARLLETWLAGKVAAAESQDHGQDLEAVEMLEKKFEAFRKEVQSLGPAK 3072

Query: 57   IDAIRE 40
            ++A+RE
Sbjct: 3073 VEALRE 3078



 Score = 35.5 bits (78), Expect = 0.97
 Identities = 19/70 (27%), Positives = 35/70 (50%)
 Frame = -3

Query: 255  ELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADV 76
            E++   LQEA   QQ   A  ++E W+   +  + S+D G D  +   L +KH  L  ++
Sbjct: 1529 EVQAQCLQEAVVLQQCFLAASELEDWVKAKQPLVSSQDCGGDQGATVRLIEKHQALRQEL 1588

Query: 75   SSHAERIDAI 46
            + H   ++ +
Sbjct: 1589 ALHWSSLEEL 1598



 Score = 35.5 bits (78), Expect = 0.97
 Identities = 22/71 (30%), Positives = 38/71 (53%), Gaps = 1/71 (1%)
 Frame = -3

Query: 240  KLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAE 61
            +L+ A +    +R ++++   L E    + + D GKDL SVQ   +KH  LE D+     
Sbjct: 2272 QLEGALEMHILSRKLDELTERLREKAALVQALDLGKDLESVQRQIRKHKELEQDMGLLQA 2331

Query: 60   RIDAI-REPGR 31
            +++ + RE GR
Sbjct: 2332 QVEPLEREVGR 2342



 Score = 34.7 bits (76), Expect = 1.7
 Identities = 20/61 (32%), Positives = 28/61 (45%)
 Frame = -3

Query: 210  YNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAERIDAIREPGR 31
            + RAV   + W+ E   QL       DL     L +KH   EA+V +H   I A+ + G 
Sbjct: 2067 FTRAVTQAQDWMEERVQQLKEPIPPGDLKDKLRLLRKHQAFEAEVQAHEGVITAVTKDGE 2126

Query: 30   A 28
            A
Sbjct: 2127 A 2127



 Score = 33.1 bits (72), Expect = 5.2
 Identities = 23/68 (33%), Positives = 32/68 (47%), Gaps = 2/68 (2%)
 Frame = -3

Query: 252 LKGNKLQEAAQQQQYN--RAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEAD 79
           L+G K Q A  Q   +  + VE     L E++    S   G+ L     L +KH LLEA 
Sbjct: 525 LQGQKKQMADLQAVLSLLQGVESTSNQLKELQVLASSTACGQQLAETVELLQKHDLLEAQ 584

Query: 78  VSSHAERI 55
           VS+H   +
Sbjct: 585 VSAHGAHV 592



 Score = 33.1 bits (72), Expect = 5.2
 Identities = 21/62 (33%), Positives = 28/62 (45%)
 Frame = -3

Query: 249  KGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSS 70
            K   LQEA +  +  R+VED+E WL  VE +L      +    +  L      LEA V  
Sbjct: 2692 KAAALQEACKALRLRRSVEDLESWLEPVEVKLRDPIGDQAQPELDELMGAQGELEAAVDR 2751

Query: 69   HA 64
             A
Sbjct: 2752 QA 2753


>UniRef50_Q95ZL8 Cluster: Uncoordinated protein 70, isoform b; n=5;
           Caenorhabditis|Rep: Uncoordinated protein 70, isoform b
           - Caenorhabditis elegans
          Length = 2302

 Score = 51.2 bits (117), Expect = 2e-05
 Identities = 23/69 (33%), Positives = 43/69 (62%)
 Frame = -3

Query: 252 LKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVS 73
           ++  KL++ A +  +NR  E  E WL+E +  +  +++G DL+SV+   KKH  +E D+ 
Sbjct: 401 IRQEKLEQLAAR--FNRKAEMRETWLTENQRLVSQDNFGNDLSSVEAATKKHEAIETDIF 458

Query: 72  SHAERIDAI 46
           ++ ER+ A+
Sbjct: 459 AYEERVQAV 467



 Score = 46.8 bits (106), Expect = 4e-04
 Identities = 27/88 (30%), Positives = 47/88 (53%)
 Frame = -3

Query: 264  AVFELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLE 85
            AV + KG+ L E+ +  Q+     + E W+SE E  ++ ++ GKD  S +N  KKH  L+
Sbjct: 1570 AVKDRKGD-LGESEKAHQFLYDCGEAEAWMSEQELYMMQDERGKDEFSTKNQIKKHERLQ 1628

Query: 84   ADVSSHAERIDAIREPGRASS*KREPLS 1
            +D+   A+ I A+         ++ PL+
Sbjct: 1629 SDIDKFADTIRALATKAHKFVEEKSPLT 1656



 Score = 44.8 bits (101), Expect = 0.002
 Identities = 22/72 (30%), Positives = 38/72 (52%)
 Frame = -1

Query: 470  ATDDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEE 291
            A D++Y D   +  K  +HQ F+ EL ANK R+D++      L + +      I  ++EE
Sbjct: 1288 AQDETYRDAKTITSKFVRHQAFQSELAANKERLDQLKHAAINLGDDKPEYHGTIDPQIEE 1347

Query: 290  LGGIWERLVQSS 255
            L   W+ L +++
Sbjct: 1348 LATQWDELEKTT 1359



 Score = 44.0 bits (99), Expect = 0.003
 Identities = 19/75 (25%), Positives = 42/75 (56%)
 Frame = -3

Query: 255  ELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADV 76
            + + ++L + +   ++   V D+ LW+ EV+ ++ S++  KD++ V+ L   H  L+A++
Sbjct: 1891 DARTSRLMDTSDLFKFMNMVRDLLLWMDEVKREMNSQERPKDVSGVELLMNNHQSLKAEI 1950

Query: 75   SSHAERIDAIREPGR 31
             +  E  +A    GR
Sbjct: 1951 DAREENFNACISLGR 1965



 Score = 43.6 bits (98), Expect = 0.004
 Identities = 18/42 (42%), Positives = 31/42 (73%)
 Frame = -3

Query: 177 LSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAERID 52
           + +++ +LLSED G  L  V++L +KHALLE+D++   ER++
Sbjct: 530 MDDIKSRLLSEDLGAHLMDVEDLLQKHALLESDINIIGERVN 571



 Score = 43.2 bits (97), Expect = 0.005
 Identities = 19/69 (27%), Positives = 36/69 (52%)
 Frame = -3

Query: 240  KLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAE 61
            KL EA   Q++ R ++  + WL+  + Q+ SE+  + L   + L  +HA +  ++  +AE
Sbjct: 1047 KLDEAGDLQRFLRDLDHFQAWLTATQRQVASEEEPQSLAEAEQLLNQHAAIREEIDGYAE 1106

Query: 60   RIDAIREPG 34
                +R  G
Sbjct: 1107 DYKKMRAMG 1115



 Score = 37.5 bits (83), Expect = 0.24
 Identities = 21/66 (31%), Positives = 31/66 (46%)
 Frame = -3

Query: 237  LQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAER 58
            LQ   +  Q+ R     E WL   E  L+S++YG++L     L KKH   E    +  ER
Sbjct: 2003 LQLILEVYQFARDAAVAESWLFAQEPYLISKEYGRNLEETIKLIKKHEAFEKSAFAQEER 2062

Query: 57   IDAIRE 40
              A+ +
Sbjct: 2063 FLALEK 2068



 Score = 36.3 bits (80), Expect = 0.56
 Identities = 19/61 (31%), Positives = 32/61 (52%)
 Frame = -3

Query: 213  QYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAERIDAIREPG 34
            Q+ R V+D +LW+SE      +++ G+ L     LQK   LL  ++ +H   I+ I   G
Sbjct: 1480 QFGRDVDDEKLWISERLVLAKAQNLGESLPDCHRLQKNLQLLSNEIDNHEPWINQICNNG 1539

Query: 33   R 31
            +
Sbjct: 1540 Q 1540



 Score = 32.3 bits (70), Expect = 9.1
 Identities = 14/66 (21%), Positives = 37/66 (56%)
 Frame = -3

Query: 240  KLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAE 61
            KL++A   QQ+    +++  W+ E   +   E Y +D  ++ +   +H   +++++++ E
Sbjct: 1260 KLKDALSLQQFLSDCDELREWIEEKMIRAQDETY-RDAKTITSKFVRHQAFQSELAANKE 1318

Query: 60   RIDAIR 43
            R+D ++
Sbjct: 1319 RLDQLK 1324


>UniRef50_A7RGP7 Cluster: Predicted protein; n=2; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 793

 Score = 50.4 bits (115), Expect = 3e-05
 Identities = 23/70 (32%), Positives = 41/70 (58%)
 Frame = -3

Query: 240 KLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAE 61
           +L++AAQ  QY     D E W+ E    + SEDYG+D  S  +L ++H+ +E ++ + A+
Sbjct: 702 RLKDAAQSLQYYSDANDAESWMKEKMFVVCSEDYGRDEQSAVSLLQRHSHIEDEIKAFAD 761

Query: 60  RIDAIREPGR 31
            I  ++E  +
Sbjct: 762 DIAQLKEQSK 771



 Score = 45.2 bits (102), Expect = 0.001
 Identities = 25/70 (35%), Positives = 37/70 (52%)
 Frame = -3

Query: 255 ELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADV 76
           E + N L    Q     R ++     + ++E  L SEDYG+ L  VQN+  KH+L+E+ +
Sbjct: 485 EARRNTLTGFTQLVGVFRDMDSAHADMLDIEAGLRSEDYGRHLLDVQNMLDKHSLVESQI 544

