SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0035
         (392 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_O65314 Cluster: Actin; n=20; Eukaryota|Rep: Actin - Sch...   100   9e-21
UniRef50_Q4JSC0 Cluster: Actin; n=13; Coelomata|Rep: Actin - Ano...   100   1e-20
UniRef50_Q96483 Cluster: Actin-51; n=584; Eukaryota|Rep: Actin-5...    96   2e-19
UniRef50_P02581 Cluster: Actin-1; n=1852; Eukaryota|Rep: Actin-1...    90   1e-17
UniRef50_P14883 Cluster: Actin-2; n=75; Eukaryota|Rep: Actin-2 -...    85   5e-16
UniRef50_Q0VHZ5 Cluster: Actin deviating protein; n=7; Eukaryota...    78   7e-14
UniRef50_Q0VHZ6 Cluster: Actin deviating protein; n=2; Bolivina ...    71   8e-12
UniRef50_UPI00005A2ACF Cluster: PREDICTED: similar to cytoplasmi...    70   1e-11
UniRef50_UPI00006C1719 Cluster: PREDICTED: similar to actin, alp...    68   7e-11
UniRef50_UPI0000449751 Cluster: PREDICTED: similar to gamma-acti...    68   7e-11
UniRef50_UPI0000588EB0 Cluster: PREDICTED: similar to actin; n=1...    67   1e-10
UniRef50_A7RPC3 Cluster: Predicted protein; n=3; Eumetazoa|Rep: ...    64   9e-10
UniRef50_Q9XZB9 Cluster: Actin; n=1; Sterkiella nova|Rep: Actin ...    62   3e-09
UniRef50_A4QNT8 Cluster: Si:ch211-241j12.3 protein; n=3; Danio r...    62   5e-09
UniRef50_UPI000065FC19 Cluster: Homolog of Homo sapiens "Actin, ...    60   1e-08
UniRef50_UPI0000E466A7 Cluster: PREDICTED: similar to actin, alp...    60   2e-08
UniRef50_P61163 Cluster: Alpha-centractin; n=356; root|Rep: Alph...    58   5e-08
UniRef50_UPI0000F2D326 Cluster: PREDICTED: similar to actin; n=1...    56   2e-07
UniRef50_UPI0000E23780 Cluster: PREDICTED: hypothetical protein ...    56   2e-07
UniRef50_Q8LKR2 Cluster: Actin-related protein 4; n=7; core eudi...    56   3e-07
UniRef50_Q2GY63 Cluster: Putative uncharacterized protein; n=1; ...    56   3e-07
UniRef50_UPI0000EBF019 Cluster: PREDICTED: similar to ribosomal ...    55   4e-07
UniRef50_A7QKV4 Cluster: Chromosome chr8 scaffold_115, whole gen...    54   7e-07
UniRef50_UPI0000F2D825 Cluster: PREDICTED: similar to actin; n=1...    54   1e-06
UniRef50_Q24C02 Cluster: Actin family protein; n=3; Oligohymenop...    53   2e-06
UniRef50_A2DKQ5 Cluster: Actin 58, putative; n=2; Trichomonas va...    53   2e-06
UniRef50_UPI0000605B09 Cluster: PREDICTED: similar to actin alph...    52   4e-06
UniRef50_UPI00001E426E Cluster: PREDICTED: similar to actin-12; ...    52   4e-06
UniRef50_A5E2K2 Cluster: Actin; n=5; Saccharomycetales|Rep: Acti...    52   4e-06
UniRef50_Q7XB26 Cluster: Ubiquitin/actin fusion protein 4; n=1; ...    51   9e-06
UniRef50_UPI00015B6274 Cluster: PREDICTED: similar to putative m...    50   1e-05
UniRef50_O96819 Cluster: Actin-related protein; n=5; Trypanosoma...    50   2e-05
UniRef50_Q00UL2 Cluster: Alpha amylase 1; n=3; Ostreococcus|Rep:...    49   3e-05
UniRef50_A3BPG0 Cluster: Putative uncharacterized protein; n=3; ...    48   5e-05
UniRef50_UPI0001554F81 Cluster: PREDICTED: similar to actin; n=1...    48   6e-05
UniRef50_Q5KB93 Cluster: Actin binding protein, putative; n=3; F...    48   6e-05
UniRef50_Q4CV94 Cluster: Actin 2, putative; n=2; Trypanosoma cru...    47   1e-04
UniRef50_Q4QG59 Cluster: Actin-like protein, putative; n=3; Leis...    47   1e-04
UniRef50_P61160 Cluster: Actin-related protein 2; n=96; Eukaryot...    46   2e-04
UniRef50_A4RW28 Cluster: Predicted protein; n=2; Ostreococcus|Re...    44   8e-04
UniRef50_A2EUM6 Cluster: Actin family protein; n=1; Trichomonas ...    44   8e-04
UniRef50_Q0J646 Cluster: Os08g0369300 protein; n=2; Oryza sativa...    44   0.001
UniRef50_A2YUL5 Cluster: Putative uncharacterized protein; n=1; ...    44   0.001
UniRef50_Q4SGD5 Cluster: Chromosome 17 SCAF14597, whole genome s...    44   0.001
UniRef50_Q5CKL2 Cluster: BRG1/brm-associated factor 53A; n=2; Cr...    44   0.001
UniRef50_A2FRF9 Cluster: Actin family protein; n=1; Trichomonas ...    44   0.001
UniRef50_UPI0000D9A391 Cluster: PREDICTED: actin related protein...    43   0.002
UniRef50_UPI00005864C8 Cluster: PREDICTED: similar to Actin; n=4...    43   0.002
UniRef50_Q17GZ9 Cluster: Actin-related protein 5; n=4; Endoptery...    43   0.002
UniRef50_Q4DMP2 Cluster: Actin-related protein 2, putative; n=4;...    42   0.003
UniRef50_A7S2B1 Cluster: Predicted protein; n=1; Nematostella ve...    42   0.003
UniRef50_A2ECQ8 Cluster: Actin family protein; n=1; Trichomonas ...    42   0.003
UniRef50_A0E1S8 Cluster: Chromosome undetermined scaffold_73, wh...    42   0.003
UniRef50_Q19R56 Cluster: Actin-like protein 3; n=4; Trypanosoma ...    42   0.004
UniRef50_Q54UQ7 Cluster: Actin-like protein 6A; n=1; Dictyosteli...    42   0.006
UniRef50_Q4N681 Cluster: Actin, putative; n=3; Piroplasmida|Rep:...    42   0.006
UniRef50_Q22WQ4 Cluster: Actin family protein; n=1; Tetrahymena ...    42   0.006
UniRef50_Q5KLG9 Cluster: 53 kDa brg1-associated factor b (Actin-...    41   0.007
UniRef50_Q9BYD9 Cluster: Actin-related protein M1; n=12; Theria|...    41   0.007
UniRef50_Q5C683 Cluster: SJCHGC08418 protein; n=1; Schistosoma j...    41   0.010
UniRef50_Q4P2E8 Cluster: Actin-related protein 4; n=1; Ustilago ...    41   0.010
UniRef50_Q9DFB8 Cluster: Actin; n=1; Scomberomorus maculatus|Rep...    40   0.013
UniRef50_Q7M3B0 Cluster: Actin beta; n=1; Sus scrofa domestica|R...    40   0.013
UniRef50_P61158 Cluster: Actin-related protein 3; n=107; Eukaryo...    40   0.013
UniRef50_A4S826 Cluster: Predicted protein; n=1; Ostreococcus lu...    40   0.017
UniRef50_Q8TDY3 Cluster: Actin-related protein T2; n=26; Amniota...    40   0.023
UniRef50_Q7M3Y5 Cluster: Actin; n=1; Aplysia californica|Rep: Ac...    39   0.030
UniRef50_A0D9D5 Cluster: Chromosome undetermined scaffold_42, wh...    39   0.030
UniRef50_Q9H568 Cluster: Actin-like protein 8; n=10; Eutheria|Re...    39   0.030
UniRef50_O96019 Cluster: Actin-like protein 6A; n=63; Eumetazoa|...    39   0.030
UniRef50_UPI000049A548 Cluster: actin; n=1; Entamoeba histolytic...    39   0.039
UniRef50_Q55DS6 Cluster: Putative uncharacterized protein; n=1; ...    39   0.039
UniRef50_A6R1X8 Cluster: Putative uncharacterized protein; n=1; ...    39   0.039
UniRef50_Q9P7X7 Cluster: Actin-related protein 4; n=1; Schizosac...    39   0.039
UniRef50_Q9Y615 Cluster: Actin-like protein 7A; n=11; Mammalia|R...    39   0.039
UniRef50_UPI0000498FDF Cluster: actin; n=1; Entamoeba histolytic...    38   0.052
UniRef50_A2VD47 Cluster: Zgc:158823 protein; n=3; Eukaryota|Rep:...    38   0.052
UniRef50_Q8IIQ4 Cluster: Actin, putative; n=7; Apicomplexa|Rep: ...    38   0.052
UniRef50_Q38F20 Cluster: Actin-like protein 3, putative; n=1; Tr...    38   0.052
UniRef50_UPI0000F2DE11 Cluster: PREDICTED: similar to testis-spe...    38   0.069
UniRef50_Q54E71 Cluster: Putative uncharacterized protein; n=1; ...    38   0.069
UniRef50_UPI0000F2D272 Cluster: PREDICTED: similar to actin; n=1...    38   0.091
UniRef50_A7TST0 Cluster: Putative uncharacterized protein; n=1; ...    38   0.091
UniRef50_P32392 Cluster: Actin-related protein 3; n=27; Eukaryot...    38   0.091
UniRef50_Q18PR4 Cluster: Actin-related protein; n=1; Porphyra ye...    37   0.12 
UniRef50_Q5C3R3 Cluster: SJCHGC08022 protein; n=1; Schistosoma j...    37   0.12 
UniRef50_P80428 Cluster: Actin-related protein 4; n=4; Saccharom...    37   0.16 
UniRef50_Q4Q2Y4 Cluster: Putative uncharacterized protein; n=3; ...    36   0.21 
UniRef50_A2FH22 Cluster: Actin family protein; n=1; Trichomonas ...    36   0.21 
UniRef50_Q0H7S7 Cluster: Actin; n=29; Sordariomycetes|Rep: Actin...    36   0.28 
UniRef50_Q7SHR0 Cluster: Actin-related protein 4; n=16; Pezizomy...    36   0.28 
UniRef50_Q9NZ32 Cluster: Actin-related protein 10; n=40; Eumetaz...    36   0.28 
UniRef50_Q7UE30 Cluster: Similar to preprotein translocase SecA ...    36   0.37 
UniRef50_A2YQV6 Cluster: Putative uncharacterized protein; n=1; ...    36   0.37 
UniRef50_Q6C061 Cluster: Actin-related protein 4; n=1; Yarrowia ...    36   0.37 
UniRef50_Q6CSB9 Cluster: Actin-related protein 4; n=1; Kluyverom...    36   0.37 
UniRef50_Q8IS27 Cluster: Actin-related protein 2; n=5; Oligohyme...    35   0.48 
UniRef50_Q4UGT7 Cluster: Actin-related protein, putative; n=2; T...    35   0.48 
UniRef50_Q383R8 Cluster: Actin-like protein, putative; n=4; Tryp...    35   0.48 
UniRef50_A2DBN6 Cluster: Actin family protein; n=1; Trichomonas ...    35   0.48 
UniRef50_Q6X960 Cluster: HSD21; n=13; Theria|Rep: HSD21 - Homo s...    35   0.48 
UniRef50_Q09849 Cluster: Uncharacterized protein C23D3.09; n=1; ...    35   0.48 
UniRef50_Q4Q187 Cluster: Actin-like protein, putative; n=3; Leis...    34   0.85 
UniRef50_Q19R57 Cluster: Actin-like protein 1; n=2; Trypanosoma ...    34   0.85 
UniRef50_Q9LHH0 Cluster: Actin-like protein; n=11; Magnoliophyta...    34   1.1  
UniRef50_A3FQE6 Cluster: Putative uncharacterized protein; n=2; ...    34   1.1  
UniRef50_Q6C0A9 Cluster: Yarrowia lipolytica chromosome F of str...    34   1.1  
UniRef50_UPI0000449ED3 Cluster: PREDICTED: similar to RIKEN cDNA...    33   1.5  
UniRef50_Q55DY5 Cluster: Putative uncharacterized protein; n=1; ...    33   1.5  
UniRef50_Q6FRF2 Cluster: Similar to sp|P38696 Saccharomyces cere...    33   1.5  
UniRef50_UPI0000E47BC7 Cluster: PREDICTED: similar to ubiquitin/...    33   2.0  
UniRef50_A5B4L4 Cluster: Putative uncharacterized protein; n=1; ...    33   2.0  
UniRef50_Q54JL1 Cluster: Putative uncharacterized protein; n=1; ...    33   2.0  
UniRef50_Q4N7N1 Cluster: Actin, putative; n=2; Theileria|Rep: Ac...    33   2.0  
UniRef50_UPI0000E477BD Cluster: PREDICTED: similar to uncharacte...    33   2.6  
UniRef50_UPI0000EC9F4D Cluster: HSD21.; n=2; Gallus gallus|Rep: ...    32   3.4  
UniRef50_Q6LBB8 Cluster: Putative uncharacterized protein; n=1; ...    32   3.4  
UniRef50_Q3M0X0 Cluster: Actin6-2; n=3; Paramecium tetraurelia|R...    32   3.4  
UniRef50_Q2PE20 Cluster: CG10067-PB, isoform B; n=1; Drosophila ...    32   3.4  
UniRef50_Q6BIA3 Cluster: CA5059|IPF3691 Candida albicans IPF3691...    32   3.4  
UniRef50_Q7P253 Cluster: Putative uncharacterized protein; n=1; ...    32   4.5  
UniRef50_Q3VWM2 Cluster: Putative uncharacterized protein; n=2; ...    32   4.5  
UniRef50_Q19R70 Cluster: Actin-like protein 3; n=4; Leishmania|R...    32   4.5  
UniRef50_Q8SRZ3 Cluster: ACTIN-RELATED PROTEIN; n=1; Encephalito...    32   4.5  
UniRef50_Q4WA13 Cluster: Chromatin remodeling complex subunit (A...    32   4.5  
UniRef50_Q2H0E9 Cluster: Putative uncharacterized protein; n=1; ...    32   4.5  
UniRef50_UPI0000E80C06 Cluster: PREDICTED: hypothetical protein;...    31   6.0  
UniRef50_Q7QA11 Cluster: ENSANGP00000003921; n=1; Anopheles gamb...    31   6.0  
UniRef50_Q5CSX9 Cluster: Actin; n=2; Cryptosporidium|Rep: Actin ...    31   6.0  
UniRef50_A2FYS8 Cluster: Actin family protein; n=1; Trichomonas ...    31   6.0  
UniRef50_Q9Y7X8 Cluster: Actin-like protein Arp5; n=1; Schizosac...    31   6.0  
UniRef50_A6RD01 Cluster: Putative uncharacterized protein; n=1; ...    31   6.0  
UniRef50_P54829 Cluster: Tyrosine-protein phosphatase non-recept...    31   6.0  
UniRef50_Q9Y614 Cluster: Actin-like protein 7B; n=12; Theria|Rep...    31   6.0  
UniRef50_UPI0000F2D271 Cluster: PREDICTED: similar to actin-like...    31   7.9  
UniRef50_UPI00005A3B5D Cluster: PREDICTED: similar to Actin-5C; ...    31   7.9  
UniRef50_UPI000023ED98 Cluster: hypothetical protein FG07920.1; ...    31   7.9  
UniRef50_A4KCE4 Cluster: Tautomycetin biosynthetic PKS; n=2; cel...    31   7.9  
UniRef50_Q8I450 Cluster: Actin-related protein, putative; n=5; P...    31   7.9  
UniRef50_Q4QJC9 Cluster: Putative uncharacterized protein; n=2; ...    31   7.9  
UniRef50_Q4QAS6 Cluster: Putative uncharacterized protein; n=4; ...    31   7.9  
UniRef50_A7AQU0 Cluster: Actin-related, putative; n=1; Babesia b...    31   7.9  
UniRef50_A1CF15 Cluster: Phospholipase, patatin family protein; ...    31   7.9  
UniRef50_Q5UR55 Cluster: Uncharacterized protein L581; n=1; Acan...    31   7.9  
UniRef50_P10220 Cluster: Large tegument protein; n=18; root|Rep:...    31   7.9  