Query: 75  SSHAERIDAI 46
            S  ER  AI
Sbjct: 545 QSQHERTLAI 554



 Score = 42.7 bits (96), Expect = 0.006
 Identities = 18/71 (25%), Positives = 41/71 (57%)
 Frame = -3

Query: 240 KLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAE 61
           +L+++ +   +   VE+ ++++ E +    S++ G+DL S+  LQ++H  LEA+++    
Sbjct: 596 RLEDSLELYTFFEDVEEEDIFIKETDKLAASKEVGRDLASLTRLQQRHEALEAEINGRFS 655

Query: 60  RIDAIREPGRA 28
             + I   G+A
Sbjct: 656 HCEGIIAKGQA 666



 Score = 35.9 bits (79), Expect = 0.74
 Identities = 20/80 (25%), Positives = 41/80 (51%)
 Frame = -1

Query: 449 DPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEELGGIWER 270
           D  +L    Q+H+  E E+       + I A G+ L++  HF   +I +++++L   W +
Sbjct: 632 DLASLTRLQQRHEALEAEINGRFSHCEGIIAKGQALIDKGHFGAKEIKAKIKQLQANWIK 691

Query: 269 LVQSSS*RETSCRKRLNNSS 210
           L + +  R    R+RL +++
Sbjct: 692 LKELAGTR----RERLKDAA 707


>UniRef50_UPI0000E47ED5 Cluster: PREDICTED: similar to GA11331-PA,
           partial; n=1; Strongylocentrotus purpuratus|Rep:
           PREDICTED: similar to GA11331-PA, partial -
           Strongylocentrotus purpuratus
          Length = 556

 Score = 46.4 bits (105), Expect = 5e-04
 Identities = 23/74 (31%), Positives = 45/74 (60%)
 Frame = -3

Query: 252 LKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVS 73
           L+ + L+++ +  Q+ R  E+ E WL E +    S   G+DL SV ++++KHA+LEA+V+
Sbjct: 367 LRKSCLEDSLKFFQFMRDSEEEESWLMEKQRIAKSAVTGRDLRSVLSMKQKHAVLEAEVT 426

Query: 72  SHAERIDAIREPGR 31
           +    +  + + G+
Sbjct: 427 ARQRTVQGVLDTGQ 440



 Score = 46.0 bits (104), Expect = 7e-04
 Identities = 20/70 (28%), Positives = 37/70 (52%)
 Frame = -3

Query: 240 KLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAE 61
           +LQ A +  QY     + E W+ E    + S+DYGKD  S + + +KH +L   + ++  
Sbjct: 477 RLQMAVESHQYYIDANEAESWMREKMPLVCSDDYGKDADSAKVMLQKHTVLHEQIQAYDN 536

Query: 60  RIDAIREPGR 31
            +  +R+ G+
Sbjct: 537 EVVQLRDNGQ 546


>UniRef50_UPI0000660AE0 Cluster: Homolog of Homo sapiens "Splice
           Isoform 4 of Spectrin beta chain, brain 3; n=1; Takifugu
           rubripes|Rep: Homolog of Homo sapiens "Splice Isoform 4
           of Spectrin beta chain, brain 3 - Takifugu rubripes
          Length = 1341

 Score = 46.4 bits (105), Expect = 5e-04
 Identities = 24/72 (33%), Positives = 38/72 (52%)
 Frame = -3

Query: 255 ELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADV 76
           E +   L  A Q QQY      IE WL++ + QL +E+ G D  S   L K H  +E  V
Sbjct: 161 ERRSVMLNAALQAQQYYSEAAKIESWLADQKLQLANEEKGLDEESTLQLLKDHQSMEESV 220

Query: 75  SSHAERIDAIRE 40
            ++AE++ ++ +
Sbjct: 221 ETYAEKVGSLSQ 232



 Score = 37.1 bits (82), Expect = 0.32
 Identities = 21/61 (34%), Positives = 32/61 (52%)
 Frame = -3

Query: 237 LQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAER 58
           L  + +  Q  + +ED  LW+ E      S+DYGK+  SVQ   K +  L+ ++SS   R
Sbjct: 61  LLASKEMHQVAQDLEDELLWIQERLPFATSKDYGKNFHSVQQHAKNNLKLQRELSSRRAR 120

Query: 57  I 55
           I
Sbjct: 121 I 121


>UniRef50_UPI0000E4782C Cluster: PREDICTED: similar to
           alpha-spectrin, partial; n=1; Strongylocentrotus
           purpuratus|Rep: PREDICTED: similar to alpha-spectrin,
           partial - Strongylocentrotus purpuratus
          Length = 122

 Score = 45.2 bits (102), Expect = 0.001
 Identities = 21/85 (24%), Positives = 41/85 (48%)
 Frame = -1

Query: 470 ATDDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEE 291
           ++D++  D T+    + KH   + E+  +   + +    GK+L+E +HF   ++ ++V +
Sbjct: 11  SSDETPHDVTSAEALINKHSEHQLEMSLHATNIADFIETGKKLIEEDHFLAKEVEAKVRQ 70

Query: 290 LGGIWERLVQSSS*RETSCRKRLNN 216
           L   W  L          C +RLNN
Sbjct: 71  LDQAWVNL-------NAKCEERLNN 88



 Score = 33.9 bits (74), Expect = 3.0
 Identities = 16/50 (32%), Positives = 28/50 (56%)
 Frame = -3

Query: 180 WLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAERIDAIREPGR 31
           W++E+   L S++   D+TS + L  KH+  + ++S HA  I    E G+
Sbjct: 2   WINEMNALLSSDETPHDVTSAEALINKHSEHQLEMSLHATNIADFIETGK 51


>UniRef50_Q4T832 Cluster: Chromosome undetermined SCAF7908, whole
           genome shotgun sequence; n=3; Tetraodon
           nigroviridis|Rep: Chromosome undetermined SCAF7908,
           whole genome shotgun sequence - Tetraodon nigroviridis
           (Green puffer)
          Length = 1154

 Score = 45.2 bits (102), Expect = 0.001
 Identities = 24/72 (33%), Positives = 36/72 (50%)
 Frame = -3

Query: 255 ELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADV 76
           E +   L  A Q QQY      +E WL++ + QL +ED G D  S   L K H  +E  V
Sbjct: 293 ERRSAVLNAALQAQQYYSEAAKVEAWLADQKLQLATEDKGLDEVSTLQLLKGHQSVEQTV 352

Query: 75  SSHAERIDAIRE 40
            ++AE +  + +
Sbjct: 353 EAYAESVGLLSQ 364



 Score = 34.3 bits (75), Expect = 2.3
 Identities = 27/122 (22%), Positives = 54/122 (44%), Gaps = 2/122 (1%)
 Frame = -3

Query: 429 QGAETSELRTGAAGQQASRRRDNGRRQA-SA*ARTFCSTSNIVSR-GRAGRNMGATGAVF 256
           Q  E      G   QQ  +  + G  ++ +    + C +  I+ +    GR   +   + 
Sbjct: 350 QTVEAYAESVGLLSQQCQQLLEVGHPESVNETVLSVCKSEQIMKQQSHIGRLYLSVKDMV 409

Query: 255 ELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADV 76
           E +  KL++     Q ++ VE+++ W++E E    S + G+DL  V  LQ+  +    + 
Sbjct: 410 EHRKTKLEQQYWLYQLHKDVEELDKWITEREVVASSTELGQDLEDVTVLQETFSQFVCET 469

Query: 75  SS 70
           +S
Sbjct: 470 NS 471



 Score = 32.3 bits (70), Expect = 9.1
 Identities = 18/61 (29%), Positives = 30/61 (49%)
 Frame = -3

Query: 237 LQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAER 58
           L  + +  Q  + +ED  LW+ E      S+D+G    SVQ   K +  L+ +++S   R
Sbjct: 193 LLASKEMHQVAQDLEDEMLWIQERLPLATSKDHGSSFHSVQQQAKANQKLQRELASRRAR 252

Query: 57  I 55
           I
Sbjct: 253 I 253


>UniRef50_UPI0000DA227F Cluster: PREDICTED: similar to Spectrin beta
           chain, brain 4 (Spectrin, non-erythroid beta chain 4)
           (Beta-V spectrin) (BSPECV); n=1; Rattus norvegicus|Rep:
           PREDICTED: similar to Spectrin beta chain, brain 4
           (Spectrin, non-erythroid beta chain 4) (Beta-V spectrin)
           (BSPECV) - Rattus norvegicus
          Length = 3606

 Score = 42.7 bits (96), Expect = 0.006
 Identities = 25/79 (31%), Positives = 40/79 (50%)
 Frame = -3

Query: 237 LQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAER 58
           L++  Q+ Q+  + E+ E WL E    +     G+DLT + N  +KH  LE ++  H   
Sbjct: 634 LEQTLQRAQFLHSCEEEEAWLQEHRQLVEKAAPGRDLTQIANALQKHKALETELHRHQAV 693

Query: 57  IDAIREPGRASS*KREPLS 1
              + + GR  S K EPL+
Sbjct: 694 CIDLMQRGRNLSVK-EPLT 711



 Score = 42.3 bits (95), Expect = 0.008
 Identities = 21/68 (30%), Positives = 38/68 (55%)
 Frame = -3

Query: 249  KGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSS 70
            +G++L +  QQ Q    ++D+   +  +EG L S + G+DL S + LQ +H  LE    +
Sbjct: 1412 QGDRLPQTRQQGQLLELLQDVRGMMEHLEGALQSTETGQDLCSSRRLQTQHRQLEGKSQA 1471

Query: 69   HAERIDAI 46
             A ++ A+
Sbjct: 1472 LASKMAAL 1479



 Score = 37.9 bits (84), Expect = 0.18
 Identities = 22/76 (28%), Positives = 35/76 (46%)
 Frame = -1

Query: 449 DPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEELGGIWER 270
           D T +   +QKH+  E EL  ++    ++   G+ L   E   QP    R E + GIW+ 
Sbjct: 669 DLTQIANALQKHKALETELHRHQAVCIDLMQRGRNLSVKEPLTQPDPLERAEAVQGIWQL 728

Query: 269 LVQSSS*RETSCRKRL 222
           L   ++ R T  +  L
Sbjct: 729 LWTGAARRRTRLQTAL 744



 Score = 37.1 bits (82), Expect = 0.32
 Identities = 21/73 (28%), Positives = 37/73 (50%)
 Frame = -3

Query: 240 KLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAE 61
           +LQ A    QY   + +   WL + + QL S  YGKD +  + L ++H  LE  + + A 
Sbjct: 739 RLQTALLVGQYFSDLAEAASWLLQRQKQLESASYGKDQSDSEALLQQHLRLEQGLCAFAV 798

Query: 60  RIDAIREPGRASS 22
            +  + +  RA++
Sbjct: 799 DLRELEDQARAAA 811



 Score = 35.5 bits (78), Expect = 0.97
 Identities = 17/53 (32%), Positives = 28/53 (52%)
 Frame = -1

Query: 425  VQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEELGGIWERL 267
            +Q H+  + EL A+   ++++   GK LL    +AQ  I  R++ L   WE L
Sbjct: 1353 LQWHKITKSELLASHKYMEDLQQTGKELLHSNPYAQEDIQDRLQSLNHKWEEL 1405



 Score = 35.5 bits (78), Expect = 0.97
 Identities = 18/61 (29%), Positives = 33/61 (54%)
 Frame = -3

Query: 255  ELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADV 76
            E + + LQ+A   Q+Y   V ++E W+ E    + S DYG +  +   L +KH +L  ++
Sbjct: 1617 EGRAHCLQQAVIFQRYLLNVSEMETWVEEKLPLVSSRDYGSNEEATFGLIRKHQMLRQEI 1676

Query: 75   S 73
            +
Sbjct: 1677 A 1677



 Score = 35.1 bits (77), Expect = 1.3
 Identities = 15/51 (29%), Positives = 26/51 (50%)
 Frame = -3

Query: 183  LWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAERIDAIREPGR 31
            LW   ++ QL S++  +D+ S Q L +KH  L  +     ER+  +   G+
Sbjct: 1120 LWAEGIQAQLCSKEQLEDVASAQQLLRKHGALREETCLWKERLQQLEAQGQ 1170


>UniRef50_UPI0000E82095 Cluster: PREDICTED: similar to brain beta 3
           spectrin; n=1; Gallus gallus|Rep: PREDICTED: similar to
           brain beta 3 spectrin - Gallus gallus
          Length = 420

 Score = 41.9 bits (94), Expect = 0.011
 Identities = 18/47 (38%), Positives = 29/47 (61%)
 Frame = -3

Query: 186 ELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAERIDAI 46
           +LW+ E     +S D+GKDL SVQ L KK+  L+ ++  H  R++ +
Sbjct: 18  QLWVKERRPMAVSTDHGKDLPSVQLLIKKNQTLQKELQGHEPRVEEL 64



 Score = 39.5 bits (88), Expect = 0.060
 Identities = 21/75 (28%), Positives = 34/75 (45%)
 Frame = -3

Query: 255 ELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADV 76
           EL+  +L+ A   Q +     + E W+ E E  +++ +  KD  S Q   KKH  LEA +
Sbjct: 90  ELRRQRLESAHAAQLFYCDAAEAEAWMGEQELHMMAHEKAKDELSAQAQLKKHLSLEASL 149

Query: 75  SSHAERIDAIREPGR 31
                 +  + E  R
Sbjct: 150 RDFGRCVQLLAEQSR 164


>UniRef50_A2BGE8 Cluster: Novel protein similar to spectrin, beta,
           erythrocytic; n=3; Clupeocephala|Rep: Novel protein
           similar to spectrin, beta, erythrocytic - Danio rerio
           (Zebrafish) (Brachydanio rerio)
          Length = 1412

 Score = 41.5 bits (93), Expect = 0.015
 Identities = 23/77 (29%), Positives = 38/77 (49%)
 Frame = -3

Query: 237 LQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAER 58
           L  + +  Q  + +ED  +W+ E      S +YG +L SVQNL K H  L+ ++     R
Sbjct: 198 LLASKELHQVTQDLEDEIIWIQERLHLASSIEYGTNLQSVQNLMKNHEALQMEMQVRKGR 257

Query: 57  IDAIREPGRASS*KREP 7
           ++ + E   A +  R P
Sbjct: 258 LEEVLERAEAVAALRTP 274



 Score = 41.1 bits (92), Expect = 0.020
 Identities = 23/69 (33%), Positives = 34/69 (49%)
 Frame = -3

Query: 237 LQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAER 58
           L    Q QQY       E WLS  + Q+L+E+ G D  S   L K+   LE  V ++AE 
Sbjct: 304 LDAVNQAQQYYSQAAKTESWLSGQKLQVLNEEKGNDEASTLRLLKEQLALEQTVENYAET 363

Query: 57  IDAIREPGR 31
           + ++ +  R
Sbjct: 364 VGSLSQQCR 372



 Score = 35.1 bits (77), Expect = 1.3
 Identities = 20/73 (27%), Positives = 36/73 (49%), Gaps = 1/73 (1%)
 Frame = -3

Query: 255 ELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADV 76
           E +  KL++     Q  R VE +E W+SE E    S + G+DL  V  LQ       ++ 
Sbjct: 404 EQRKTKLEQQYWLYQLKREVEALEKWISEREAVASSTELGQDLEHVTVLQSSFTQFSSET 463

Query: 75  SSHAER-IDAIRE 40
            +  ++ +D++ +
Sbjct: 464 RAVGQKQMDSVNK 476



 Score = 32.3 bits (70), Expect = 9.1
 Identities = 14/69 (20%), Positives = 34/69 (49%)
 Frame = -3

Query: 213 QYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAERIDAIREPG 34
           Q+   V ++ +W+  + GQ+   D  +DL+ ++ +  +H  L++ + + ++      E G
Sbjct: 629 QFFAVVRELSMWMDGIMGQIGPNDDARDLSVLEGMMSQHQNLKSKMENKSKNFVHCVEMG 688

Query: 33  RASS*KREP 7
           +     R P
Sbjct: 689 KMLLAARNP 697


>UniRef50_UPI0000E260D8 Cluster: PREDICTED: spectrin, beta,
           non-erythrocytic 5; n=5; Pan troglodytes|Rep: PREDICTED:
           spectrin, beta, non-erythrocytic 5 - Pan troglodytes
          Length = 897

 Score = 40.3 bits (90), Expect = 0.034
 Identities = 23/71 (32%), Positives = 41/71 (57%), Gaps = 1/71 (1%)
 Frame = -3

Query: 240 KLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAE 61
           +L+ A +    +R ++++   + E E  + + D GKDL SVQ L +KH  LE +V     
Sbjct: 456 QLEGALEIHVLSRELDNVTKRIQEKEALIQALDCGKDLESVQRLLRKHEELEREVHPIQA 515

Query: 60  RIDAI-REPGR 31
           +++++ RE GR
Sbjct: 516 QVESLEREVGR 526



 Score = 37.1 bits (82), Expect = 0.32
 Identities = 20/57 (35%), Positives = 28/57 (49%)
 Frame = -3

Query: 201 AVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAERIDAIREPGR 31
           +VE +E WL   E  L SE     L  ++ L  KH +LE D+   A +I A+    R
Sbjct: 705 SVEKMERWLCSKEDSLASEGLWDPLAPMEPLLWKHKMLERDLEVQAGKISALEATAR 761


>UniRef50_A7S2F5 Cluster: Predicted protein; n=1; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 410

 Score = 39.9 bits (89), Expect = 0.045
 Identities = 19/67 (28%), Positives = 37/67 (55%)
 Frame = -3

Query: 240 KLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAE 61
           +L ++++   + R  +++  W+ E E  + S+D G+DL  V+ L +K  +   D+ S  E
Sbjct: 264 RLLDSSRLFNFLREADELGAWVEEKEAIVSSDDCGRDLEHVEMLMQKFEVFTRDLVSSGE 323

Query: 60  RIDAIRE 40
           RI  + E
Sbjct: 324 RIAKLTE 330


>UniRef50_A7T2A8 Cluster: Predicted protein; n=1; Nematostella
            vectensis|Rep: Predicted protein - Nematostella vectensis
          Length = 1459

 Score = 38.7 bits (86), Expect = 0.10
 Identities = 21/73 (28%), Positives = 36/73 (49%), Gaps = 1/73 (1%)
 Frame = -3

Query: 249  KGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLS-EDYGKDLTSVQNLQKKHALLEADVS 73
            +G  ++     +QY++  E I +WL E+E +L      G +L +VQ   K H    A+++
Sbjct: 1007 RGELVEVKVTSEQYHKLFEVILVWLDELELKLSEVPPVGTELATVQEQLKLHKAFHAELT 1066