>UniRef50_O65314 Cluster: Actin; n=20; Eukaryota|Rep: Actin -
           Scherffelia dubia
          Length = 378

 Score =  100 bits (240), Expect = 9e-21
 Identities = 42/47 (89%), Positives = 46/47 (97%)
 Frame = +1

Query: 250 GKPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIATNWDDM 390
           G+PRHQGVMVGMGQKD+YVGDEAQSKRGILTLKYPIEHG+ +NWDDM
Sbjct: 39  GRPRHQGVMVGMGQKDAYVGDEAQSKRGILTLKYPIEHGVVSNWDDM 85



 Score = 65.3 bits (152), Expect = 4e-10
 Identities = 31/37 (83%), Positives = 32/37 (86%)
 Frame = +2

Query: 149 DEEVAALVVDNGSGMCKAGFAGYDAPRAVFPSIVGSP 259
           D EV+ALV DNGSGM KAGFAG DAPRAVFPSIVG P
Sbjct: 5   DGEVSALVCDNGSGMVKAGFAGDDAPRAVFPSIVGRP 41


>UniRef50_Q4JSC0 Cluster: Actin; n=13; Coelomata|Rep: Actin -
           Anopheles gambiae (African malaria mosquito)
          Length = 376

 Score =  100 bits (239), Expect = 1e-20
 Identities = 43/47 (91%), Positives = 45/47 (95%)
 Frame = +1

Query: 250 GKPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIATNWDDM 390
           G+PRHQGVMVGMG KD+YVGDEAQSKRGILTLKYPIEHGI TNWDDM
Sbjct: 37  GRPRHQGVMVGMGNKDAYVGDEAQSKRGILTLKYPIEHGIITNWDDM 83



 Score = 75.4 bits (177), Expect = 4e-13
 Identities = 33/39 (84%), Positives = 35/39 (89%)
 Frame = +2

Query: 143 MCDEEVAALVVDNGSGMCKAGFAGYDAPRAVFPSIVGSP 259
           MCD++  ALVVDNGSGMCKAGFAG DAPRAVFPSIVG P
Sbjct: 1   MCDDDAGALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRP 39


>UniRef50_Q96483 Cluster: Actin-51; n=584; Eukaryota|Rep: Actin-51 -
           Solanum lycopersicum (Tomato) (Lycopersicon esculentum)
          Length = 336

 Score = 95.9 bits (228), Expect = 2e-19
 Identities = 41/47 (87%), Positives = 44/47 (93%)
 Frame = +1

Query: 250 GKPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIATNWDDM 390
           G+PRH GVMVGMGQKD+Y GDEAQSKRGILTLKYPIEHGI +NWDDM
Sbjct: 18  GRPRHTGVMVGMGQKDAYDGDEAQSKRGILTLKYPIEHGIVSNWDDM 64



 Score = 40.3 bits (90), Expect = 0.013
 Identities = 18/20 (90%), Positives = 18/20 (90%)
 Frame = +2

Query: 200 AGFAGYDAPRAVFPSIVGSP 259
           AGFAG DAPRAVFPSIVG P
Sbjct: 1   AGFAGDDAPRAVFPSIVGRP 20


>UniRef50_P02581 Cluster: Actin-1; n=1852; Eukaryota|Rep: Actin-1 -
           Glycine max (Soybean)
          Length = 377

 Score = 90.2 bits (214), Expect = 1e-17
 Identities = 38/47 (80%), Positives = 43/47 (91%)
 Frame = +1

Query: 250 GKPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIATNWDDM 390
           G+PRH  V+VGMGQKD+YVGDEAQ +RGILTLKYPIEHGI +NWDDM
Sbjct: 38  GRPRHTXVVVGMGQKDAYVGDEAQVQRGILTLKYPIEHGIVSNWDDM 84



 Score = 57.6 bits (133), Expect = 8e-08
 Identities = 26/36 (72%), Positives = 29/36 (80%)
 Frame = +2

Query: 152 EEVAALVVDNGSGMCKAGFAGYDAPRAVFPSIVGSP 259
           E++  LV DNG+GM KAG AG DAPRAVFPSIVG P
Sbjct: 5   EDIQPLVCDNGTGMVKAGLAGDDAPRAVFPSIVGRP 40


>UniRef50_P14883 Cluster: Actin-2; n=75; Eukaryota|Rep: Actin-2 -
           Plasmodium falciparum
          Length = 376

 Score = 85.0 bits (201), Expect = 5e-16
 Identities = 35/47 (74%), Positives = 41/47 (87%)
 Frame = +1

Query: 250 GKPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIATNWDDM 390
           G+P+   +M+GM QK+ YVGDEAQ+KRGILTLKYPIEHGI TNWDDM
Sbjct: 36  GRPKMPNIMIGMEQKECYVGDEAQNKRGILTLKYPIEHGIVTNWDDM 82



 Score = 59.3 bits (137), Expect = 3e-08
 Identities = 27/36 (75%), Positives = 29/36 (80%)
 Frame = +2

Query: 152 EEVAALVVDNGSGMCKAGFAGYDAPRAVFPSIVGSP 259
           EE  ALVVDNGSGM K+G AG DAP+ VFPSIVG P
Sbjct: 3   EEAVALVVDNGSGMVKSGLAGDDAPKCVFPSIVGRP 38


>UniRef50_Q0VHZ5 Cluster: Actin deviating protein; n=7;
           Eukaryota|Rep: Actin deviating protein - Bolivina sp.
           isolate 615
          Length = 360

 Score = 77.8 bits (183), Expect = 7e-14
 Identities = 33/47 (70%), Positives = 41/47 (87%)
 Frame = +1

Query: 250 GKPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIATNWDDM 390
           G+ R  GVMVGM QK+ YVGDEAQSKRGIL+L++PI HGI+T+WDD+
Sbjct: 14  GRRRRNGVMVGMAQKNCYVGDEAQSKRGILSLRWPIVHGISTSWDDV 60


>UniRef50_Q0VHZ6 Cluster: Actin deviating protein; n=2; Bolivina sp.
           isolate 615|Rep: Actin deviating protein - Bolivina sp.
           isolate 615
          Length = 387

 Score = 70.9 bits (166), Expect = 8e-12
 Identities = 29/47 (61%), Positives = 36/47 (76%)
 Frame = +1

Query: 250 GKPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIATNWDDM 390
           G  +H+G+ VGM QK  YVGDEAQSKRGIL L +P++ G+  NWDDM
Sbjct: 14  GTLKHRGIFVGMAQKSYYVGDEAQSKRGILKLMHPMQRGVVKNWDDM 60


>UniRef50_UPI00005A2ACF Cluster: PREDICTED: similar to cytoplasmic
           beta-actin; n=1; Canis lupus familiaris|Rep: PREDICTED:
           similar to cytoplasmic beta-actin - Canis familiaris
          Length = 268

 Score = 70.1 bits (164), Expect = 1e-11
 Identities = 31/46 (67%), Positives = 35/46 (76%)
 Frame = +1

Query: 253 KPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIATNWDDM 390
           K +   +MVGMGQKDSY+ +EAQ K GILT KY IEHGI  NWDDM
Sbjct: 91  KAKDLSIMVGMGQKDSYIRNEAQRKWGILTFKYCIEHGIVINWDDM 136


>UniRef50_UPI00006C1719 Cluster: PREDICTED: similar to actin, alpha
           2, smooth muscle, aorta; n=3; Homo/Pan/Gorilla
           group|Rep: PREDICTED: similar to actin, alpha 2, smooth
           muscle, aorta - Homo sapiens
          Length = 183

 Score = 67.7 bits (158), Expect = 7e-11
 Identities = 31/36 (86%), Positives = 32/36 (88%)
 Frame = +1

Query: 283 MGQKDSYVGDEAQSKRGILTLKYPIEHGIATNWDDM 390
           MGQKDSYVGDEAQSK GILTLKYPIE G+ TN DDM
Sbjct: 1   MGQKDSYVGDEAQSKYGILTLKYPIEQGMVTNRDDM 36


>UniRef50_UPI0000449751 Cluster: PREDICTED: similar to gamma-actin;
           n=3; Amniota|Rep: PREDICTED: similar to gamma-actin -
           Gallus gallus
          Length = 377

 Score = 67.7 bits (158), Expect = 7e-11
 Identities = 28/47 (59%), Positives = 38/47 (80%)
 Frame = +1

Query: 250 GKPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIATNWDDM 390
           G P+   VM+GM  +D YVG+EAQSKRGIL+L YP+E+G+ T+WD+M
Sbjct: 40  GYPKFTFVMIGMEHRDWYVGEEAQSKRGILSLTYPMENGVVTSWDNM 86



 Score = 48.0 bits (109), Expect = 6e-05
 Identities = 20/31 (64%), Positives = 24/31 (77%)
 Frame = +2

Query: 167 LVVDNGSGMCKAGFAGYDAPRAVFPSIVGSP 259
           +V DNGSG CKAG +G  APR+V P+IVG P
Sbjct: 12  VVFDNGSGQCKAGLSGEQAPRSVIPTIVGYP 42


>UniRef50_UPI0000588EB0 Cluster: PREDICTED: similar to actin; n=1;
           Strongylocentrotus purpuratus|Rep: PREDICTED: similar to
           actin - Strongylocentrotus purpuratus
          Length = 386

 Score = 67.3 bits (157), Expect = 1e-10
 Identities = 31/51 (60%), Positives = 38/51 (74%), Gaps = 4/51 (7%)
 Frame = +1

Query: 250 GKPRHQGVMVGMGQK----DSYVGDEAQSKRGILTLKYPIEHGIATNWDDM 390
           G+PRHQ V+  +  K    DSYVG+EAQ++RG+LTL YPIE GI T WDDM
Sbjct: 42  GRPRHQEVLDDLTTKLNFRDSYVGEEAQNRRGVLTLTYPIERGIITKWDDM 92



 Score = 39.5 bits (88), Expect = 0.023
 Identities = 18/31 (58%), Positives = 22/31 (70%)
 Frame = +2

Query: 167 LVVDNGSGMCKAGFAGYDAPRAVFPSIVGSP 259
           +V+D+GS   +AGFA  D PR VF SIVG P
Sbjct: 14  MVIDHGSFEIQAGFAEEDCPRTVFQSIVGRP 44


>UniRef50_A7RPC3 Cluster: Predicted protein; n=3; Eumetazoa|Rep:
           Predicted protein - Nematostella vectensis
          Length = 64

 Score = 64.1 bits (149), Expect = 9e-10
 Identities = 29/35 (82%), Positives = 31/35 (88%)
 Frame = +1

Query: 250 GKPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYP 354
           G+PRHQGVMVGMGQKDSYVG EA SKRGIL+L  P
Sbjct: 30  GRPRHQGVMVGMGQKDSYVGWEAHSKRGILSLSTP 64



 Score = 47.6 bits (108), Expect = 8e-05
 Identities = 22/32 (68%), Positives = 24/32 (75%)
 Frame = +2

Query: 164 ALVVDNGSGMCKAGFAGYDAPRAVFPSIVGSP 259
           ALV+D GS M K GFAG DAP+ VFP IVG P
Sbjct: 1   ALVIDVGSHMWKVGFAGDDAPKGVFPPIVGRP 32


>UniRef50_Q9XZB9 Cluster: Actin; n=1; Sterkiella nova|Rep: Actin -
           Oxytricha nova
          Length = 374

 Score = 62.5 bits (145), Expect = 3e-09
 Identities = 21/47 (44%), Positives = 35/47 (74%)
 Frame = +1

Query: 250 GKPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIATNWDDM 390
           G+P++Q  ++G+  KD ++G++A  KRG+L   YP++HGI  +WDDM
Sbjct: 35  GRPKNQNAIIGVEAKDEFIGEDAYLKRGVLKFSYPVQHGIIKDWDDM 81



 Score = 42.7 bits (96), Expect = 0.002
 Identities = 18/36 (50%), Positives = 22/36 (61%)
 Frame = +2

Query: 152 EEVAALVVDNGSGMCKAGFAGYDAPRAVFPSIVGSP 259
           E    +V+DNGSG  KAGF G D P  V  ++VG P
Sbjct: 2   ESSKTIVIDNGSGFVKAGFVGEDGPSVVLRNLVGRP 37


>UniRef50_A4QNT8 Cluster: Si:ch211-241j12.3 protein; n=3; Danio
           rerio|Rep: Si:ch211-241j12.3 protein - Danio rerio
           (Zebrafish) (Brachydanio rerio)
          Length = 389