Query: 72   SHAERIDAIREPG 34
             H   I  I + G
Sbjct: 1067 PHQSEITQINQLG 1079



 Score = 38.7 bits (86), Expect = 0.10
 Identities = 17/72 (23%), Positives = 37/72 (51%)
 Frame = -1

Query: 428  KVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEELGGIWERLVQSSS* 249
            ++ KH+  + ++ +++P VD ++     LLE        +  +V+EL   W+ ++  S+ 
Sbjct: 1165 ELAKHKILQNDILSHEPSVDSLSRAASALLESGETDSTALEGKVQELKTTWDAVLAKSAQ 1224

Query: 248  RETSCRKRLNNS 213
            R+    K L +S
Sbjct: 1225 RQAELEKALKDS 1236



 Score = 35.5 bits (78), Expect = 0.97
 Identities = 22/76 (28%), Positives = 41/76 (53%), Gaps = 2/76 (2%)
 Frame = -1

Query: 452  LDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLE--LEHFAQPQISSRVEELGGI 279
            +DP +L  +++KH+ F+  L AN+  +D    +GK+L++  L+  A   I  ++ +L   
Sbjct: 1374 VDPAHLRTQLKKHKEFQTMLGANQAGLDATVKMGKQLMDRSLDEDA-ITIEGKIADLKAR 1432

Query: 278  WERLVQSSS*RETSCR 231
            W+ +   S  R  S R
Sbjct: 1433 WDAVCGLSVERLVSLR 1448


>UniRef50_A7SF35 Cluster: Predicted protein; n=1; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 1586

 Score = 38.7 bits (86), Expect = 0.10
 Identities = 17/72 (23%), Positives = 37/72 (51%)
 Frame = -1

Query: 428 KVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEELGGIWERLVQSSS* 249
           ++ KH+  + ++ +++P VD ++     LLE        +  +V+EL   W+ ++  S+ 
Sbjct: 430 ELAKHKILQNDILSHEPSVDSLSRAASALLESGETDSTALEGKVQELKTTWDAVLAKSAQ 489

Query: 248 RETSCRKRLNNS 213
           R+    K L +S
Sbjct: 490 RQAELEKALKDS 501



 Score = 35.9 bits (79), Expect = 0.74
 Identities = 20/73 (27%), Positives = 35/73 (47%), Gaps = 1/73 (1%)
 Frame = -3

Query: 249 KGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLS-EDYGKDLTSVQNLQKKHALLEADVS 73
           +G  ++     +QY++    I +WL E+E +L      G +L +VQ   K H    A+++
Sbjct: 272 RGELVEVKVTSEQYHKLFVVILVWLDELELKLSEVPPVGTELATVQEQLKLHKAFHAELT 331

Query: 72  SHAERIDAIREPG 34
            H   I  I + G
Sbjct: 332 PHQSEITQINQLG 344



 Score = 35.1 bits (77), Expect = 1.3
 Identities = 21/79 (26%), Positives = 42/79 (53%), Gaps = 2/79 (2%)
 Frame = -1

Query: 452 LDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLE--LEHFAQPQISSRVEELGGI 279
           +DP +L  +++KH+ F+  L AN+  +D    +GK+L++  L+  A   I  ++ +L   
Sbjct: 748 VDPAHLRTQLKKHKEFQTMLGANQAGLDATVKMGKQLMDRSLDEDA-ITIEGKIADLKAR 806

Query: 278 WERLVQSSS*RETSCRKRL 222
           W+ +   S  R+    + L
Sbjct: 807 WDAVCGLSVERQQKLEEAL 825


>UniRef50_UPI0000E2615F Cluster: PREDICTED: similar to beta V
           spectrin, partial; n=3; Pan troglodytes|Rep: PREDICTED:
           similar to beta V spectrin, partial - Pan troglodytes
          Length = 472

 Score = 38.3 bits (85), Expect = 0.14
 Identities = 27/89 (30%), Positives = 40/89 (44%), Gaps = 14/89 (15%)
 Frame = -3

Query: 255 ELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKD--------------LTSV 118
           E +   LQ+A   QQY   V ++E W+ E    + S DYG+D              L  +
Sbjct: 180 EAQAQCLQQAVAFQQYFLDVSELEGWVEEKRTLVSSRDYGRDEAATLRLINKHQDPLAPM 239

Query: 117 QNLQKKHALLEADVSSHAERIDAIREPGR 31
           + L  KH +LE D+   A +I A+    R
Sbjct: 240 EPLLWKHKMLERDLEEQAGKISALEATAR 268



 Score = 34.7 bits (76), Expect = 1.7
 Identities = 19/76 (25%), Positives = 40/76 (52%), Gaps = 1/76 (1%)
 Frame = -3

Query: 252 LKGNKLQEAAQQQQYNRAVEDIEL-WLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADV 76
           ++G +LQ + +  Q+   + ++EL W++E         Y + L   Q+L +KH  L+ +V
Sbjct: 75  IRGLQLQASVELHQFCH-LSNMELSWVAEHMPHGSPTSYTECLNGAQSLHRKHKELQVEV 133

Query: 75  SSHAERIDAIREPGRA 28
            +H  ++  +   GR+
Sbjct: 134 KAHQGQVQRVLSSGRS 149


>UniRef50_Q4SKB2 Cluster: Chromosome 13 SCAF14566, whole genome
           shotgun sequence; n=1; Tetraodon nigroviridis|Rep:
           Chromosome 13 SCAF14566, whole genome shotgun sequence -
           Tetraodon nigroviridis (Green puffer)
          Length = 340

 Score = 37.1 bits (82), Expect = 0.32
 Identities = 17/43 (39%), Positives = 21/43 (48%), Gaps = 2/43 (4%)
 Frame = +2

Query: 350 CRRPLSRRREACWPAAPVRSSDVSAPCHSGWSDP--STSRRWR 472
           CR P SR   ACW  +    +  SA    GW+ P  +TS  WR
Sbjct: 158 CRSPRSRGSSACWATSSALGTSSSACSRPGWAGPPRTTSSAWR 200


>UniRef50_UPI0000660388 Cluster: Homolog of Homo sapiens "spectrin,
           beta, non-erythrocytic 5; n=1; Takifugu rubripes|Rep:
           Homolog of Homo sapiens "spectrin, beta,
           non-erythrocytic 5 - Takifugu rubripes
          Length = 1207

 Score = 36.7 bits (81), Expect = 0.42
 Identities = 15/46 (32%), Positives = 25/46 (54%)
 Frame = -1

Query: 404 EQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEELGGIWERL 267
           EQ++  NK R++ +   G  L+   H    +I   + +LGG+WE L
Sbjct: 618 EQDILNNKTRIEVVKREGHELVRARHPGSAKIEEFLTQLGGLWEEL 663


>UniRef50_Q4RFJ9 Cluster: Chromosome 8 SCAF15119, whole genome
           shotgun sequence; n=3; Clupeocephala|Rep: Chromosome 8
           SCAF15119, whole genome shotgun sequence - Tetraodon
           nigroviridis (Green puffer)
          Length = 1527

 Score = 36.7 bits (81), Expect = 0.42
 Identities = 18/62 (29%), Positives = 32/62 (51%), Gaps = 1/62 (1%)
 Frame = -3

Query: 213 QYNRAVEDIELWLSEVEGQLL-SEDYGKDLTSVQNLQKKHALLEADVSSHAERIDAIREP 37
           Q+  A++++  WLS    QL  S     DL + +    KH +L  DV SH   ++++ + 
Sbjct: 525 QFQNALDELHTWLSRTAEQLEGSRPISIDLQACEIELAKHKVLRNDVMSHVRTMESVNQA 584

Query: 36  GR 31
           G+
Sbjct: 585 GK 586



 Score = 32.3 bits (70), Expect = 9.1
 Identities = 17/71 (23%), Positives = 35/71 (49%), Gaps = 1/71 (1%)
 Frame = -1

Query: 428 KVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQ-ISSRVEELGGIWERLVQSSS 252
           ++ KH+    ++ ++   ++ +   GK LLE+     P  + +R+EEL   WE +   + 
Sbjct: 560 ELAKHKVLRNDVMSHVRTMESVNQAGKNLLEVGSGDSPNGLQARLEELNDSWEFVRCETE 619

Query: 251 *RETSCRKRLN 219
            R+     RL+
Sbjct: 620 RRQLELENRLS 630


>UniRef50_Q4REJ7 Cluster: Chromosome 10 SCAF15123, whole genome
            shotgun sequence; n=4; Euteleostomi|Rep: Chromosome 10
            SCAF15123, whole genome shotgun sequence - Tetraodon
            nigroviridis (Green puffer)
          Length = 6015

 Score = 36.7 bits (81), Expect = 0.42
 Identities = 18/62 (29%), Positives = 35/62 (56%)
 Frame = -3

Query: 213  QYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAERIDAIREPG 34
            +Y R+V+ ++ W++  E +L  +   +DL+SVQN  K+   +E  V    + ++ + E G
Sbjct: 4249 EYERSVQALKSWMANQEDRLKKKHRMEDLSSVQNALKECQEMEDLVREKEKELERVEEQG 4308

Query: 33   RA 28
             A
Sbjct: 4309 CA 4310



 Score = 34.3 bits (75), Expect = 2.3
 Identities = 16/66 (24%), Positives = 39/66 (59%), Gaps = 3/66 (4%)
 Frame = -3

Query: 222  QQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLT---SVQNLQKKHALLEADVSSHAERID 52
            + + YN  ++++E WL ++  +L++ D  +  +   + Q L +  AL+E +++S  ER+ 
Sbjct: 1383 EHEDYNSELQEVEKWLLQMSSRLVTSDSMQTSSIEMATQQLARHKALME-EITSFEERLT 1441