 Score = 61.7 bits (143), Expect = 5e-09
 Identities = 23/47 (48%), Positives = 35/47 (74%)
 Frame = +1

Query: 250 GKPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIATNWDDM 390
           G+P+++ VM     ++ YVG +AQ  RG+LTL+YPI HG+ +NWD+M
Sbjct: 53  GRPKYEEVMNSCVDRELYVGHDAQHMRGVLTLRYPIRHGVVSNWDEM 99



 Score = 46.4 bits (105), Expect = 2e-04
 Identities = 18/31 (58%), Positives = 25/31 (80%)
 Frame = +2

Query: 167 LVVDNGSGMCKAGFAGYDAPRAVFPSIVGSP 259
           +V+D+GSG+ KAGFA  D P AVFP+++G P
Sbjct: 25  IVLDSGSGLMKAGFADQDLPAAVFPTVIGRP 55


>UniRef50_UPI000065FC19 Cluster: Homolog of Homo sapiens "Actin,
           cytoplasmic 2; n=1; Takifugu rubripes|Rep: Homolog of
           Homo sapiens "Actin, cytoplasmic 2 - Takifugu rubripes
          Length = 396

 Score = 60.5 bits (140), Expect = 1e-08
 Identities = 22/47 (46%), Positives = 36/47 (76%)
 Frame = +1

Query: 250 GKPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIATNWDDM 390
           G P+++ +M G  ++++Y+G EAQ  RG+L LK+PI++GI  NWD+M
Sbjct: 30  GMPKYEEIMNGRAERETYIGHEAQHMRGVLALKHPIKNGIIQNWDEM 76



 Score = 44.0 bits (99), Expect = 0.001
 Identities = 18/31 (58%), Positives = 22/31 (70%)
 Frame = +2

Query: 167 LVVDNGSGMCKAGFAGYDAPRAVFPSIVGSP 259
           +V+D GSG  KAGFA  D P  VFP+I+G P
Sbjct: 2   IVLDTGSGFMKAGFADEDLPNVVFPTIIGMP 32


>UniRef50_UPI0000E466A7 Cluster: PREDICTED: similar to actin, alpha
           1, skeletal muscle; n=1; Strongylocentrotus
           purpuratus|Rep: PREDICTED: similar to actin, alpha 1,
           skeletal muscle - Strongylocentrotus purpuratus
          Length = 258

 Score = 59.7 bits (138), Expect = 2e-08
 Identities = 24/40 (60%), Positives = 31/40 (77%)
 Frame = +1

Query: 271 VMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIATNWDDM 390
           +   M  +D +VGDEAQ KRG+L++KYPIE GI TNW+DM
Sbjct: 2   IPTSMITRDHFVGDEAQRKRGLLSIKYPIERGIVTNWEDM 41


>UniRef50_P61163 Cluster: Alpha-centractin; n=356; root|Rep:
           Alpha-centractin - Homo sapiens (Human)
          Length = 376

 Score = 58.4 bits (135), Expect = 5e-08
 Identities = 21/47 (44%), Positives = 35/47 (74%)
 Frame = +1

Query: 250 GKPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIATNWDDM 390
           G+P+H  VM G  + D ++G +A+  RG+L+++YP+EHGI  +W+DM
Sbjct: 40  GRPKHVRVMAGALEGDIFIGPKAEEHRGLLSIRYPMEHGIVKDWNDM 86



 Score = 43.6 bits (98), Expect = 0.001
 Identities = 18/31 (58%), Positives = 23/31 (74%)
 Frame = +2

Query: 167 LVVDNGSGMCKAGFAGYDAPRAVFPSIVGSP 259
           +V+DNGSG+ KAGFAG   P+  FP+ VG P
Sbjct: 12  VVIDNGSGVIKAGFAGDQIPKYCFPNYVGRP 42


>UniRef50_UPI0000F2D326 Cluster: PREDICTED: similar to actin; n=1;
           Monodelphis domestica|Rep: PREDICTED: similar to actin -
           Monodelphis domestica
          Length = 378

 Score = 56.4 bits (130), Expect = 2e-07
 Identities = 24/47 (51%), Positives = 30/47 (63%)
 Frame = +1

Query: 250 GKPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIATNWDDM 390
           G P+    M    QK  YVG EAQ  R ILTL +P++HG+ T+WDDM
Sbjct: 40  GYPQSINSMANTWQKAYYVGQEAQDNRSILTLNHPMQHGVVTSWDDM 86



 Score = 38.3 bits (85), Expect = 0.052
 Identities = 15/47 (31%), Positives = 29/47 (61%), Gaps = 1/47 (2%)
 Frame = +2

Query: 155 EVAALVVDNGSGMCKAGFAGYDAPRAVFPSIVGSP-AIRA*WSVWDR 292
           ++ + + DNGSG+CK G +G   PR +  +++G P +I +  + W +
Sbjct: 8   KIPSAIFDNGSGLCKVGISGEQNPRFIQATVLGYPQSINSMANTWQK 54


>UniRef50_UPI0000E23780 Cluster: PREDICTED: hypothetical protein
           isoform 2; n=2; Amniota|Rep: PREDICTED: hypothetical
           protein isoform 2 - Pan troglodytes
          Length = 179

 Score = 56.4 bits (130), Expect = 2e-07
 Identities = 25/47 (53%), Positives = 32/47 (68%)
 Frame = -3

Query: 390 HVIPVSGDSVFDGVFEGQDTSFALCLISYIRVLLSHTDHHALMAGLP 250
           HV+PV  D+V  GV +GQD S AL LI++I + L H  HHAL+ G P
Sbjct: 92  HVVPVGDDAVLHGVLQGQDASLALGLIAHIGLHLMHAPHHALVPGAP 138



 Score = 37.5 bits (83), Expect = 0.091
 Identities = 24/63 (38%), Positives = 33/63 (52%)
 Frame = -2

Query: 313 HLLHKSPSVPYRPSRPDGGASHDRGKHCARSIISCEAGLAHTGAIVYYQRGNFFVAHLEL 134
           HL+H     P+    P  GA HD  +     II+C+AGLAH  A+V    G   + H EL
Sbjct: 124 HLMH----APHHALVP--GAPHDGREDSPGGIITCKAGLAHARAVVNDGHGGIII-HGEL 176

Query: 133 VKL 125
           ++L
Sbjct: 177 IQL 179


>UniRef50_Q8LKR2 Cluster: Actin-related protein 4; n=7; core
           eudicotyledons|Rep: Actin-related protein 4 -
           Arabidopsis thaliana (Mouse-ear cress)
          Length = 442

 Score = 55.6 bits (128), Expect = 3e-07
 Identities = 23/35 (65%), Positives = 31/35 (88%)
 Frame = +2

Query: 152 EEVAALVVDNGSGMCKAGFAGYDAPRAVFPSIVGS 256
           +EV+A+VVD GS  CKAG+AG DAP+AVFPS++G+
Sbjct: 6   DEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSVIGA 40


>UniRef50_Q2GY63 Cluster: Putative uncharacterized protein; n=1;
           Chaetomium globosum|Rep: Putative uncharacterized
           protein - Chaetomium globosum (Soil fungus)
          Length = 350

 Score = 55.6 bits (128), Expect = 3e-07
 Identities = 22/48 (45%), Positives = 36/48 (75%), Gaps = 1/48 (2%)
 Frame = +1

Query: 250 GKPRHQGVMVGMGQKDSYVGDEAQSK-RGILTLKYPIEHGIATNWDDM 390
           G+P+H  V+ G  + + +VG +A ++ RG+L ++YP+EHGI T+WDDM
Sbjct: 38  GRPKHLRVLAGALEGEVFVGKKAAAELRGLLKIRYPLEHGIVTDWDDM 85



 Score = 40.3 bits (90), Expect = 0.013
 Identities = 17/32 (53%), Positives = 23/32 (71%)
 Frame = +2

Query: 164 ALVVDNGSGMCKAGFAGYDAPRAVFPSIVGSP 259
           A+V+DNGSG  +AG++G   P+  FPS VG P
Sbjct: 9   AVVLDNGSGNIRAGYSGESEPKVNFPSWVGRP 40


>UniRef50_UPI0000EBF019 Cluster: PREDICTED: similar to ribosomal
           protein L10; n=1; Bos taurus|Rep: PREDICTED: similar to
           ribosomal protein L10 - Bos taurus
          Length = 289

 Score = 55.2 bits (127), Expect = 4e-07
 Identities = 23/45 (51%), Positives = 33/45 (73%)
 Frame = +1

Query: 256 PRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIATNWDDM 390
           P+HQ  MVG+GQKDSY+G + Q +  + T +YP+E GI T+ DD+
Sbjct: 33  PQHQDCMVGVGQKDSYMGGKIQGRLSVQTPEYPMEQGIITHPDDV 77


>UniRef50_A7QKV4 Cluster: Chromosome chr8 scaffold_115, whole genome
           shotgun sequence; n=1; Vitis vinifera|Rep: Chromosome
           chr8 scaffold_115, whole genome shotgun sequence - Vitis
           vinifera (Grape)
          Length = 431

 Score = 54.4 bits (125), Expect = 7e-07
 Identities = 23/33 (69%), Positives = 27/33 (81%)
 Frame = +1

Query: 289 QKDSYVGDEAQSKRGILTLKYPIEHGIATNWDD 387
           QKD+YV DEAQSK+ +LTLKYP + GI  NWDD
Sbjct: 21  QKDAYVEDEAQSKKDMLTLKYPTKSGIVGNWDD 53


>UniRef50_UPI0000F2D825 Cluster: PREDICTED: similar to actin; n=1;
           Monodelphis domestica|Rep: PREDICTED: similar to actin -
           Monodelphis domestica
          Length = 416

 Score = 54.0 bits (124), Expect = 1e-06
 Identities = 23/47 (48%), Positives = 30/47 (63%)
 Frame = +1

Query: 250 GKPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIATNWDDM 390
           G  R Q +  GM  +D+++G+E   K   L +KYPIEHGI  NWDDM
Sbjct: 80  GHYRWQNIKSGMDLRDTFIGNEVIEKWANLLVKYPIEHGIIVNWDDM 126



 Score = 32.3 bits (70), Expect = 3.4
 Identities = 14/33 (42%), Positives = 19/33 (57%)
 Frame = +2

Query: 155 EVAALVVDNGSGMCKAGFAGYDAPRAVFPSIVG 253
           E   ++ D GS   K G+ G  +PR VFPS +G
Sbjct: 48  ESLPVIFDGGSRYFKVGYGGEYSPRFVFPSAIG 80


>UniRef50_Q24C02 Cluster: Actin family protein; n=3;
           Oligohymenophorea|Rep: Actin family protein -
           Tetrahymena thermophila SB210
          Length = 398

 Score = 53.2 bits (122), Expect = 2e-06
 Identities = 21/47 (44%), Positives = 33/47 (70%)
 Frame = +1

Query: 250 GKPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIATNWDDM 390
           G+P+++ V+    Q D Y+G+ +  +RG+L L+YPI HGI  NW+DM
Sbjct: 41  GRPKYKMVLPTNTQSDYYLGNISDEQRGLLKLQYPINHGIIQNWNDM 87



 Score = 37.1 bits (82), Expect = 0.12
 Identities = 15/31 (48%), Positives = 21/31 (67%)
 Frame = +2

Query: 167 LVVDNGSGMCKAGFAGYDAPRAVFPSIVGSP 259
           +V+DNGSG+ +AG AG D  +  F S +G P
Sbjct: 13  VVIDNGSGIIRAGIAGEDKAKLQFDSYIGRP 43


>UniRef50_A2DKQ5 Cluster: Actin 58, putative; n=2; Trichomonas
           vaginalis G3|Rep: Actin 58, putative - Trichomonas
           vaginalis G3
          Length = 373

 Score = 53.2 bits (122), Expect = 2e-06
 Identities = 20/31 (64%), Positives = 29/31 (93%)
 Frame = +2

Query: 167 LVVDNGSGMCKAGFAGYDAPRAVFPSIVGSP 259
           +V+DNG+G+ KAGFAG +AP++VFP+I+GSP
Sbjct: 6   IVIDNGTGLTKAGFAGAEAPKSVFPTIIGSP 36



 Score = 48.8 bits (111), Expect = 4e-05
 Identities = 22/47 (46%), Positives = 29/47 (61%)
 Frame = +1

Query: 250 GKPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIATNWDDM 390
           G P+    MVG   KD +VG EA  K  +L L+ PIE+G  +NWDD+
Sbjct: 34  GSPKSNMQMVGGQNKDFFVGFEAVQKSDLLVLRQPIENGTISNWDDI 80


>UniRef50_UPI0000605B09 Cluster: PREDICTED: similar to actin alpha 1
           skeletal muscle protein; n=1; Mus musculus|Rep:
           PREDICTED: similar to actin alpha 1 skeletal muscle
           protein - Mus musculus
          Length = 255

 Score = 52.0 bits (119), Expect = 4e-06
 Identities = 20/47 (42%), Positives = 31/47 (65%)
 Frame = +1

Query: 250 GKPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIATNWDDM 390
           GK +H  V+ G+G++D ++G E Q+ R  L + YPI  G  TNWD++
Sbjct: 34  GKMKHTNVLEGLGEQDWFIGAETQTNRTELNMYYPISRGAITNWDNV 80



 Score = 42.3 bits (95), Expect = 0.003
 Identities = 19/33 (57%), Positives = 23/33 (69%)
 Frame = +2

Query: 155 EVAALVVDNGSGMCKAGFAGYDAPRAVFPSIVG 253
           E   LV D GSG  K GF+G  AP+AVFP+I+G
Sbjct: 2   EKTPLVCDYGSGFSKVGFSGTQAPQAVFPTILG 34


>UniRef50_UPI00001E426E Cluster: PREDICTED: similar to actin-12;
           n=11; Eutheria|Rep: PREDICTED: similar to actin-12 - Mus
           musculus
          Length = 372

 Score = 52.0 bits (119), Expect = 4e-06
 Identities = 20/47 (42%), Positives = 31/47 (65%)
 Frame = +1

Query: 250 GKPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIATNWDDM 390
           GK +H  V+ G+G++D ++G E Q+ R  L + YPI  G  TNWD++
Sbjct: 34  GKMKHTNVLEGLGEQDWFIGAETQTNRTELNMYYPISRGAITNWDNV 80



 Score = 42.3 bits (95), Expect = 0.003
 Identities = 19/33 (57%), Positives = 23/33 (69%)
 Frame = +2

Query: 155 EVAALVVDNGSGMCKAGFAGYDAPRAVFPSIVG 253
           E   LV D GSG  K GF+G  AP+AVFP+I+G
Sbjct: 2   EKTPLVCDYGSGFSKVGFSGTQAPQAVFPTILG 34


>UniRef50_A5E2K2 Cluster: Actin; n=5; Saccharomycetales|Rep: Actin -
           Lodderomyces elongisporus (Yeast) (Saccharomyces
           elongisporus)
          Length = 417

 Score = 52.0 bits (119), Expect = 4e-06
 Identities = 25/58 (43%), Positives = 32/58 (55%), Gaps = 11/58 (18%)
 Frame = +1

Query: 250 GKPRHQGVMVGM-----------GQKDSYVGDEAQSKRGILTLKYPIEHGIATNWDDM 390
           G+P++Q +M G               D +VGD AQ  RG+L L YP+EHGI T W DM
Sbjct: 38  GRPKYQKLMAGSLTSSTSGSTIASDTDLFVGDAAQKNRGLLRLNYPVEHGIVTKWSDM 95



 Score = 40.3 bits (90), Expect = 0.013
 Identities = 18/31 (58%), Positives = 21/31 (67%)
 Frame = +2

Query: 167 LVVDNGSGMCKAGFAGYDAPRAVFPSIVGSP 259
           +VVDNG G  KAGFAG + PR    SI+G P
Sbjct: 10  VVVDNGLGTLKAGFAGEEKPRTYASSIIGRP 40


>UniRef50_Q7XB26 Cluster: Ubiquitin/actin fusion protein 4; n=1;
           Bigelowiella natans|Rep: Ubiquitin/actin fusion protein
           4 - Bigelowiella natans (Pedinomonas minutissima)
           (Chlorarachnion sp.(strain CCMP 621))
          Length = 234

 Score = 50.8 bits (116), Expect = 9e-06
 Identities = 24/39 (61%), Positives = 26/39 (66%)
 Frame = +2

Query: 152 EEVAALVVDNGSGMCKAGFAGYDAPRAVFPSIVGSPAIR 268
           EE   LVVDNGS M KAGFAG  APR  FPS+   P +R
Sbjct: 78  EECQPLVVDNGSDMIKAGFAGDGAPRTAFPSVFKVPRVR 116



 Score = 45.6 bits (103), Expect = 3e-04
 Identities = 22/45 (48%), Positives = 29/45 (64%)
 Frame = +1

Query: 256 PRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIATNWDDM 390
           PR +  M G  ++D Y+G    +KRG+L  KY IEHGI T+WD M
Sbjct: 113 PRVRNTMTG--KQDVYIGS-VNAKRGVLINKYAIEHGIVTDWDAM 154


>UniRef50_UPI00015B6274 Cluster: PREDICTED: similar to putative mRNA
           splicing factor; n=1; Nasonia vitripennis|Rep:
           PREDICTED: similar to putative mRNA splicing factor -
           Nasonia vitripennis
          Length = 515

 Score = 50.4 bits (115), Expect = 1e-05
 Identities = 22/42 (52%), Positives = 29/42 (69%)
 Frame = -3

Query: 390 HVIPVSGDSVFDGVFEGQDTSFALCLISYIRVLLSHTDHHAL 265
           HVIPV   SV D +F  +DT+  L L++Y+ VLL+H DH AL
Sbjct: 418 HVIPVGDYSVLDRIFNREDTALGLGLVAYVGVLLAHADHDAL 459


>UniRef50_O96819 Cluster: Actin-related protein; n=5;
           Trypanosoma|Rep: Actin-related protein - Trypanosoma
           brucei
          Length = 433

 Score = 50.0 bits (114), Expect = 2e-05
 Identities = 21/47 (44%), Positives = 31/47 (65%)
 Frame = +1

Query: 250 GKPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIATNWDDM 390
           G PR++GV V  G  +  +GD A +KRG+LT+  PIE G   +W++M
Sbjct: 39  GHPRNRGVAVAAGMNEYEIGDVALAKRGMLTVSSPIESGRVVSWENM 85



 Score = 34.7 bits (76), Expect = 0.64
 Identities = 18/43 (41%), Positives = 25/43 (58%), Gaps = 1/43 (2%)
 Frame = +2

Query: 143 MCDEEVAALVV-DNGSGMCKAGFAGYDAPRAVFPSIVGSPAIR 268
           +C  E A +V+ D GS   +AG+A   APR   P++VG P  R
Sbjct: 2   VCSTERAPVVILDGGSHHLRAGYASDGAPRLDIPALVGHPRNR 44


>UniRef50_Q00UL2 Cluster: Alpha amylase 1; n=3; Ostreococcus|Rep:
           Alpha amylase 1 - Ostreococcus tauri
          Length = 913

 Score = 49.2 bits (112), Expect = 3e-05
 Identities = 24/33 (72%), Positives = 27/33 (81%)
 Frame = -3

Query: 246 IEGNTARGASYPAKPALHIPEPLSTTNAATSSS 148
           ++GNTA GAS PAKPAL IPEPLS T+A TS S
Sbjct: 1   MDGNTAFGASSPAKPALTIPEPLSHTSAETSPS 33


>UniRef50_A3BPG0 Cluster: Putative uncharacterized protein; n=3;
           Oryza sativa|Rep: Putative uncharacterized protein -
           Oryza sativa subsp. japonica (Rice)
          Length = 467

 Score = 48.4 bits (110), Expect = 5e-05
 Identities = 20/32 (62%), Positives = 27/32 (84%)
 Frame = +2

Query: 152 EEVAALVVDNGSGMCKAGFAGYDAPRAVFPSI 247
           +EV+A+V+D GS  CKAG+AG D P+AVFPS+
Sbjct: 5   DEVSAIVIDVGSYSCKAGYAGDDTPKAVFPSL 36


>UniRef50_UPI0001554F81 Cluster: PREDICTED: similar to actin; n=1;
           Ornithorhynchus anatinus|Rep: PREDICTED: similar to
           actin - Ornithorhynchus anatinus
          Length = 376

 Score = 48.0 bits (109), Expect = 6e-05
 Identities = 19/32 (59%), Positives = 26/32 (81%)
 Frame = +2

Query: 158 VAALVVDNGSGMCKAGFAGYDAPRAVFPSIVG 253
           +  LV+DNG+G+CKAGFAG +AP+ V P+ VG
Sbjct: 1   MTTLVIDNGTGLCKAGFAGDNAPKLVVPTAVG 32


>UniRef50_Q5KB93 Cluster: Actin binding protein, putative; n=3;
           Filobasidiella neoformans|Rep: Actin binding protein,
           putative - Cryptococcus neoformans (Filobasidiella
           neoformans)
          Length = 390

 Score = 48.0 bits (109), Expect = 6e-05
 Identities = 22/35 (62%), Positives = 26/35 (74%)
 Frame = +2

Query: 167 LVVDNGSGMCKAGFAGYDAPRAVFPSIVGSPAIRA 271
           LVVDNG+G  K G+AG + P  VFPSIVG P +RA
Sbjct: 7   LVVDNGTGFVKCGWAGSNFPDYVFPSIVGRPILRA 41



 Score = 44.0 bits (99), Expect = 0.001
 Identities = 16/33 (48%), Positives = 22/33 (66%)
 Frame = +1

Query: 292 KDSYVGDEAQSKRGILTLKYPIEHGIATNWDDM 390
           KD  +GDEA   R  L + +P+EHG+  NW+DM
Sbjct: 51  KDIMIGDEAAENRSYLQVTHPMEHGVVKNWEDM 83


>UniRef50_Q4CV94 Cluster: Actin 2, putative; n=2; Trypanosoma
           cruzi|Rep: Actin 2, putative - Trypanosoma cruzi
          Length = 392

 Score = 47.2 bits (107), Expect = 1e-04
 Identities = 20/34 (58%), Positives = 25/34 (73%)
 Frame = +2

Query: 152 EEVAALVVDNGSGMCKAGFAGYDAPRAVFPSIVG 253
           +E  A+V+DNGSG  K GFAG + PR VFPS+ G
Sbjct: 7   DEEPAVVLDNGSGNIKCGFAGEEIPRCVFPSVTG 40



 Score = 39.9 bits (89), Expect = 0.017
 Identities = 17/30 (56%), Positives = 22/30 (73%)
 Frame = +1

Query: 301 YVGDEAQSKRGILTLKYPIEHGIATNWDDM 390
           YVGDEA  ++G L   YP+EHGI ++WD M
Sbjct: 57  YVGDEALQEKG-LRYFYPMEHGIVSDWDQM 85


>UniRef50_Q4QG59 Cluster: Actin-like protein, putative; n=3;
           Leishmania|Rep: Actin-like protein, putative -
           Leishmania major
          Length = 483

 Score = 46.8 bits (106), Expect = 1e-04
 Identities = 18/47 (38%), Positives = 29/47 (61%)
 Frame = +1

Query: 250 GKPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIATNWDDM 390
           G PRH+ + +  G  +  VG+EA  K+GIL + +PI +G   +W D+
Sbjct: 38  GYPRHRSIAMAAGMNEQEVGEEALLKQGILDVHHPIRNGFINDWGDV 84



 Score = 34.7 bits (76), Expect = 0.64
 Identities = 17/37 (45%), Positives = 23/37 (62%)
 Frame = +2

Query: 161 AALVVDNGSGMCKAGFAGYDAPRAVFPSIVGSPAIRA 271
           AA+V+D GS   +AGF G   PR   P++VG P  R+
Sbjct: 8   AAVVLDCGSFHSRAGFGGEKGPRLDVPTLVGYPRHRS 44


>UniRef50_P61160 Cluster: Actin-related protein 2; n=96;
           Eukaryota|Rep: Actin-related protein 2 - Homo sapiens
           (Human)
          Length = 394

 Score = 46.4 bits (105), Expect = 2e-04
 Identities = 19/33 (57%), Positives = 23/33 (69%)
 Frame = +1

Query: 292 KDSYVGDEAQSKRGILTLKYPIEHGIATNWDDM 390
           KD  VGDEA   R +L + YP+E+GI  NWDDM
Sbjct: 53  KDLMVGDEASELRSMLEVNYPMENGIVRNWDDM 85



 Score = 43.6 bits (98), Expect = 0.001
 Identities = 17/35 (48%), Positives = 25/35 (71%)
 Frame = +2

Query: 167 LVVDNGSGMCKAGFAGYDAPRAVFPSIVGSPAIRA 271
           +V DNG+G  K G+AG + P  +FP++VG P IR+
Sbjct: 9   VVCDNGTGFVKCGYAGSNFPEHIFPALVGRPIIRS 43


>UniRef50_A4RW28 Cluster: Predicted protein; n=2; Ostreococcus|Rep:
           Predicted protein - Ostreococcus lucimarinus CCE9901
          Length = 425

 Score = 44.4 bits (100), Expect = 8e-04
 Identities = 20/37 (54%), Positives = 27/37 (72%)
 Frame = +2

Query: 152 EEVAALVVDNGSGMCKAGFAGYDAPRAVFPSIVGSPA 262
           +EV+A+V+D G+   KAG+AG D P+ VFPS VG  A
Sbjct: 5   DEVSAVVIDLGTHSVKAGYAGQDTPQHVFPSAVGECA 41


>UniRef50_A2EUM6 Cluster: Actin family protein; n=1; Trichomonas
           vaginalis G3|Rep: Actin family protein - Trichomonas
           vaginalis G3
          Length = 360

 Score = 44.4 bits (100), Expect = 8e-04
 Identities = 19/30 (63%), Positives = 24/30 (80%)
 Frame = +2

Query: 167 LVVDNGSGMCKAGFAGYDAPRAVFPSIVGS 256
           LV+D GSG  KAGFAG D+P  VFP++VG+
Sbjct: 8   LVLDFGSGFVKAGFAGNDSPSLVFPTVVGN 37


>UniRef50_Q0J646 Cluster: Os08g0369300 protein; n=2; Oryza sativa
           (japonica cultivar-group)|Rep: Os08g0369300 protein -
           Oryza sativa subsp. japonica (Rice)
          Length = 495

 Score = 44.0 bits (99), Expect = 0.001
 Identities = 18/34 (52%), Positives = 24/34 (70%)
 Frame = +2

Query: 167 LVVDNGSGMCKAGFAGYDAPRAVFPSIVGSPAIR 268
           +V DNG+G  K GFAG + P +VFP +VG P +R
Sbjct: 7   VVCDNGTGYVKCGFAGENFPTSVFPCVVGRPLLR 40


>UniRef50_A2YUL5 Cluster: Putative uncharacterized protein; n=1;
           Oryza sativa (indica cultivar-group)|Rep: Putative
           uncharacterized protein - Oryza sativa subsp. indica
           (Rice)
          Length = 367

 Score = 44.0 bits (99), Expect = 0.001
 Identities = 18/34 (52%), Positives = 24/34 (70%)
 Frame = +2

Query: 167 LVVDNGSGMCKAGFAGYDAPRAVFPSIVGSPAIR 268
           +V DNG+G  K GFAG + P +VFP +VG P +R
Sbjct: 7   VVCDNGTGYVKCGFAGENFPTSVFPCVVGRPLLR 40


>UniRef50_Q4SGD5 Cluster: Chromosome 17 SCAF14597, whole genome
           shotgun sequence; n=1; Tetraodon nigroviridis|Rep:
           Chromosome 17 SCAF14597, whole genome shotgun sequence -
           Tetraodon nigroviridis (Green puffer)
          Length = 425

 Score = 43.6 bits (98), Expect = 0.001
 Identities = 17/35 (48%), Positives = 25/35 (71%)
 Frame = +2

Query: 167 LVVDNGSGMCKAGFAGYDAPRAVFPSIVGSPAIRA 271
           +V DNG+G  K G+AG + P  +FP++VG P IR+
Sbjct: 9   VVCDNGTGFVKCGYAGSNFPEHIFPALVGRPIIRS 43


>UniRef50_Q5CKL2 Cluster: BRG1/brm-associated factor 53A; n=2;
           Cryptosporidium|Rep: BRG1/brm-associated factor 53A -
           Cryptosporidium hominis
          Length = 423

 Score = 43.6 bits (98), Expect = 0.001
 Identities = 18/34 (52%), Positives = 25/34 (73%)
 Frame = +2

Query: 152 EEVAALVVDNGSGMCKAGFAGYDAPRAVFPSIVG 253
           ++V A++VD GS M K G+ G D PR V+PS+VG
Sbjct: 11  DDVGAIIVDVGSYMTKIGYGGEDCPRQVWPSVVG 44