Query: 51   AIREPG 34
             +++ G
Sbjct: 1442 NLKQKG 1447


>UniRef50_Q89M57 Cluster: Bll4336 protein; n=1; Bradyrhizobium
           japonicum|Rep: Bll4336 protein - Bradyrhizobium
           japonicum
          Length = 345

 Score = 36.7 bits (81), Expect = 0.42
 Identities = 18/62 (29%), Positives = 26/62 (41%)
 Frame = +2

Query: 320 EQNVRAQADACRRPLSRRREACWPAAPVRSSDVSAPCHSGWSDPSTSRRWRTFSFLVYPT 499
           ++  RA AD    P ++R E  W     R  + SAP  SGW    +   W  F  +    
Sbjct: 13  KRGFRAMADGQNAPETKRVETVWDQDRARGDEASAPGTSGWRGGISGGDWTIFGAIAAVA 72

Query: 500 FS 505
           F+
Sbjct: 73  FA 74


>UniRef50_UPI0000E254D5 Cluster: PREDICTED: plectin 1; n=3;
           Amniota|Rep: PREDICTED: plectin 1 - Pan troglodytes
          Length = 4393

 Score = 36.3 bits (80), Expect = 0.56
 Identities = 17/61 (27%), Positives = 31/61 (50%)
 Frame = -1

Query: 443 TNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEELGGIWERLV 264
           TN+  K + +    +EL+  + ++ E+   G RLL  +H A+P + S    L   W  ++
Sbjct: 642 TNMTAKKESYSALMRELELKEKKIKELQNAGDRLLREDHPARPTVESFQAALQTQWSWML 701

Query: 263 Q 261
           Q
Sbjct: 702 Q 702


>UniRef50_Q15149 Cluster: Plectin-1; n=128; cellular organisms|Rep:
           Plectin-1 - Homo sapiens (Human)
          Length = 4684

 Score = 36.3 bits (80), Expect = 0.56
 Identities = 17/61 (27%), Positives = 31/61 (50%)
 Frame = -1

Query: 443 TNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEELGGIWERLV 264
           TN+  K + +    +EL+  + ++ E+   G RLL  +H A+P + S    L   W  ++
Sbjct: 786 TNMTAKKESYSALMRELELKEKKIKELQNAGDRLLREDHPARPTVESFQAALQTQWSWML 845

Query: 263 Q 261
           Q
Sbjct: 846 Q 846


>UniRef50_P18091 Cluster: Alpha-actinin, sarcomeric; n=53;
           Bilateria|Rep: Alpha-actinin, sarcomeric - Drosophila
           melanogaster (Fruit fly)
          Length = 924

 Score = 36.3 bits (80), Expect = 0.56
 Identities = 17/58 (29%), Positives = 33/58 (56%), Gaps = 1/58 (1%)
 Frame = -3

Query: 216 QQYNRAVEDIELWLSEVEGQLLSEDYGK-DLTSVQNLQKKHALLEADVSSHAERIDAI 46
           Q++    +  E W    E  L S+D+ +  L  ++ L+KKH   E+D+++H +R++ I
Sbjct: 429 QKFKHKADAHEDWTRGKEEMLQSQDFRQCKLNELKALKKKHEAFESDLAAHQDRVEQI 486


>UniRef50_Q4ABH1 Cluster: CG33715-PD, isoform D; n=9; Sophophora|Rep:
            CG33715-PD, isoform D - Drosophila melanogaster (Fruit
            fly)
          Length = 11707

 Score = 35.1 bits (77), Expect = 1.3
 Identities = 16/71 (22%), Positives = 36/71 (50%), Gaps = 2/71 (2%)
 Frame = -3

Query: 234  QEAAQQQQYNRAVEDIELWLSEVEGQLLSED--YGKDLTSVQNLQKKHALLEADVSSHAE 61
            QE      Y+++++D+E WL ++  QL++ +  +  +    Q   K+H  L  ++  +  
Sbjct: 5779 QEMFDYNAYHQSLQDVEKWLLQISFQLMAHNSLFISNREQTQEQIKQHEALLVEIQKYQT 5838

Query: 60   RIDAIREPGRA 28
             +D +   G+A
Sbjct: 5839 NLDDLNAKGQA 5849



 Score = 33.9 bits (74), Expect = 3.0
 Identities = 19/73 (26%), Positives = 40/73 (54%), Gaps = 1/73 (1%)
 Frame = -3

Query: 255  ELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGK-DLTSVQNLQKKHALLEAD 79
            ++KG   +      QY ++ E I  WL +VEG++ +E   + +L+ V    ++ ++L+ D
Sbjct: 2461 QIKGILDENVDLWSQYEQSNEQISNWLRDVEGRVKAETSSQVNLSEVPQKLQELSILQQD 2520

Query: 78   VSSHAERIDAIRE 40
            V +H   I+ + +
Sbjct: 2521 VLAHEPIINNLEQ 2533


>UniRef50_UPI0001556552 Cluster: PREDICTED: similar to
           MAP/microtubule affinity-regulating kinase 4, partial;
           n=1; Ornithorhynchus anatinus|Rep: PREDICTED: similar to
           MAP/microtubule affinity-regulating kinase 4, partial -
           Ornithorhynchus anatinus
          Length = 375

 Score = 34.7 bits (76), Expect = 1.7
 Identities = 18/43 (41%), Positives = 25/43 (58%)
 Frame = -3

Query: 255 ELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDL 127
           E +   L  A Q +QY   + ++E WLSE E  L+SE+ GK L
Sbjct: 104 ERRQQSLDAAFQVEQYYFDMAEVEAWLSEQELLLMSEEKGKAL 146


>UniRef50_UPI0000E23F6F Cluster: PREDICTED: spectrin, beta,
           non-erythrocytic 5, partial; n=4; Pan troglodytes|Rep:
           PREDICTED: spectrin, beta, non-erythrocytic 5, partial -
           Pan troglodytes
          Length = 648

 Score = 34.7 bits (76), Expect = 1.7
 Identities = 20/79 (25%), Positives = 39/79 (49%)
 Frame = -3

Query: 237 LQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAER 58
           LQ+A + QQ+   + +   WL+E    L SED G    + Q L ++    + D+ + + R
Sbjct: 59  LQQAQEAQQFLTELLEAGSWLAERGHALDSEDMGHSAEATQALLQRLEATKRDLEAFSPR 118

Query: 57  IDAIREPGRASS*KREPLS 1
           I+ +++       ++ P S
Sbjct: 119 IEQLQQTAALLESRKNPES 137



 Score = 32.3 bits (70), Expect = 9.1
 Identities = 17/53 (32%), Positives = 29/53 (54%)
 Frame = -3

Query: 216 QQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAER 58
           Q+  + +E  E WL+  EG LL  DYG  ++ V+ L  +   LE  +++  E+
Sbjct: 458 QKLLQRLEQAEAWLACREGLLLKPDYGHSVSDVELLLHRRQDLEKLLAAQEEK 510


>UniRef50_UPI0000585CF2 Cluster: PREDICTED: similar to beta
           spectrin; n=1; Strongylocentrotus purpuratus|Rep:
           PREDICTED: similar to beta spectrin - Strongylocentrotus
           purpuratus
          Length = 200

 Score = 34.7 bits (76), Expect = 1.7
 Identities = 18/58 (31%), Positives = 26/58 (44%)
 Frame = -3

Query: 213 QYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAERIDAIRE 40
           Q+ R     + WL   E  L S+DYG  L  V+ L K+    E  +    ER  A+ +
Sbjct: 95  QFARDAHATDAWLMSQEQYLRSDDYGDSLDEVEKLIKRPEAFEKALYCQGERFTALEK 152


>UniRef50_Q96PK2 Cluster: Microtubule-actin cross-linking factor 1,
            isoform 4; n=26; Fungi/Metazoa group|Rep:
            Microtubule-actin cross-linking factor 1, isoform 4 -
            Homo sapiens (Human)
          Length = 5938

 Score = 34.7 bits (76), Expect = 1.7
 Identities = 19/80 (23%), Positives = 37/80 (46%), Gaps = 1/80 (1%)
 Frame = -1

Query: 449  DPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQ-PQISSRVEELGGIWE 273
            DP  +  ++ KH   + ++ A++  V+ +   G  LLE         + SR+E +   WE
Sbjct: 4799 DPKVIEVELAKHHVLKNDVLAHQATVETVNKAGNELLESSAGDDASSLRSRLEAMNQCWE 4858

Query: 272  RLVQSSS*RETSCRKRLNNS 213
             ++Q +  RE   +  L  +
Sbjct: 4859 SVLQKTEEREQQLQSTLQQA 4878


>UniRef50_Q9UPN3 Cluster: Microtubule-actin cross-linking factor 1,
            isoforms 1/2/3/5; n=44; Amniota|Rep: Microtubule-actin
            cross-linking factor 1, isoforms 1/2/3/5 - Homo sapiens
            (Human)
          Length = 5430

 Score = 34.7 bits (76), Expect = 1.7
 Identities = 19/80 (23%), Positives = 37/80 (46%), Gaps = 1/80 (1%)
 Frame = -1

Query: 449  DPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQ-PQISSRVEELGGIWE 273
            DP  +  ++ KH   + ++ A++  V+ +   G  LLE         + SR+E +   WE
Sbjct: 4297 DPKVIEVELAKHHVLKNDVLAHQATVETVNKAGNELLESSAGDDASSLRSRLEAMNQCWE 4356