>UniRef50_A2FRF9 Cluster: Actin family protein; n=1; Trichomonas
           vaginalis G3|Rep: Actin family protein - Trichomonas
           vaginalis G3
          Length = 543

 Score = 43.6 bits (98), Expect = 0.001
 Identities = 17/31 (54%), Positives = 22/31 (70%)
 Frame = +2

Query: 167 LVVDNGSGMCKAGFAGYDAPRAVFPSIVGSP 259
           +V+D GSG  K GFAGY  P+  FP++VG P
Sbjct: 6   VVIDTGSGFTKVGFAGYYEPKVEFPTVVGVP 36



 Score = 42.3 bits (95), Expect = 0.003
 Identities = 16/47 (34%), Positives = 28/47 (59%)
 Frame = +1

Query: 250 GKPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIATNWDDM 390
           G P+    ++G    D +VG+E  +K  ++ +  PIE+G+  NWDD+
Sbjct: 34  GVPKDSTALIGGKNVDFFVGNEVFTKSDLVDISKPIENGVIVNWDDI 80


>UniRef50_UPI0000D9A391 Cluster: PREDICTED: actin related protein M1
           isoform 1; n=1; Macaca mulatta|Rep: PREDICTED: actin
           related protein M1 isoform 1 - Macaca mulatta
          Length = 319

 Score = 43.2 bits (97), Expect = 0.002
 Identities = 16/29 (55%), Positives = 22/29 (75%)
 Frame = +1

Query: 304 VGDEAQSKRGILTLKYPIEHGIATNWDDM 390
           VGD+AQ  R  L++ YP+E G+ T+WDDM
Sbjct: 116 VGDQAQDWRSSLSISYPVERGLITSWDDM 144



 Score = 39.9 bits (89), Expect = 0.017
 Identities = 15/29 (51%), Positives = 23/29 (79%)
 Frame = +2

Query: 167 LVVDNGSGMCKAGFAGYDAPRAVFPSIVG 253
           +V+DNGSG+ KAG AG   P+ ++P+I+G
Sbjct: 71  VVIDNGSGVIKAGLAGSREPQFIYPNIIG 99


>UniRef50_UPI00005864C8 Cluster: PREDICTED: similar to Actin; n=4;
           Strongylocentrotus purpuratus|Rep: PREDICTED: similar to
           Actin - Strongylocentrotus purpuratus
          Length = 383

 Score = 43.2 bits (97), Expect = 0.002
 Identities = 14/35 (40%), Positives = 25/35 (71%)
 Frame = +1

Query: 286 GQKDSYVGDEAQSKRGILTLKYPIEHGIATNWDDM 390
           G++++++G+     R +L + YPIEHGI  +W+DM
Sbjct: 49  GKREAFIGEAIYKHREVLGINYPIEHGIVKDWEDM 83



 Score = 40.3 bits (90), Expect = 0.013
 Identities = 19/35 (54%), Positives = 23/35 (65%)
 Frame = +2

Query: 149 DEEVAALVVDNGSGMCKAGFAGYDAPRAVFPSIVG 253
           D+    +VVDNGSG  +AGFAG    RA FPS +G
Sbjct: 6   DDGPDPVVVDNGSGTIQAGFAGGKTCRATFPSCIG 40


>UniRef50_Q17GZ9 Cluster: Actin-related protein 5; n=4;
           Endopterygota|Rep: Actin-related protein 5 - Aedes
           aegypti (Yellowfever mosquito)
          Length = 655

 Score = 42.7 bits (96), Expect = 0.002
 Identities = 17/33 (51%), Positives = 24/33 (72%)
 Frame = +2

Query: 161 AALVVDNGSGMCKAGFAGYDAPRAVFPSIVGSP 259
           AA+V+DNGS  C+AG+AG D P  VF +++  P
Sbjct: 28  AAIVIDNGSYHCRAGWAGKDVPSLVFKNVLAKP 60


>UniRef50_Q4DMP2 Cluster: Actin-related protein 2, putative; n=4;
           Trypanosoma|Rep: Actin-related protein 2, putative -
           Trypanosoma cruzi
          Length = 403

 Score = 42.3 bits (95), Expect = 0.003
 Identities = 18/39 (46%), Positives = 26/39 (66%)
 Frame = +2

Query: 155 EVAALVVDNGSGMCKAGFAGYDAPRAVFPSIVGSPAIRA 271
           E   +V+DNGSG  K G+AG + P AVF + +G P +R+
Sbjct: 4   EKRPVVLDNGSGFIKCGYAGANFPTAVFQTALGRPVLRS 42



 Score = 33.5 bits (73), Expect = 1.5
 Identities = 14/33 (42%), Positives = 19/33 (57%)
 Frame = +1

Query: 292 KDSYVGDEAQSKRGILTLKYPIEHGIATNWDDM 390
           +D   GDE    R +L + YPI +GI  N D+M
Sbjct: 65  RDIVFGDECSGVRHLLDMTYPIRNGIIQNMDEM 97


>UniRef50_A7S2B1 Cluster: Predicted protein; n=1; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 265

 Score = 42.3 bits (95), Expect = 0.003
 Identities = 17/32 (53%), Positives = 24/32 (75%)
 Frame = +2

Query: 164 ALVVDNGSGMCKAGFAGYDAPRAVFPSIVGSP 259
           A+V+DNG G+ K GFAG   PR + P++VG+P
Sbjct: 1   AIVLDNGCGISKIGFAGDRVPRIIQPAVVGNP 32


>UniRef50_A2ECQ8 Cluster: Actin family protein; n=1; Trichomonas
           vaginalis G3|Rep: Actin family protein - Trichomonas
           vaginalis G3
          Length = 371

 Score = 42.3 bits (95), Expect = 0.003
 Identities = 18/45 (40%), Positives = 27/45 (60%)
 Frame = +1

Query: 250 GKPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIATNWD 384
           G  +    MVG+  K  +VG+EA +K  +L L  PIE+G+  NW+
Sbjct: 35  GTAKENADMVGIKNKAYFVGNEALAKENLLNLVNPIENGVVQNWE 79



 Score = 37.1 bits (82), Expect = 0.12
 Identities = 14/34 (41%), Positives = 23/34 (67%)
 Frame = +2

Query: 155 EVAALVVDNGSGMCKAGFAGYDAPRAVFPSIVGS 256
           ++  +V+DNG+   KAGFAG   P  + P++VG+
Sbjct: 3   DMKTIVIDNGTFSVKAGFAGTKKPHFIIPTVVGT 36


>UniRef50_A0E1S8 Cluster: Chromosome undetermined scaffold_73, whole
           genome shotgun sequence; n=1; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_73,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 383

 Score = 42.3 bits (95), Expect = 0.003
 Identities = 16/31 (51%), Positives = 22/31 (70%)
 Frame = +1

Query: 292 KDSYVGDEAQSKRGILTLKYPIEHGIATNWD 384
           +D Y G+EA +K   L+LKYPI+ GI  +WD
Sbjct: 51  EDQYFGEEAMAKANALSLKYPIQRGIINDWD 81



 Score = 38.3 bits (85), Expect = 0.052
 Identities = 16/33 (48%), Positives = 22/33 (66%)
 Frame = +2

Query: 167 LVVDNGSGMCKAGFAGYDAPRAVFPSIVGSPAI 265
           +V+DNGS   KAGF G+ AP    P++VG P +
Sbjct: 11  IVIDNGSYELKAGFQGHYAPSCRIPTVVGRPKL 43


>UniRef50_Q19R56 Cluster: Actin-like protein 3; n=4; Trypanosoma
           cruzi|Rep: Actin-like protein 3 - Trypanosoma cruzi
           strain CL Brener
          Length = 426

 Score = 41.9 bits (94), Expect = 0.004
 Identities = 16/27 (59%), Positives = 20/27 (74%)
 Frame = +1

Query: 304 VGDEAQSKRGILTLKYPIEHGIATNWD 384
           VG +A  +RG+L L YPI+HGI  NWD
Sbjct: 51  VGKDAAERRGLLHLTYPIQHGIIVNWD 77


>UniRef50_Q54UQ7 Cluster: Actin-like protein 6A; n=1; Dictyostelium
           discoideum AX4|Rep: Actin-like protein 6A -
           Dictyostelium discoideum AX4
          Length = 440

 Score = 41.5 bits (93), Expect = 0.006
 Identities = 16/34 (47%), Positives = 27/34 (79%)
 Frame = +2

Query: 152 EEVAALVVDNGSGMCKAGFAGYDAPRAVFPSIVG 253
           ++V+A+V+D G+   K G+AG D+P+AVFP+ +G
Sbjct: 5   DDVSAIVIDVGTFSTKGGYAGEDSPKAVFPTDIG 38


>UniRef50_Q4N681 Cluster: Actin, putative; n=3; Piroplasmida|Rep:
           Actin, putative - Theileria parva
          Length = 380

 Score = 41.5 bits (93), Expect = 0.006
 Identities = 16/33 (48%), Positives = 24/33 (72%)
 Frame = +2

Query: 152 EEVAALVVDNGSGMCKAGFAGYDAPRAVFPSIV 250
           +E  AL++D GS + KAGFAG + P+  FP++V
Sbjct: 3   DETLALIIDTGSAVTKAGFAGSETPKVRFPTLV 35


>UniRef50_Q22WQ4 Cluster: Actin family protein; n=1; Tetrahymena
           thermophila SB210|Rep: Actin family protein -
           Tetrahymena thermophila SB210
          Length = 444

 Score = 41.5 bits (93), Expect = 0.006
 Identities = 19/37 (51%), Positives = 25/37 (67%)
 Frame = +2

Query: 143 MCDEEVAALVVDNGSGMCKAGFAGYDAPRAVFPSIVG 253
           M  E++ A+VVD GS   +AG++G D PR V PS VG
Sbjct: 1   MFTEDITAIVVDPGSLSIRAGYSGEDTPRLVMPSQVG 37


>UniRef50_Q5KLG9 Cluster: 53 kDa brg1-associated factor b
           (Actin-related protein baf53b), putative; n=1;
           Filobasidiella neoformans|Rep: 53 kDa brg1-associated
           factor b (Actin-related protein baf53b), putative -
           Cryptococcus neoformans (Filobasidiella neoformans)
          Length = 476

 Score = 41.1 bits (92), Expect = 0.007
 Identities = 19/34 (55%), Positives = 24/34 (70%)
 Frame = +2

Query: 152 EEVAALVVDNGSGMCKAGFAGYDAPRAVFPSIVG 253
           +EV+ALV+D GS   +AG+AG D PR V PS  G
Sbjct: 6   DEVSALVLDFGSYTTRAGYAGEDCPRVVCPSFYG 39


>UniRef50_Q9BYD9 Cluster: Actin-related protein M1; n=12;
           Theria|Rep: Actin-related protein M1 - Homo sapiens
           (Human)
          Length = 372

 Score = 41.1 bits (92), Expect = 0.007
 Identities = 16/29 (55%), Positives = 23/29 (79%)
 Frame = +2

Query: 167 LVVDNGSGMCKAGFAGYDAPRAVFPSIVG 253
           +V+DNGSGM KAG AG   P+ ++P+I+G
Sbjct: 8   VVIDNGSGMIKAGVAGCREPQFIYPNIIG 36



 Score = 40.3 bits (90), Expect = 0.013
 Identities = 15/29 (51%), Positives = 21/29 (72%)
 Frame = +1

Query: 304 VGDEAQSKRGILTLKYPIEHGIATNWDDM 390
           VGD+AQ  R  L + YP+E G+ T+W+DM
Sbjct: 53  VGDQAQDWRSSLFISYPVERGLITSWEDM 81


>UniRef50_Q5C683 Cluster: SJCHGC08418 protein; n=1; Schistosoma
           japonicum|Rep: SJCHGC08418 protein - Schistosoma
           japonicum (Blood fluke)
          Length = 106

 Score = 40.7 bits (91), Expect = 0.010
 Identities = 17/40 (42%), Positives = 26/40 (65%)
 Frame = +2

Query: 167 LVVDNGSGMCKAGFAGYDAPRAVFPSIVGSPAIRA*WSVW 286
           +VVDNG+G  KAG+AG   PR + P ++G P   + ++ W
Sbjct: 9   IVVDNGAGHLKAGYAGDGGPRILVPMLIGRPKKCSKYTDW 48


>UniRef50_Q4P2E8 Cluster: Actin-related protein 4; n=1; Ustilago
           maydis|Rep: Actin-related protein 4 - Ustilago maydis
           (Smut fungus)
          Length = 534

 Score = 40.7 bits (91), Expect = 0.010
 Identities = 18/38 (47%), Positives = 24/38 (63%)
 Frame = +2

Query: 152 EEVAALVVDNGSGMCKAGFAGYDAPRAVFPSIVGSPAI 265
           +E+ ALV+D G    + G+AG DAPR V PS  G  +I
Sbjct: 8   DEINALVIDAGHSSSRVGWAGEDAPRVVLPSYYGHTSI 45


>UniRef50_Q9DFB8 Cluster: Actin; n=1; Scomberomorus maculatus|Rep:
           Actin - Scomberomorus maculatus (Spanish mackerel)
          Length = 101

 Score = 40.3 bits (90), Expect = 0.013
 Identities = 15/26 (57%), Positives = 20/26 (76%)
 Frame = +3

Query: 315 GTEQKRYPDPQIPHRTRNRH*LG*HG 392
           G E+KR+PDP++ HR R+ H LG HG
Sbjct: 22  GPEKKRHPDPEVSHRARHHHQLGRHG 47



 Score = 31.1 bits (67), Expect = 7.9
 Identities = 12/26 (46%), Positives = 17/26 (65%)
 Frame = +1

Query: 253 KPRHQGVMVGMGQKDSYVGDEAQSKR 330
           +PRHQGVMVGMG++     +    K+
Sbjct: 1   RPRHQGVMVGMGRRTPTSDERGPEKK 26


>UniRef50_Q7M3B0 Cluster: Actin beta; n=1; Sus scrofa domestica|Rep:
           Actin beta - Sus scrofa domestica (domestic pig)
          Length = 195

 Score = 40.3 bits (90), Expect = 0.013
 Identities = 18/20 (90%), Positives = 18/20 (90%)
 Frame = +2

Query: 200 AGFAGYDAPRAVFPSIVGSP 259
           AGFAG DAPRAVFPSIVG P
Sbjct: 1   AGFAGDDAPRAVFPSIVGRP 20



 Score = 37.5 bits (83), Expect = 0.091
 Identities = 17/32 (53%), Positives = 20/32 (62%), Gaps = 2/32 (6%)
 Frame = +1

Query: 301 YVGDEAQSK--RGILTLKYPIEHGIATNWDDM 390
           + GD+A       I+   YPIEHGI TNWDDM
Sbjct: 3   FAGDDAPRAVFPSIVGRPYPIEHGIVTNWDDM 34


>UniRef50_P61158 Cluster: Actin-related protein 3; n=107;
           Eukaryota|Rep: Actin-related protein 3 - Homo sapiens
           (Human)
          Length = 418

 Score = 40.3 bits (90), Expect = 0.013
 Identities = 22/57 (38%), Positives = 29/57 (50%)
 Frame = +1

Query: 220 CSSRSVSLDRGKPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIATNWDDM 390
           C +   S   G    + VM G+   D ++GDEA  K    T K+PI HGI  +WD M
Sbjct: 34  CIAIKESAKVGDQAQRRVMKGVDDLDFFIGDEAIEKPTYAT-KWPIRHGIVEDWDLM 89


>UniRef50_A4S826 Cluster: Predicted protein; n=1; Ostreococcus
           lucimarinus CCE9901|Rep: Predicted protein -
           Ostreococcus lucimarinus CCE9901
          Length = 346

 Score = 39.9 bits (89), Expect = 0.017
 Identities = 20/27 (74%), Positives = 22/27 (81%), Gaps = 1/27 (3%)
 Frame = +2

Query: 143 MCDE-EVAALVVDNGSGMCKAGFAGYD 220
           M DE E++ALV DNGSGM KAGFAG D
Sbjct: 1   MADEGELSALVCDNGSGMVKAGFAGDD 27


>UniRef50_Q8TDY3 Cluster: Actin-related protein T2; n=26;
           Amniota|Rep: Actin-related protein T2 - Homo sapiens
           (Human)
          Length = 377

 Score = 39.5 bits (88), Expect = 0.023
 Identities = 17/30 (56%), Positives = 21/30 (70%)
 Frame = +2

Query: 164 ALVVDNGSGMCKAGFAGYDAPRAVFPSIVG 253
           A++ DNGSG CKAG +G   PR +  SIVG
Sbjct: 11  AVIFDNGSGFCKAGLSGEFGPRHMVSSIVG 40



 Score = 37.9 bits (84), Expect = 0.069
 Identities = 18/47 (38%), Positives = 24/47 (51%)
 Frame = +1

Query: 250 GKPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIATNWDDM 390
           G  + Q       QK  +VG+EA  K+  L L  P E G+ T WDD+
Sbjct: 40  GHLKFQAPSAEANQKKYFVGEEALYKQEALQLHSPFERGLITGWDDV 86


>UniRef50_Q7M3Y5 Cluster: Actin; n=1; Aplysia californica|Rep: Actin
           - Aplysia californica (California sea hare)
          Length = 92

 Score = 39.1 bits (87), Expect = 0.030
 Identities = 18/19 (94%), Positives = 18/19 (94%)
 Frame = +2

Query: 158 VAALVVDNGSGMCKAGFAG 214
           VAALVVDNGSGM KAGFAG
Sbjct: 1   VAALVVDNGSGMXKAGFAG 19


>UniRef50_A0D9D5 Cluster: Chromosome undetermined scaffold_42, whole
           genome shotgun sequence; n=1; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_42,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 94

 Score = 39.1 bits (87), Expect = 0.030
 Identities = 16/35 (45%), Positives = 24/35 (68%)
 Frame = +2

Query: 167 LVVDNGSGMCKAGFAGYDAPRAVFPSIVGSPAIRA 271
           ++ D+G+G  K GFAG + P   FP++VG P +RA
Sbjct: 5   IIEDSGTGYLKIGFAGDNFPSHSFPAMVGRPTLRA 39



 Score = 31.9 bits (69), Expect = 4.5
 Identities = 13/23 (56%), Positives = 17/23 (73%)
 Frame = +1

Query: 292 KDSYVGDEAQSKRGILTLKYPIE 360
           KD  +GDEAQ  RG+L L +P+E
Sbjct: 49  KDIMIGDEAQPYRGLLELTHPLE 71


>UniRef50_Q9H568 Cluster: Actin-like protein 8; n=10; Eutheria|Rep:
           Actin-like protein 8 - Homo sapiens (Human)
          Length = 366

 Score = 39.1 bits (87), Expect = 0.030
 Identities = 15/28 (53%), Positives = 23/28 (82%)
 Frame = +2

Query: 167 LVVDNGSGMCKAGFAGYDAPRAVFPSIV 250
           +++D+GSG  KAG AG++ P+ VFP+IV
Sbjct: 6   VIIDHGSGFLKAGTAGWNEPQMVFPNIV 33


>UniRef50_O96019 Cluster: Actin-like protein 6A; n=63;
           Eumetazoa|Rep: Actin-like protein 6A - Homo sapiens
           (Human)
          Length = 429

 Score = 39.1 bits (87), Expect = 0.030
 Identities = 17/34 (50%), Positives = 23/34 (67%)
 Frame = +2

Query: 152 EEVAALVVDNGSGMCKAGFAGYDAPRAVFPSIVG 253
           +EV ALV D GS   +AG+AG D P+  FP+ +G
Sbjct: 9   DEVGALVFDIGSYTVRAGYAGEDCPKVDFPTAIG 42


>UniRef50_UPI000049A548 Cluster: actin; n=1; Entamoeba histolytica
           HM-1:IMSS|Rep: actin - Entamoeba histolytica HM-1:IMSS
          Length = 365

 Score = 38.7 bits (86), Expect = 0.039
 Identities = 14/29 (48%), Positives = 22/29 (75%)
 Frame = +2

Query: 167 LVVDNGSGMCKAGFAGYDAPRAVFPSIVG 253
           +++DNGSG+ KAG +  + P+ VFP +VG
Sbjct: 6   IIIDNGSGLIKAGESSEELPKIVFPCVVG 34


>UniRef50_Q55DS6 Cluster: Putative uncharacterized protein; n=1;
           Dictyostelium discoideum AX4|Rep: Putative
           uncharacterized protein - Dictyostelium discoideum AX4
          Length = 392

 Score = 38.7 bits (86), Expect = 0.039
 Identities = 16/48 (33%), Positives = 30/48 (62%), Gaps = 1/48 (2%)
 Frame = +1

Query: 250 GKPRHQGVMVGM-GQKDSYVGDEAQSKRGILTLKYPIEHGIATNWDDM 390
           G+ ++  V+ G   +K  + G E ++++  +++K+PIE G   NWDDM
Sbjct: 44  GRTKYYEVLYGAPNKKVIFAGHEVETQKTNISIKHPIERGSIINWDDM 91



 Score = 32.3 bits (70), Expect = 3.4
 Identities = 15/37 (40%), Positives = 25/37 (67%), Gaps = 2/37 (5%)
 Frame = +2

Query: 149 DEEVA-ALVVDNGSGMCKAGFAGYD-APRAVFPSIVG 253
           +EE+  ++++D GSG  K GF+  +  PR  FP+I+G
Sbjct: 8   NEEIRNSVIIDCGSGFTKVGFSNEELTPRNEFPTIIG 44


>UniRef50_A6R1X8 Cluster: Putative uncharacterized protein; n=1;
           Ajellomyces capsulatus NAm1|Rep: Putative
           uncharacterized protein - Ajellomyces capsulatus NAm1
          Length = 444

 Score = 38.7 bits (86), Expect = 0.039
 Identities = 15/34 (44%), Positives = 24/34 (70%)
 Frame = +2

Query: 152 EEVAALVVDNGSGMCKAGFAGYDAPRAVFPSIVG 253
           +EV+A+++D G    +AGFAG D P++V P+  G
Sbjct: 15  DEVSAIILDPGYSTVRAGFAGEDTPKSVIPTCYG 48


>UniRef50_Q9P7X7 Cluster: Actin-related protein 4; n=1;
           Schizosaccharomyces pombe|Rep: Actin-related protein 4 -
           Schizosaccharomyces pombe (Fission yeast)
          Length = 433

 Score = 38.7 bits (86), Expect = 0.039
 Identities = 16/34 (47%), Positives = 23/34 (67%)
 Frame = +2

Query: 152 EEVAALVVDNGSGMCKAGFAGYDAPRAVFPSIVG 253
           +EV+A+V+D GS   + GF+G D P+ V PS  G
Sbjct: 9   DEVSAIVIDPGSKWTRIGFSGEDIPKCVLPSYCG 42


>UniRef50_Q9Y615 Cluster: Actin-like protein 7A; n=11; Mammalia|Rep:
           Actin-like protein 7A - Homo sapiens (Human)
          Length = 435

 Score = 38.7 bits (86), Expect = 0.039
 Identities = 17/53 (32%), Positives = 27/53 (50%)
 Frame = +1

Query: 226 SRSVSLDRGKPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIATNWD 384
           +  +S   GKP  +    G  +K+++VG E  +    L L  P+ HGI  +WD
Sbjct: 92  THKISTTVGKPYMETAKTGDNRKETFVGQELNNTNVHLKLVNPLRHGIIVDWD 144



 Score = 36.7 bits (81), Expect = 0.16
 Identities = 17/36 (47%), Positives = 20/36 (55%)
 Frame = +2

Query: 152 EEVAALVVDNGSGMCKAGFAGYDAPRAVFPSIVGSP 259
           E   A+VVD G+G CK GFAG   P     + VG P
Sbjct: 67  EVTKAVVVDLGTGYCKCGFAGLPRPTHKISTTVGKP 102


>UniRef50_UPI0000498FDF Cluster: actin; n=1; Entamoeba histolytica
           HM-1:IMSS|Rep: actin - Entamoeba histolytica HM-1:IMSS
          Length = 763

 Score = 38.3 bits (85), Expect = 0.052
 Identities = 19/37 (51%), Positives = 26/37 (70%)
 Frame = +1

Query: 250 GKPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIE 360
           GK  HQ    G  +++ YVGDEA  KRGIL+L+YP++
Sbjct: 452 GKNLHQ--TSGFVEQNLYVGDEAIDKRGILSLEYPMQ 486


>UniRef50_A2VD47 Cluster: Zgc:158823 protein; n=3; Eukaryota|Rep:
           Zgc:158823 protein - Danio rerio (Zebrafish)
           (Brachydanio rerio)
          Length = 334

 Score = 38.3 bits (85), Expect = 0.052
 Identities = 20/57 (35%), Positives = 29/57 (50%)
 Frame = +1

Query: 220 CSSRSVSLDRGKPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIATNWDDM 390
           C +   S   G    + ++ G+   D ++GDEA  K    T K+PI HGI  +WD M
Sbjct: 35  CIAVRESASVGDQAQRRLVKGVDDLDFFIGDEAIDKPNYAT-KWPIRHGIIEDWDFM 90


>UniRef50_Q8IIQ4 Cluster: Actin, putative; n=7; Apicomplexa|Rep:
           Actin, putative - Plasmodium falciparum (isolate 3D7)
          Length = 392

 Score = 38.3 bits (85), Expect = 0.052
 Identities = 17/33 (51%), Positives = 21/33 (63%)
 Frame = +2

Query: 155 EVAALVVDNGSGMCKAGFAGYDAPRAVFPSIVG 253
           E   +V+DNGSG  KAG    + P  VFP+IVG
Sbjct: 2   ENKTIVIDNGSGYIKAGINSSEEPTIVFPTIVG 34


>UniRef50_Q38F20 Cluster: Actin-like protein 3, putative; n=1;
           Trypanosoma brucei|Rep: Actin-like protein 3, putative -
           Trypanosoma brucei
          Length = 416

 Score = 38.3 bits (85), Expect = 0.052
 Identities = 16/32 (50%), Positives = 20/32 (62%)
 Frame = +1

Query: 295 DSYVGDEAQSKRGILTLKYPIEHGIATNWDDM 390
           D YVGDEA +      L +PI+HGI  +WD M
Sbjct: 51  DFYVGDEALAHSSSCNLYHPIKHGIVEDWDKM 82



 Score = 31.5 bits (68), Expect = 6.0
 Identities = 11/26 (42%), Positives = 18/26 (69%)
 Frame = +2

Query: 167 LVVDNGSGMCKAGFAGYDAPRAVFPS 244
           +V+DNG+G  K G+AG + P  + P+
Sbjct: 6   VVIDNGTGYTKMGYAGNEEPTYIIPT 31


>UniRef50_UPI0000F2DE11 Cluster: PREDICTED: similar to
           testis-specific actin-related protein 3; n=1;
           Monodelphis domestica|Rep: PREDICTED: similar to
           testis-specific actin-related protein 3 - Monodelphis
           domestica
          Length = 939

 Score = 37.9 bits (84), Expect = 0.069
 Identities = 16/34 (47%), Positives = 23/34 (67%)
 Frame = +2

Query: 152 EEVAALVVDNGSGMCKAGFAGYDAPRAVFPSIVG 253
           + +AA+V+D G+G  K G AG D  RA+ P+ VG
Sbjct: 106 KNLAAVVIDTGTGYSKCGLAGEDRTRAIVPTRVG 139


>UniRef50_Q54E71 Cluster: Putative uncharacterized protein; n=1;
           Dictyostelium discoideum AX4|Rep: Putative
           uncharacterized protein - Dictyostelium discoideum AX4
          Length = 684

 Score = 37.9 bits (84), Expect = 0.069
 Identities = 14/29 (48%), Positives = 22/29 (75%)
 Frame = +2

Query: 167 LVVDNGSGMCKAGFAGYDAPRAVFPSIVG 253
           +++DNGS  C+AGFA   +P+ +F S+VG
Sbjct: 33  IIIDNGSYQCRAGFANDISPKLIFRSLVG 61


>UniRef50_UPI0000F2D272 Cluster: PREDICTED: similar to actin; n=1;
           Monodelphis domestica|Rep: PREDICTED: similar to actin -
           Monodelphis domestica
          Length = 790

 Score = 37.5 bits (83), Expect = 0.091
 Identities = 17/33 (51%), Positives = 21/33 (63%)
 Frame = +2

Query: 155 EVAALVVDNGSGMCKAGFAGYDAPRAVFPSIVG 253
           E + LVVD GS  CKAG+ G   P  + PS+VG
Sbjct: 423 ERSCLVVDIGSACCKAGWCGEKFPPIIVPSVVG 455