Query: 272  RLVQSSS*RETSCRKRLNNS 213
             ++Q +  RE   +  L  +
Sbjct: 4357 SVLQKTEEREQQLQSTLQQA 4376


>UniRef50_Q9QW73 Cluster: Beta-spectrin subunit; n=1; Mus sp.|Rep:
           Beta-spectrin subunit - Mus sp
          Length = 332

 Score = 34.3 bits (75), Expect = 2.3
 Identities = 17/56 (30%), Positives = 27/56 (48%)
 Frame = -3

Query: 213 QYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAERIDAI 46
           Q++R     E WL   E  L S + G+ +  V+ L K+H   E   ++  ER  A+
Sbjct: 147 QFSRDASVAEAWLLGQEPYLSSREIGQSVDEVEKLIKRHEAFEKSAATWDERFSAL 202


>UniRef50_A4XBS1 Cluster: Putative uncharacterized protein; n=2;
           Salinispora|Rep: Putative uncharacterized protein -
           Salinispora tropica CNB-440
          Length = 820

 Score = 34.3 bits (75), Expect = 2.3
 Identities = 18/37 (48%), Positives = 21/37 (56%)
 Frame = +3

Query: 153 AAVLQLPRAKVQCPRRPGCTAVVEPLPATCFPSARRL 263
           AAVL  PRA+    R PG T +V+PL A   P  R L
Sbjct: 681 AAVLTRPRARRAPARSPGATRIVDPLAAPRLPMPRLL 717


>UniRef50_UPI0000EBC2AB Cluster: PREDICTED: hypothetical protein;
           n=1; Bos taurus|Rep: PREDICTED: hypothetical protein -
           Bos taurus
          Length = 248

 Score = 33.9 bits (74), Expect = 3.0
 Identities = 17/36 (47%), Positives = 20/36 (55%)
 Frame = +3

Query: 129 DPSRSPR*AAVLQLPRAKVQCPRRPGCTAVVEPLPA 236
           DP    R A V   P A+ QCPRRP  + V  P+PA
Sbjct: 141 DPGELRRSARVRGWPPARPQCPRRPPLSQVSGPVPA 176


>UniRef50_UPI0000E820B7 Cluster: PREDICTED: hypothetical protein,
           partial; n=1; Gallus gallus|Rep: PREDICTED: hypothetical
           protein, partial - Gallus gallus
          Length = 369

 Score = 33.9 bits (74), Expect = 3.0
 Identities = 15/48 (31%), Positives = 27/48 (56%), Gaps = 1/48 (2%)
 Frame = -3

Query: 186 ELWLSEVEGQLLSEDYGK-DLTSVQNLQKKHALLEADVSSHAERIDAI 46
           E W    E  L  +DY    L+ ++ L +KH   E+D+++H +R++ I
Sbjct: 279 EAWTEGKEAMLKQKDYETATLSDIKALIRKHEAFESDLAAHQDRVEQI 326


>UniRef50_UPI000023F2A2 Cluster: hypothetical protein FG05967.1;
           n=1; Gibberella zeae PH-1|Rep: hypothetical protein
           FG05967.1 - Gibberella zeae PH-1
          Length = 365

 Score = 33.9 bits (74), Expect = 3.0
 Identities = 23/89 (25%), Positives = 40/89 (44%), Gaps = 1/89 (1%)
 Frame = -1

Query: 395 LQANKPRVDEITAVGKRLLELEHFAQPQISSRVEELGGIWERLVQSSS*RETS-CRKRLN 219
           +Q +K  VD++  +G  ++EL   A P+       LG +W ++  +   RE + C   L+
Sbjct: 255 IQQSKTTVDQLVQLGPDVIELPPEANPRTMEVTSNLGEVWGKVDITGGRREVARCTAALD 314

Query: 218 NSSTTGPSRTLNFGSRKLKDSCSARTTGR 132
           N  +    R     S++LK       T R
Sbjct: 315 NCLSQAKERRHRL-SKELKRKEEEMETAR 342


>UniRef50_Q6A6M4 Cluster: 8-amino-7-oxononanoate synthase; n=1;
           Propionibacterium acnes|Rep: 8-amino-7-oxononanoate
           synthase - Propionibacterium acnes
          Length = 653

 Score = 33.9 bits (74), Expect = 3.0
 Identities = 14/56 (25%), Positives = 28/56 (50%)
 Frame = -3

Query: 210 YNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAERIDAIR 43
           +++A  +I  WL   +   ++  Y  ++ ++Q L   H  + +D  +HA  ID  R
Sbjct: 343 HHQAEHEIAAWLGYPQAVFMASGYQANIATIQLLADPHVTVISDAENHASLIDGCR 398


>UniRef50_A2FHJ4 Cluster: Putative uncharacterized protein; n=1;
           Trichomonas vaginalis G3|Rep: Putative uncharacterized
           protein - Trichomonas vaginalis G3
          Length = 363

 Score = 33.9 bits (74), Expect = 3.0
 Identities = 15/63 (23%), Positives = 36/63 (57%)
 Frame = -3

Query: 231 EAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAERID 52
           E + +QQ +  +++I++  S V+     E  G++  + + L+KK ++L+ ++    E +D
Sbjct: 273 EQSNEQQLHETMKEIDMMPSPVQNDQDYEILGEEQKNGEELEKKRSILKMELRKKEELLD 332

Query: 51  AIR 43
            +R
Sbjct: 333 EVR 335


>UniRef50_Q4RQA7 Cluster: Chromosome 17 SCAF15006, whole genome
            shotgun sequence; n=1; Tetraodon nigroviridis|Rep:
            Chromosome 17 SCAF15006, whole genome shotgun sequence -
            Tetraodon nigroviridis (Green puffer)
          Length = 6846

 Score = 33.5 bits (73), Expect = 3.9
 Identities = 14/53 (26%), Positives = 30/53 (56%), Gaps = 1/53 (1%)
 Frame = -3

Query: 216  QQYNRAVEDIELWLSEVEGQLL-SEDYGKDLTSVQNLQKKHALLEADVSSHAE 61
            QQ++  +E +  WL   E  L+ SE  G + + +++   +H  LE ++ +H++
Sbjct: 4934 QQFHETLEPLSEWLGATEKHLINSEPIGTETSKLEDQISQHKALEEEIMNHSK 4986


>UniRef50_Q07FY0 Cluster: Envoplakin; n=2; Xenopus tropicalis|Rep:
           Envoplakin - Xenopus tropicalis (Western clawed frog)
           (Silurana tropicalis)
          Length = 1182

 Score = 33.5 bits (73), Expect = 3.9
 Identities = 16/54 (29%), Positives = 32/54 (59%), Gaps = 1/54 (1%)
 Frame = -1

Query: 422 QKHQNFEQE-LQANKPRVDEITAVGKRLLELEHFAQPQISSRVEELGGIWERLV 264
           ++++ F+ E L   +  V+++   G+R++EL+H A P I +  E L G W+  +
Sbjct: 254 RQYEKFKSEDLLPQEENVNQLLDDGERMIELKHPAAPCIQAHHEALKGEWQNFL 307


>UniRef50_Q2G714 Cluster: Putative uncharacterized protein
           precursor; n=1; Novosphingobium aromaticivorans DSM
           12444|Rep: Putative uncharacterized protein precursor -
           Novosphingobium aromaticivorans (strain DSM 12444)
          Length = 433

 Score = 33.5 bits (73), Expect = 3.9
 Identities = 22/78 (28%), Positives = 40/78 (51%)
 Frame = -3

Query: 288 GRNMGATGAVFELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNL 109
           G  +GATGAV + K  K+ +A    ++ +A + ++  +++V          KD  + Q L
Sbjct: 26  GLAVGATGAVAKEKEQKVAKATNSPEFGKAAQTLQKPIADVTA-------SKDKAAAQAL 78

Query: 108 QKKHALLEADVSSHAERI 55
             + A +EA V +  +RI
Sbjct: 79  IPQLAAIEASVKTPLDRI 96


>UniRef50_Q3R0M6 Cluster: Lysozyme; n=2; Xylella fastidiosa|Rep:
           Lysozyme - Xylella fastidiosa Ann-1
          Length = 80

 Score = 33.5 bits (73), Expect = 3.9
 Identities = 16/30 (53%), Positives = 20/30 (66%)
 Frame = -2

Query: 163 RTAAQRGLREGSDQRAESPEEARAVGGRRE 74
           R AA+R L EGSD RAE  +   A+ GRR+
Sbjct: 51  RRAAERALFEGSDWRAEEKQRRAALKGRRD 80


>UniRef50_Q1V114 Cluster: Cell division particle; n=2; Candidatus
           Pelagibacter ubique|Rep: Cell division particle -
           Candidatus Pelagibacter ubique HTCC1002
          Length = 305

 Score = 33.5 bits (73), Expect = 3.9
 Identities = 15/54 (27%), Positives = 27/54 (50%)
 Frame = -3

Query: 279 MGATGAVFELKGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSV 118
           +G  G + +  GNK+  +A       A+E +E W ++++ Q+     G D  SV
Sbjct: 119 IGKVGKILKSNGNKVMFSACDTFRAAAIEQLESWANKIDVQITKSTQGSDPASV 172


>UniRef50_A0DR68 Cluster: Chromosome undetermined scaffold_60, whole
            genome shotgun sequence; n=1; Paramecium tetraurelia|Rep:
            Chromosome undetermined scaffold_60, whole genome shotgun
            sequence - Paramecium tetraurelia
          Length = 2018

 Score = 33.5 bits (73), Expect = 3.9
 Identities = 17/47 (36%), Positives = 27/47 (57%)
 Frame = +3

Query: 288  QLFHARRYLRLSKMFELKQTLADGRYLVDARLVGLQLLFEVLMFLHL 428
            QLF   R LR++K+F L + L   + L+D     L  LFE+++ + L
Sbjct: 1601 QLFRVFRVLRVTKLFRLVKQLKGLKKLIDTATFALPELFELILLMLL 1647


>UniRef50_UPI000065D76F Cluster: Homolog of Homo sapiens "Bullous
           pemphigoid antigen 1, 230\/240kDa; n=1; Takifugu
           rubripes|Rep: Homolog of Homo sapiens "Bullous
           pemphigoid antigen 1, 230\/240kDa - Takifugu rubripes
          Length = 2064

 Score = 33.1 bits (72), Expect = 5.2
 Identities = 17/65 (26%), Positives = 33/65 (50%), Gaps = 1/65 (1%)
 Frame = -3

Query: 225 AQQQQYNRAVEDIELWLSE-VEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAERIDA 49
           A  QQ+++  +D + WLSE ++ QL  +        +Q   ++H+ L+  +S H +  + 
Sbjct: 750 ASSQQFHQTSKDFQSWLSEKLQDQLKPQAISAKADPLQQSLEEHSKLQELLSEHEDAYNT 809

Query: 48  IREPG 34
           I   G
Sbjct: 810 IMREG 814


>UniRef50_A1AUB9 Cluster: DTDP-4-dehydrorhamnose 3,5-epimerase; n=3;
           Bacteria|Rep: DTDP-4-dehydrorhamnose 3,5-epimerase -
           Pelobacter propionicus (strain DSM 2379)
          Length = 187

 Score = 33.1 bits (72), Expect = 5.2
 Identities = 14/32 (43%), Positives = 19/32 (59%)
 Frame = +1

Query: 505 FYHNRVSNC*YFVGRSFQGERGRLVRLFSSKS 600
           F H R+S C   V   FQ ERGR V+ ++ K+
Sbjct: 3   FIHTRISGCLEIVPVCFQDERGRFVKTYNEKT 34


>UniRef50_Q7KY09 Cluster: Trio; n=10; Diptera|Rep: Trio - Drosophila
           melanogaster (Fruit fly)
          Length = 2263

 Score = 33.1 bits (72), Expect = 5.2
 Identities = 15/49 (30%), Positives = 23/49 (46%)
 Frame = -1

Query: 419 KHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEELGGIWE 273
           +HQ F          +D I AV  RL+E +H+A   I +  + L   W+
Sbjct: 356 EHQKFAVASMNVSVNIDRILAVAARLIESQHYAAQHIKTLAQRLDRTWK 404


>UniRef50_Q5BRC3 Cluster: SJCHGC08698 protein; n=1; Schistosoma
           japonicum|Rep: SJCHGC08698 protein - Schistosoma
           japonicum (Blood fluke)
          Length = 136

 Score = 33.1 bits (72), Expect = 5.2
 Identities = 18/71 (25%), Positives = 37/71 (52%)
 Frame = -3

Query: 246 GNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSH 67
           G KL+E    Q++ + V+D E WL+E +  +++E       ++  L  +    E ++ ++
Sbjct: 16  GQKLKEQLHLQEFCQDVDDAEEWLAE-KAMVITEQPTPLARNIAALYGRFKAFEGELDAN 74

Query: 66  AERIDAIREPG 34
            E+I  + E G
Sbjct: 75  KEKIAKVIEEG 85



 Score = 32.7 bits (71), Expect = 6.9
 Identities = 17/63 (26%), Positives = 31/63 (49%)
 Frame = -1

Query: 440 NLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEELGGIWERLVQ 261
           N+     + + FE EL ANK ++ ++   G+ L+      Q Q+  ++  L   WE L  
Sbjct: 56  NIAALYGRFKAFEGELDANKEKIAKVIEEGEELIAAHPILQVQVEPKICALRKQWEDLNT 115

Query: 260 SSS 252
           S++
Sbjct: 116 STA 118


>UniRef50_Q5TBT1 Cluster: Dystonin; n=33; Euteleostomi|Rep: Dystonin
           - Homo sapiens (Human)
          Length = 5457

 Score = 33.1 bits (72), Expect = 5.2
 Identities = 16/53 (30%), Positives = 32/53 (60%), Gaps = 1/53 (1%)
 Frame = -3

Query: 252 LKGNKLQEAAQQQQYN-RAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKH 97
           LK + L +   +++ N + V+D+  W+ E++ QL   ++G DL SV++  + H
Sbjct: 589 LKSSLLDQNLTEEEINMKFVQDLLNWVDEMQVQLDRTEWGSDLPSVESHLENH 641



 Score = 32.7 bits (71), Expect = 6.9
 Identities = 14/55 (25%), Positives = 31/55 (56%), Gaps = 1/55 (1%)
 Frame = -3

Query: 216  QQYNRAVEDIELWLSEVEGQLLS-EDYGKDLTSVQNLQKKHALLEADVSSHAERI 55
            QQ++  +E +  WL+ +E +L++ E  G   + ++    +H  LE D+ +H + +
Sbjct: 3418 QQFHETLEPLNEWLTTIEKRLVNCEPIGTQASKLEEQIAQHKALEDDIINHNKHL 3472


>UniRef50_Q9QXZ0 Cluster: Microtubule-actin cross-linking factor 1;
            n=38; cellular organisms|Rep: Microtubule-actin
            cross-linking factor 1 - Mus musculus (Mouse)
          Length = 5327

 Score = 33.1 bits (72), Expect = 5.2
 Identities = 19/80 (23%), Positives = 36/80 (45%), Gaps = 1/80 (1%)
 Frame = -1

Query: 449  DPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQ-PQISSRVEELGGIWE 273
            DP  +  ++ KH   + ++ A++  V  +   G  LLE         + SR+E +   WE
Sbjct: 4184 DPKVIEVELAKHHVLKNDVLAHQATVATVNKAGSELLESSAGDDASSLRSRLETMNQCWE 4243

Query: 272  RLVQSSS*RETSCRKRLNNS 213
             ++Q +  RE   +  L  +
Sbjct: 4244 SVLQKTEEREQQLQSTLQQA 4263


>UniRef50_O94833 Cluster: Bullous pemphigoid antigen 1, isoforms
           6/9/10; n=42; Euteleostomi|Rep: Bullous pemphigoid
           antigen 1, isoforms 6/9/10 - Homo sapiens (Human)
          Length = 5171

 Score = 33.1 bits (72), Expect = 5.2
 Identities = 16/53 (30%), Positives = 32/53 (60%), Gaps = 1/53 (1%)
 Frame = -3

Query: 252 LKGNKLQEAAQQQQYN-RAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKH 97
           LK + L +   +++ N + V+D+  W+ E++ QL   ++G DL SV++  + H
Sbjct: 263 LKSSLLDQNLTEEEINMKFVQDLLNWVDEMQVQLDRTEWGSDLPSVESHLENH 315



 Score = 32.7 bits (71), Expect = 6.9
 Identities = 14/55 (25%), Positives = 31/55 (56%), Gaps = 1/55 (1%)
 Frame = -3

Query: 216  QQYNRAVEDIELWLSEVEGQLLS-EDYGKDLTSVQNLQKKHALLEADVSSHAERI 55
            QQ++  +E +  WL+ +E +L++ E  G   + ++    +H  LE D+ +H + +
Sbjct: 3092 QQFHETLEPLNEWLTTIEKRLVNCEPIGTQASKLEEQIAQHKALEDDIINHNKHL 3146


>UniRef50_Q91ZU6 Cluster: Bullous pemphigoid antigen 1, isoforms
           1/2/3/4; n=16; cellular organisms|Rep: Bullous
           pemphigoid antigen 1, isoforms 1/2/3/4 - Mus musculus
           (Mouse)
          Length = 7389

 Score = 33.1 bits (72), Expect = 5.2
 Identities = 16/53 (30%), Positives = 32/53 (60%), Gaps = 1/53 (1%)
 Frame = -3

Query: 252 LKGNKLQEAAQQQQYN-RAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKH 97
           LK + L +   +++ N + V+D+  W+ E++ QL   ++G DL SV++  + H
Sbjct: 589 LKSSLLDQNLTEEEVNMKFVQDLLNWVDEMQVQLDRTEWGSDLPSVESHLENH 641



 Score = 32.3 bits (70), Expect = 9.1
 Identities = 14/38 (36%), Positives = 23/38 (60%)
 Frame = -1

Query: 452  LDPTNLNGKVQKHQNFEQELQANKPRVDEITAVGKRLL 339
            +DP  LN + Q+ Q   QE    KP+ +++TA G+ +L
Sbjct: 4582 IDPNMLNTQKQQVQILLQEFDTRKPQYEQLTAAGQGIL 4619


>UniRef50_Q03001 Cluster: Bullous pemphigoid antigen 1, isoforms
           1/2/3/4/5/8; n=14; Eutheria|Rep: Bullous pemphigoid
           antigen 1, isoforms 1/2/3/4/5/8 - Homo sapiens (Human)
          Length = 3214

 Score = 33.1 bits (72), Expect = 5.2
 Identities = 16/53 (30%), Positives = 32/53 (60%), Gaps = 1/53 (1%)
 Frame = -3