 Score = 34.3 bits (75), Expect = 0.85
 Identities = 15/33 (45%), Positives = 21/33 (63%)
 Frame = +2

Query: 155 EVAALVVDNGSGMCKAGFAGYDAPRAVFPSIVG 253
           E +++V+D GS  CKAG A  + P    PS+VG
Sbjct: 68  ESSSVVIDIGSAWCKAGLAMENYPTLAVPSVVG 100


>UniRef50_A7TST0 Cluster: Putative uncharacterized protein; n=1;
           Vanderwaltozyma polyspora DSM 70294|Rep: Putative
           uncharacterized protein - Vanderwaltozyma polyspora DSM
           70294
          Length = 501

 Score = 37.5 bits (83), Expect = 0.091
 Identities = 14/39 (35%), Positives = 26/39 (66%)
 Frame = +2

Query: 152 EEVAALVVDNGSGMCKAGFAGYDAPRAVFPSIVGSPAIR 268
           +E++A+V+D GS     G++G D P+A+ PS  G  +++
Sbjct: 12  DEISAVVIDPGSFTTNIGYSGTDCPQAILPSYYGEISLK 50


>UniRef50_P32392 Cluster: Actin-related protein 3; n=27;
           Eukaryota|Rep: Actin-related protein 3 - Drosophila
           melanogaster (Fruit fly)
          Length = 418

 Score = 37.5 bits (83), Expect = 0.091
 Identities = 16/47 (34%), Positives = 26/47 (55%)
 Frame = +1

Query: 250 GKPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIATNWDDM 390
           G    + +  G+   D ++GDEA    G  ++KYP+ HG+  +WD M
Sbjct: 44  GDTNTRRITKGIEDLDFFIGDEAFDATGY-SIKYPVRHGLVEDWDLM 89



 Score = 31.5 bits (68), Expect = 6.0
 Identities = 13/29 (44%), Positives = 18/29 (62%)
 Frame = +2

Query: 164 ALVVDNGSGMCKAGFAGYDAPRAVFPSIV 250
           A V+D G+G  K GFAG   P+ + PS +
Sbjct: 7   ACVIDVGTGYSKLGFAGNKEPQFIIPSAI 35


>UniRef50_Q18PR4 Cluster: Actin-related protein; n=1; Porphyra
           yezoensis|Rep: Actin-related protein - Porphyra
           yezoensis
          Length = 573

 Score = 37.1 bits (82), Expect = 0.12
 Identities = 16/36 (44%), Positives = 23/36 (63%)
 Frame = +2

Query: 149 DEEVAALVVDNGSGMCKAGFAGYDAPRAVFPSIVGS 256
           D  V ++V D GS  CK GFAG D P +++ S +G+
Sbjct: 5   DGTVPSVVFDFGSHTCKVGFAGEDLPHSLYSSNIGA 40


>UniRef50_Q5C3R3 Cluster: SJCHGC08022 protein; n=1; Schistosoma
           japonicum|Rep: SJCHGC08022 protein - Schistosoma
           japonicum (Blood fluke)
          Length = 209

 Score = 37.1 bits (82), Expect = 0.12
 Identities = 12/31 (38%), Positives = 22/31 (70%)
 Frame = +2

Query: 167 LVVDNGSGMCKAGFAGYDAPRAVFPSIVGSP 259
           +V+DNG+  C+AG++ ++ P   FP++V  P
Sbjct: 39  IVIDNGNFECRAGYSNFEKPHMTFPNVVYRP 69


>UniRef50_P80428 Cluster: Actin-related protein 4; n=4;
           Saccharomycetales|Rep: Actin-related protein 4 -
           Saccharomyces cerevisiae (Baker's yeast)
          Length = 489

 Score = 36.7 bits (81), Expect = 0.16
 Identities = 14/34 (41%), Positives = 24/34 (70%)
 Frame = +2

Query: 152 EEVAALVVDNGSGMCKAGFAGYDAPRAVFPSIVG 253
           +EV+A+V+D GS     G++G D P+++ PS+ G
Sbjct: 12  DEVSAVVIDPGSYTTNIGYSGSDFPQSILPSVYG 45


>UniRef50_Q4Q2Y4 Cluster: Putative uncharacterized protein; n=3;
           Leishmania|Rep: Putative uncharacterized protein -
           Leishmania major
          Length = 491

 Score = 36.3 bits (80), Expect = 0.21
 Identities = 32/87 (36%), Positives = 40/87 (45%), Gaps = 9/87 (10%)
 Frame = +1

Query: 109 HTYILLISLIQDVRRRSCRVGSRQWLRYVQGR-LRRI*CS----SRSVSLDRGKPRHQGV 273
           H    +I+L QD RRR   +  R W    Q    +RI  S    SRS SL RG PRH G 
Sbjct: 66  HVTRSMIALSQDERRRGMEL-RRSWQSLTQQHGSKRIQTSRTPSSRSASLMRGTPRHPGE 124

Query: 274 MVGM----GQKDSYVGDEAQSKRGILT 342
            + M     + +   G  A S RG+ T
Sbjct: 125 TLSMDLFPDEPEQEYGASAVSTRGLST 151


>UniRef50_A2FH22 Cluster: Actin family protein; n=1; Trichomonas
           vaginalis G3|Rep: Actin family protein - Trichomonas
           vaginalis G3
          Length = 390

 Score = 36.3 bits (80), Expect = 0.21
 Identities = 16/32 (50%), Positives = 18/32 (56%)
 Frame = +1

Query: 292 KDSYVGDEAQSKRGILTLKYPIEHGIATNWDD 387
           KD  V DE    R  L L  P+EHGI  NW+D
Sbjct: 50  KDIMVCDETYPVRQYLDLTLPVEHGIVKNWED 81


>UniRef50_Q0H7S7 Cluster: Actin; n=29; Sordariomycetes|Rep: Actin -
           Phaeoacremonium sphinctrophorum
          Length = 39

 Score = 35.9 bits (79), Expect = 0.28
 Identities = 15/19 (78%), Positives = 17/19 (89%)
 Frame = +2

Query: 191 MCKAGFAGYDAPRAVFPSI 247
           MCKAGFAG DAPRAVF ++
Sbjct: 1   MCKAGFAGDDAPRAVFRNL 19


>UniRef50_Q7SHR0 Cluster: Actin-related protein 4; n=16;
           Pezizomycotina|Rep: Actin-related protein 4 - Neurospora
           crassa
          Length = 469

 Score = 35.9 bits (79), Expect = 0.28
 Identities = 16/34 (47%), Positives = 23/34 (67%)
 Frame = +2

Query: 152 EEVAALVVDNGSGMCKAGFAGYDAPRAVFPSIVG 253
           +EV+ALV+D G    +AG+AG + P+ V PS  G
Sbjct: 20  DEVSALVLDPGYCNTRAGYAGEEMPKQVLPSFYG 53


>UniRef50_Q9NZ32 Cluster: Actin-related protein 10; n=40;
           Eumetazoa|Rep: Actin-related protein 10 - Homo sapiens
           (Human)
          Length = 417

 Score = 35.9 bits (79), Expect = 0.28
 Identities = 14/32 (43%), Positives = 19/32 (59%)
 Frame = +2

Query: 155 EVAALVVDNGSGMCKAGFAGYDAPRAVFPSIV 250
           E  A+V+D G    K GFAG   PR + PS++
Sbjct: 12  EKTAVVIDLGEAFTKCGFAGETGPRCIIPSVI 43


>UniRef50_Q7UE30 Cluster: Similar to preprotein translocase SecA
           chain; n=1; Pirellula sp.|Rep: Similar to preprotein
           translocase SecA chain - Rhodopirellula baltica
          Length = 503

 Score = 35.5 bits (78), Expect = 0.37
 Identities = 26/79 (32%), Positives = 46/79 (58%), Gaps = 4/79 (5%)
 Frame = +1

Query: 166 VGSRQWLRYVQGRL---RRI*CSSRSVSLDR-GKPRHQGVMVGMGQKDSYVGDEAQSKRG 333
           +G+ +W+R    RL   R++      V++DR  + R    ++ MG +D+  G  A S+RG
Sbjct: 98  LGAERWIRQHPDRLFIDRKL-DRKLPVNIDRRDQIRFHHCILAMGARDACKG--AGSRRG 154

Query: 334 ILTLKYPIEHGIATNWDDM 390
            LTL+ P++ G AT+ D++
Sbjct: 155 SLTLEAPMDAGAATSPDNL 173


>UniRef50_A2YQV6 Cluster: Putative uncharacterized protein; n=1;
           Oryza sativa (indica cultivar-group)|Rep: Putative
           uncharacterized protein - Oryza sativa subsp. indica
           (Rice)
          Length = 581

 Score = 35.5 bits (78), Expect = 0.37
 Identities = 17/39 (43%), Positives = 22/39 (56%), Gaps = 3/39 (7%)
 Frame = +1

Query: 283 MGQKDSYVGDEAQS---KRGILTLKYPIEHGIATNWDDM 390
           M   D ++GDEA S     G+ T K+PI HG   +WD M
Sbjct: 364 MADLDFFMGDEALSLFKSSGLYTRKHPINHGQVDDWDTM 402


>UniRef50_Q6C061 Cluster: Actin-related protein 4; n=1; Yarrowia
           lipolytica|Rep: Actin-related protein 4 - Yarrowia
           lipolytica (Candida lipolytica)
          Length = 432

 Score = 35.5 bits (78), Expect = 0.37
 Identities = 15/34 (44%), Positives = 21/34 (61%)
 Frame = +2

Query: 152 EEVAALVVDNGSGMCKAGFAGYDAPRAVFPSIVG 253
           +EVA LV+D GS   + G+AG D P+ V  +  G
Sbjct: 14  DEVATLVIDTGSSYTRVGYAGEDTPKLVVSTECG 47


>UniRef50_Q6CSB9 Cluster: Actin-related protein 4; n=1;
           Kluyveromyces lactis|Rep: Actin-related protein 4 -
           Kluyveromyces lactis (Yeast) (Candida sphaerica)
          Length = 520

 Score = 35.5 bits (78), Expect = 0.37
 Identities = 13/35 (37%), Positives = 24/35 (68%)
 Frame = +2

Query: 152 EEVAALVVDNGSGMCKAGFAGYDAPRAVFPSIVGS 256
           +E+ A+V+D GS +   G++G D P+++ PS  G+
Sbjct: 12  DEINAIVIDPGSFVTNIGYSGTDCPQSIMPSSYGN 46


>UniRef50_Q8IS27 Cluster: Actin-related protein 2; n=5;
           Oligohymenophorea|Rep: Actin-related protein 2 -
           Tetrahymena thermophila
          Length = 393

 Score = 35.1 bits (77), Expect = 0.48
 Identities = 13/34 (38%), Positives = 23/34 (67%)
 Frame = +2

Query: 167 LVVDNGSGMCKAGFAGYDAPRAVFPSIVGSPAIR 268
           +V D+G+G  K G+AG + P+   P+++G P +R
Sbjct: 7   IVCDSGTGYIKIGYAGDNFPKYSIPAMIGRPMLR 40



 Score = 32.3 bits (70), Expect = 3.4
 Identities = 13/33 (39%), Positives = 18/33 (54%)
 Frame = +1

Query: 292 KDSYVGDEAQSKRGILTLKYPIEHGIATNWDDM 390
           K+  +G EA   + +L L  P+E G   NW DM
Sbjct: 51  KEIMIGGEAAPYQAMLELTKPVEEGTVKNWQDM 83


>UniRef50_Q4UGT7 Cluster: Actin-related protein, putative; n=2;
           Theileria|Rep: Actin-related protein, putative -
           Theileria annulata
          Length = 575

 Score = 35.1 bits (77), Expect = 0.48
 Identities = 16/35 (45%), Positives = 21/35 (60%)
 Frame = +2

Query: 167 LVVDNGSGMCKAGFAGYDAPRAVFPSIVGSPAIRA 271
           +V++NGSG  K G AG   P  V P+ VG P  +A
Sbjct: 12  VVLENGSGYVKIGMAGNKKPPHVIPNCVGQPKKKA 46


>UniRef50_Q383R8 Cluster: Actin-like protein, putative; n=4;
           Trypanosoma|Rep: Actin-like protein, putative -
           Trypanosoma brucei
          Length = 394

 Score = 35.1 bits (77), Expect = 0.48
 Identities = 15/39 (38%), Positives = 23/39 (58%)
 Frame = +2

Query: 152 EEVAALVVDNGSGMCKAGFAGYDAPRAVFPSIVGSPAIR 268
           ++   +V D GS   + GFAG +APR +  ++VG P  R
Sbjct: 3   QQQPVVVFDMGSNKTRVGFAGEEAPRVISSTVVGVPRQR 41



 Score = 33.9 bits (74), Expect = 1.1
 Identities = 16/49 (32%), Positives = 28/49 (57%), Gaps = 2/49 (4%)
 Frame = +1

Query: 250 GKPRHQGVMVGMGQ--KDSYVGDEAQSKRGILTLKYPIEHGIATNWDDM 390
           G PR +G++  + Q   D Y GD A ++ G+L L YP+ +   T+  ++
Sbjct: 36  GVPRQRGLVGSLMQHYSDDYAGDAACAQEGMLNLSYPVRNRRITSMPEV 84


>UniRef50_A2DBN6 Cluster: Actin family protein; n=1; Trichomonas
           vaginalis G3|Rep: Actin family protein - Trichomonas
           vaginalis G3
          Length = 373

 Score = 35.1 bits (77), Expect = 0.48
 Identities = 12/33 (36%), Positives = 22/33 (66%)
 Frame = +2

Query: 155 EVAALVVDNGSGMCKAGFAGYDAPRAVFPSIVG 253
           EV+ +V+D G+   +AGF G   P+ + P+++G
Sbjct: 2   EVSTIVIDTGAYSTRAGFGGDSDPQCILPTVIG 34


>UniRef50_Q6X960 Cluster: HSD21; n=13; Theria|Rep: HSD21 - Homo
           sapiens (Human)
          Length = 416

 Score = 35.1 bits (77), Expect = 0.48
 Identities = 14/33 (42%), Positives = 21/33 (63%)
 Frame = +2

Query: 155 EVAALVVDNGSGMCKAGFAGYDAPRAVFPSIVG 253
           +  A+V+D G+G CK GFAG  +P     +I+G
Sbjct: 48  KTGAVVIDMGTGTCKVGFAGQASPTYTVATILG 80