Query: 252 LKGNKLQEAAQQQQYN-RAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKH 97
           LK + L +   +++ N + V+D+  W+ E++ QL   ++G DL SV++  + H
Sbjct: 773 LKSSLLDQNLTEEEINMKFVQDLLNWVDEMQVQLDRTEWGSDLPSVESHLENH 825


>UniRef50_O43707 Cluster: Alpha-actinin-4; n=186; Eumetazoa|Rep:
           Alpha-actinin-4 - Homo sapiens (Human)
          Length = 911

 Score = 33.1 bits (72), Expect = 5.2
 Identities = 15/48 (31%), Positives = 26/48 (54%), Gaps = 1/48 (2%)
 Frame = -3

Query: 186 ELWLSEVEGQLLSEDYGK-DLTSVQNLQKKHALLEADVSSHAERIDAI 46
           E W    E  L   DY    L+ ++ L +KH   E+D+++H +R++ I
Sbjct: 426 EAWTDGKEAMLKHRDYETATLSDIKALIRKHEAFESDLAAHQDRVEQI 473


>UniRef50_UPI0000E81ECF Cluster: PREDICTED: similar to protocadherin
           beta 20; n=2; Gallus gallus|Rep: PREDICTED: similar to
           protocadherin beta 20 - Gallus gallus
          Length = 808

 Score = 32.7 bits (71), Expect = 6.9
 Identities = 21/52 (40%), Positives = 27/52 (51%), Gaps = 1/52 (1%)
 Frame = -3

Query: 438 PEWQGAETSELRTGAAGQQASRRRDNGRRQASA*ARTFCSTSNI-VSRGRAG 286
           P   GAE      G A + A++R   GRR+  A A + C  S + VSR RAG
Sbjct: 77  PGQGGAERLRAGRGRAQRSAAQRSAGGRRRRRAAAESCCPCSELGVSRRRAG 128


>UniRef50_Q8JG61 Cluster: Protein 4.1; n=1; Danio rerio|Rep: Protein
           4.1 - Danio rerio (Zebrafish) (Brachydanio rerio)
          Length = 1534

 Score = 32.7 bits (71), Expect = 6.9
 Identities = 16/49 (32%), Positives = 27/49 (55%)
 Frame = -3

Query: 243 NKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKH 97
           + + E AQ ++  R VE IEL L E    L+ E+  +   + + +QK+H
Sbjct: 626 SSIPEGAQAEEVKREVEKIELVLPEKPKTLMREETIQSRVTTEEIQKEH 674


>UniRef50_UPI0000F1F58B Cluster: PREDICTED: similar to dystonin;
           n=1; Danio rerio|Rep: PREDICTED: similar to dystonin -
           Danio rerio
          Length = 3225

 Score = 32.3 bits (70), Expect = 9.1
 Identities = 17/53 (32%), Positives = 30/53 (56%), Gaps = 1/53 (1%)
 Frame = -3

Query: 252 LKGNKLQEAAQQQQYN-RAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKH 97
           LK + L     + + N + V+D+  W+ E++ QL   ++G DL SV++   KH
Sbjct: 558 LKSSFLDPNLSEDEANMKFVQDLLSWVEEMQVQLDQAEWGSDLLSVESNLGKH 610


>UniRef50_UPI000069EF7E Cluster: Bullous pemphigoid antigen 1
           isoforms 1/2/3/4/5/8 (230 kDa bullous pemphigoid
           antigen) (BPA) (Hemidesmosomal plaque protein) (Dystonia
           musculorum protein) (Dystonin); n=2; Tetrapoda|Rep:
           Bullous pemphigoid antigen 1 isoforms 1/2/3/4/5/8 (230
           kDa bullous pemphigoid antigen) (BPA) (Hemidesmosomal
           plaque protein) (Dystonia musculorum protein) (Dystonin)
           - Xenopus tropicalis
          Length = 1418

 Score = 32.3 bits (70), Expect = 9.1
 Identities = 12/46 (26%), Positives = 28/46 (60%)
 Frame = -3

Query: 234 QEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKH 97
           Q   +++  ++ V+D+  W+ E++ QL   ++G DL+S++   + H
Sbjct: 474 QNLPEEEVNSKFVQDLLSWIEEMQVQLDRAEWGSDLSSIEGHLENH 519


>UniRef50_Q01WV5 Cluster: Glycoside hydrolase family 2, sugar
           binding precursor; n=1; Solibacter usitatus
           Ellin6076|Rep: Glycoside hydrolase family 2, sugar
           binding precursor - Solibacter usitatus (strain
           Ellin6076)
          Length = 828

 Score = 32.3 bits (70), Expect = 9.1
 Identities = 15/31 (48%), Positives = 19/31 (61%)
 Frame = +2

Query: 386 WPAAPVRSSDVSAPCHSGWSDPSTSRRWRTF 478
           WPAAPVR+S  +A   SG    S ++ WR F
Sbjct: 17  WPAAPVRASGATAVTVSGERRQSFNQGWRFF 47


>UniRef50_Q01A79 Cluster: JERF3; n=2; Ostreococcus|Rep: JERF3 -
           Ostreococcus tauri
          Length = 490

 Score = 32.3 bits (70), Expect = 9.1
 Identities = 22/64 (34%), Positives = 28/64 (43%)
 Frame = -3

Query: 399 GAAGQQASRRRDNGRRQASA*ARTFCSTSNIVSRGRAGRNMGATGAVFELKGNKLQEAAQ 220
           G  G++A  R    RR   + AR    T    + GR  R  GA  A  E KG+K  + A 
Sbjct: 44  GGGGRRARDRGVGDRRVGGSGARACAGTGGWGAAGRDERLTGAFRATQEGKGDKQSKKAT 103

Query: 219 QQQY 208
             QY
Sbjct: 104 TSQY 107


>UniRef50_Q9BJD3 Cluster: Major plasmodial myosin heavy chain; n=3;
            Physarum polycephalum|Rep: Major plasmodial myosin heavy
            chain - Physarum polycephalum (Slime mold)
          Length = 2148

 Score = 32.3 bits (70), Expect = 9.1
 Identities = 32/115 (27%), Positives = 54/115 (46%), Gaps = 3/115 (2%)
 Frame = -3

Query: 396  AAGQQASRRRDNGRRQASA*ARTFCSTSNIVSRGRA--GRNMGATGAVFELKGNKL-QEA 226
            A  Q+     D  +++A    +   S    VS  RA   +N+ AT    E    +L QE 
Sbjct: 1234 AEEQRDKAALDKAKKKADQDVKELKSNLENVSASRATLDQNLKATEEKLENAKVELEQEQ 1293

Query: 225  AQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAE 61
              +QQ  +A + +E  L  V+GQL  E  G+D+     + +K + LE++++   E
Sbjct: 1294 KTKQQLEKAKKLLETELHAVQGQLDDEKKGRDI-----VDRKRSDLESELADLRE 1343


>UniRef50_A7EE60 Cluster: Putative uncharacterized protein; n=1;
           Sclerotinia sclerotiorum 1980|Rep: Putative
           uncharacterized protein - Sclerotinia sclerotiorum 1980
          Length = 185

 Score = 32.3 bits (70), Expect = 9.1
 Identities = 27/93 (29%), Positives = 41/93 (44%), Gaps = 4/93 (4%)
 Frame = -3

Query: 429 QGAETSELRTGAAGQ---QASRRRDNGRRQASA*ARTFCSTSNIVSRGR-AGRNMGATGA 262
           QGA  S+ ++G   Q   +A RR+D G  +A A       TS  + + +  GRN+     
Sbjct: 54  QGAGVSKKKSGRKSQLSSKAKRRQDKGLDRAEA---VMDRTSTKIEKSKYRGRNVQERAK 110

Query: 261 VFELKGNKLQEAAQQQQYNRAVEDIELWLSEVE 163
            +E    K QEA Q         + E+   +VE
Sbjct: 111 AWETLNKKAQEAVQAAMEKEKENEDEVSEEDVE 143


>UniRef50_P39922 Cluster: Myosin heavy chain, clone 203; n=2; Hydra
           vulgaris|Rep: Myosin heavy chain, clone 203 - Hydra
           attenuata (Hydra) (Hydra vulgaris)
          Length = 539

 Score = 32.3 bits (70), Expect = 9.1
 Identities = 36/133 (27%), Positives = 56/133 (42%), Gaps = 8/133 (6%)
 Frame = -1

Query: 602 RLLLEKSRTKRPRSPWKDRPTKYQQFETRL**N*RL-GKRES*KFATDDSYLDPTNLNGK 426
           ++ LEK + K+  S  KD   K  + ETRL     L  KRE    +  D       L  +
Sbjct: 248 KMKLEKEK-KKVESDLKDNRDKLSETETRLKETQDLVTKREK---SISDLENAKEGLESQ 303

Query: 425 VQKHQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEEL-------GGIWERL 267
           + + Q   QEL A    ++E     ++L +     + ++ SR+EEL       GG     
Sbjct: 304 ISQLQRKIQELLAKIEELEEELENERKLRQKSELQRKELESRIEELQDQLETAGGATSAQ 363

Query: 266 VQSSS*RETSCRK 228
           V+    RE  C +
Sbjct: 364 VEVGKKREAECNR 376


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 582,485,551
Number of Sequences: 1657284
Number of extensions: 11282630
Number of successful extensions: 48033
Number of sequences better than 10.0: 85
Number of HSP's better than 10.0 without gapping: 45066
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 47983
length of database: 575,637,011
effective HSP length: 97
effective length of database: 414,880,463
effective search space used: 42732687689
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).