>UniRef50_Q09849 Cluster: Uncharacterized protein C23D3.09; n=1;
           Schizosaccharomyces pombe|Rep: Uncharacterized protein
           C23D3.09 - Schizosaccharomyces pombe (Fission yeast)
          Length = 430

 Score = 35.1 bits (77), Expect = 0.48
 Identities = 14/34 (41%), Positives = 22/34 (64%)
 Frame = +2

Query: 152 EEVAALVVDNGSGMCKAGFAGYDAPRAVFPSIVG 253
           EE+ +LV+D GS   + G+AG ++P  + PS  G
Sbjct: 8   EEIPSLVIDPGSCWTRFGYAGEESPMTILPSYYG 41


>UniRef50_Q4Q187 Cluster: Actin-like protein, putative; n=3;
           Leishmania|Rep: Actin-like protein, putative -
           Leishmania major
          Length = 407

 Score = 34.3 bits (75), Expect = 0.85
 Identities = 15/37 (40%), Positives = 23/37 (62%)
 Frame = +2

Query: 158 VAALVVDNGSGMCKAGFAGYDAPRAVFPSIVGSPAIR 268
           + ++VVD G+   + GF+G +APR +  S VG P  R
Sbjct: 8   IQSVVVDVGTRNTRVGFSGEEAPRTMLRSCVGLPGTR 44


>UniRef50_Q19R57 Cluster: Actin-like protein 1; n=2; Trypanosoma
           cruzi|Rep: Actin-like protein 1 - Trypanosoma cruzi
           strain CL Brener
          Length = 390

 Score = 34.3 bits (75), Expect = 0.85
 Identities = 14/32 (43%), Positives = 20/32 (62%)
 Frame = +2

Query: 167 LVVDNGSGMCKAGFAGYDAPRAVFPSIVGSPA 262
           ++VD GS + KAG      P  +FP++VG PA
Sbjct: 2   IIVDFGSSLVKAGTVTESLPSLIFPAVVGVPA 33


>UniRef50_Q9LHH0 Cluster: Actin-like protein; n=11;
           Magnoliophyta|Rep: Actin-like protein - Arabidopsis
           thaliana (Mouse-ear cress)
          Length = 724

 Score = 33.9 bits (74), Expect = 1.1
 Identities = 15/35 (42%), Positives = 22/35 (62%)
 Frame = +2

Query: 167 LVVDNGSGMCKAGFAGYDAPRAVFPSIVGSPAIRA 271
           +V+DNG+   + G+AG   PR VF +IV  P  +A
Sbjct: 22  IVIDNGASYFRIGWAGETEPRVVFRNIVQRPRHKA 56


>UniRef50_A3FQE6 Cluster: Putative uncharacterized protein; n=2;
           Cryptosporidium|Rep: Putative uncharacterized protein -
           Cryptosporidium parvum Iowa II
          Length = 396

 Score = 33.9 bits (74), Expect = 1.1
 Identities = 12/33 (36%), Positives = 23/33 (69%)
 Frame = +2

Query: 161 AALVVDNGSGMCKAGFAGYDAPRAVFPSIVGSP 259
           +++++D G+   +AG+ G D PR+V P+ +G P
Sbjct: 15  SSIILDIGTQSIRAGYGGDDLPRSVVPTCIGIP 47


>UniRef50_Q6C0A9 Cluster: Yarrowia lipolytica chromosome F of strain
           CLIB122 of Yarrowia lipolytica; n=1; Yarrowia
           lipolytica|Rep: Yarrowia lipolytica chromosome F of
           strain CLIB122 of Yarrowia lipolytica - Yarrowia
           lipolytica (Candida lipolytica)
          Length = 427

 Score = 33.9 bits (74), Expect = 1.1
 Identities = 13/34 (38%), Positives = 22/34 (64%)
 Frame = +2

Query: 152 EEVAALVVDNGSGMCKAGFAGYDAPRAVFPSIVG 253
           +EV ++V++ GS   + GF+G D P+ V P+  G
Sbjct: 18  DEVTSIVIECGSSYTRVGFSGDDLPKVVIPTKYG 51


>UniRef50_UPI0000449ED3 Cluster: PREDICTED: similar to RIKEN cDNA
           4921517D21 gene; n=2; Gallus gallus|Rep: PREDICTED:
           similar to RIKEN cDNA 4921517D21 gene - Gallus gallus
          Length = 321

 Score = 33.5 bits (73), Expect = 1.5
 Identities = 13/31 (41%), Positives = 22/31 (70%)
 Frame = +2

Query: 152 EEVAALVVDNGSGMCKAGFAGYDAPRAVFPS 244
           +++ A+V+D G G  ++G AG + PR+V PS
Sbjct: 10  KDLCAVVIDTGMGHTRSGLAGDERPRSVAPS 40


>UniRef50_Q55DY5 Cluster: Putative uncharacterized protein; n=1;
           Dictyostelium discoideum AX4|Rep: Putative
           uncharacterized protein - Dictyostelium discoideum AX4
          Length = 355

 Score = 33.5 bits (73), Expect = 1.5
 Identities = 14/35 (40%), Positives = 20/35 (57%)
 Frame = +1

Query: 286 GQKDSYVGDEAQSKRGILTLKYPIEHGIATNWDDM 390
           G    + G EA ++     L YPI++GI  NW+DM
Sbjct: 40  GDTKLFYGKEAVARFSTSKLVYPIKNGIVCNWEDM 74


>UniRef50_Q6FRF2 Cluster: Similar to sp|P38696 Saccharomyces
           cerevisiae YHR129c ACT5; n=1; Candida glabrata|Rep:
           Similar to sp|P38696 Saccharomyces cerevisiae YHR129c
           ACT5 - Candida glabrata (Yeast) (Torulopsis glabrata)
          Length = 387

 Score = 33.5 bits (73), Expect = 1.5
 Identities = 14/45 (31%), Positives = 23/45 (51%)
 Frame = +1

Query: 250 GKPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIATNWD 384
           G P  +  MV +  K++Y+G+ A  +R  L L+ P       +WD
Sbjct: 41  GNPLAERSMVTVSNKETYIGNSAYERRATLHLESPYSTNAIMSWD 85



 Score = 32.3 bits (70), Expect = 3.4
 Identities = 13/31 (41%), Positives = 21/31 (67%)
 Frame = +2

Query: 167 LVVDNGSGMCKAGFAGYDAPRAVFPSIVGSP 259
           +++DNGS + KAGFAG   P  +  + +G+P
Sbjct: 13  VILDNGSSVIKAGFAGSQQPDVLEYAWIGNP 43


>UniRef50_UPI0000E47BC7 Cluster: PREDICTED: similar to ubiquitin/actin
            fusion protein; n=1; Strongylocentrotus purpuratus|Rep:
            PREDICTED: similar to ubiquitin/actin fusion protein -
            Strongylocentrotus purpuratus
          Length = 1608

 Score = 33.1 bits (72), Expect = 2.0
 Identities = 13/29 (44%), Positives = 19/29 (65%)
 Frame = +2

Query: 167  LVVDNGSGMCKAGFAGYDAPRAVFPSIVG 253
            +++DNGS M +AG A   AP    P++VG
Sbjct: 1236 IILDNGSSMLRAGLADGVAPSVTMPTVVG 1264


>UniRef50_A5B4L4 Cluster: Putative uncharacterized protein; n=1;
           Vitis vinifera|Rep: Putative uncharacterized protein -
           Vitis vinifera (Grape)
          Length = 571

 Score = 33.1 bits (72), Expect = 2.0
 Identities = 16/39 (41%), Positives = 20/39 (51%), Gaps = 3/39 (7%)
 Frame = +1

Query: 283 MGQKDSYVGDEAQSKR---GILTLKYPIEHGIATNWDDM 390
           M   D ++GDEA ++        L YPI HG   NWD M
Sbjct: 120 MADLDFFIGDEAIARSRNSSTYNLSYPIVHGQVDNWDAM 158


>UniRef50_Q54JL1 Cluster: Putative uncharacterized protein; n=1;
           Dictyostelium discoideum AX4|Rep: Putative
           uncharacterized protein - Dictyostelium discoideum AX4
          Length = 414

 Score = 33.1 bits (72), Expect = 2.0
 Identities = 16/42 (38%), Positives = 27/42 (64%), Gaps = 3/42 (7%)
 Frame = +1

Query: 274 MVGMGQKDSYVGDEAQ--SKRGI-LTLKYPIEHGIATNWDDM 390
           M+G+ +K+ Y G +    +KR   L+L  P++ GI +NW+DM
Sbjct: 40  MIGVERKNYYAGSDINFINKRNHRLSLTCPMKRGIVSNWEDM 81


>UniRef50_Q4N7N1 Cluster: Actin, putative; n=2; Theileria|Rep:
           Actin, putative - Theileria parva
          Length = 383

 Score = 33.1 bits (72), Expect = 2.0
 Identities = 16/39 (41%), Positives = 24/39 (61%)
 Frame = +2

Query: 143 MCDEEVAALVVDNGSGMCKAGFAGYDAPRAVFPSIVGSP 259
           M DE+   +V+DNGS   K G +G  +P  +  S+VG+P
Sbjct: 1   MADEQ--CVVIDNGSFSLKIGLSGSYSPSFIVHSVVGNP 37


>UniRef50_UPI0000E477BD Cluster: PREDICTED: similar to
           uncharacterized hypothalamus protein HARP11; n=1;
           Strongylocentrotus purpuratus|Rep: PREDICTED: similar to
           uncharacterized hypothalamus protein HARP11 -
           Strongylocentrotus purpuratus
          Length = 481

 Score = 32.7 bits (71), Expect = 2.6
 Identities = 17/45 (37%), Positives = 21/45 (46%)
 Frame = +2

Query: 155 EVAALVVDNGSGMCKAGFAGYDAPRAVFPSIVGSPAIRA*WSVWD 289
           E  A V D G+   K GFAG  +PRA  PS +          +WD
Sbjct: 12  EKTAAVFDIGAAYTKVGFAGETSPRATIPSKIKLSKTDKVVHIWD 56


>UniRef50_UPI0000EC9F4D Cluster: HSD21.; n=2; Gallus gallus|Rep:
           HSD21. - Gallus gallus
          Length = 373

 Score = 32.3 bits (70), Expect = 3.4
 Identities = 12/29 (41%), Positives = 21/29 (72%)
 Frame = +2

Query: 167 LVVDNGSGMCKAGFAGYDAPRAVFPSIVG 253
           +V+D G+  C+AGF+G+ +P A   ++VG
Sbjct: 15  IVIDMGTRSCRAGFSGHYSPSAEVSTLVG 43


>UniRef50_Q6LBB8 Cluster: Putative uncharacterized protein; n=1;
           Oligotropha carboxidovorans|Rep: Putative
           uncharacterized protein - Oligotropha carboxidovorans
           (Pseudomonas carboxydovorans)
          Length = 139

 Score = 32.3 bits (70), Expect = 3.4
 Identities = 13/43 (30%), Positives = 24/43 (55%)
 Frame = -2

Query: 238 KHCARSIISCEAGLAHTGAIVYYQRGNFFVAHLELVKLVRCRC 110
           +H + S   C +  +  G ++ ++RG + V+ L L +  RCRC
Sbjct: 94  RHLSHSSEWCASSTSCQGCLIRFERGLWRVSRLPLTRCSRCRC 136


>UniRef50_Q3M0X0 Cluster: Actin6-2; n=3; Paramecium tetraurelia|Rep:
           Actin6-2 - Paramecium tetraurelia
          Length = 394

 Score = 32.3 bits (70), Expect = 3.4
 Identities = 12/34 (35%), Positives = 22/34 (64%)
 Frame = +2

Query: 167 LVVDNGSGMCKAGFAGYDAPRAVFPSIVGSPAIR 268
           +V+DNG+   K G +G D PR ++ +  GS +++
Sbjct: 11  VVIDNGTDTIKVGISGEDYPRLIYDNKCGSHSVQ 44


>UniRef50_Q2PE20 Cluster: CG10067-PB, isoform B; n=1; Drosophila
           melanogaster|Rep: CG10067-PB, isoform B - Drosophila
           melanogaster (Fruit fly)
          Length = 36

 Score = 32.3 bits (70), Expect = 3.4
 Identities = 13/15 (86%), Positives = 15/15 (100%)
 Frame = +2

Query: 143 MCDEEVAALVVDNGS 187
           MCD+EVAALVVDNG+
Sbjct: 1   MCDDEVAALVVDNGA 15


>UniRef50_Q6BIA3 Cluster: CA5059|IPF3691 Candida albicans IPF3691;
           n=5; Saccharomycetales|Rep: CA5059|IPF3691 Candida
           albicans IPF3691 - Debaryomyces hansenii (Yeast)
           (Torulaspora hansenii)
          Length = 450

 Score = 32.3 bits (70), Expect = 3.4
 Identities = 16/27 (59%), Positives = 18/27 (66%)
 Frame = +2

Query: 164 ALVVDNGSGMCKAGFAGYDAPRAVFPS 244
           A+V+DNGS   KAGFA  D P  VF S
Sbjct: 7   AVVIDNGSHTTKAGFALDDLPSLVFNS 33


>UniRef50_Q7P253 Cluster: Putative uncharacterized protein; n=1;
           Chromobacterium violaceum|Rep: Putative uncharacterized
           protein - Chromobacterium violaceum
          Length = 202

 Score = 31.9 bits (69), Expect = 4.5
 Identities = 21/62 (33%), Positives = 30/62 (48%), Gaps = 4/62 (6%)
 Frame = -3

Query: 324 ALCLISYIRV-LLSHTDHHA---LMAGLPTIEGNTARGASYPAKPALHIPEPLSTTNAAT 157
           A C I +  V L++ +DHH     MAGL       A G +  A PA+ +P P+    A  
Sbjct: 2   ASCYIFHRTVALIAQSDHHCYAQFMAGLGGSVARHAGGDAGNANPAMRLPPPIGVGKAGL 61

Query: 156 SS 151
           S+
Sbjct: 62  ST 63


>UniRef50_Q3VWM2 Cluster: Putative uncharacterized protein; n=2;
           Chlorobiaceae|Rep: Putative uncharacterized protein -
           Prosthecochloris aestuarii DSM 271
          Length = 297

 Score = 31.9 bits (69), Expect = 4.5
 Identities = 16/39 (41%), Positives = 20/39 (51%)
 Frame = +3

Query: 15  IPGAGVPAPGRQSGICFSRLAVTAGRLIFILSHLHLTNF 131
           +P AG    GR S   +SRLA    R +FIL + H   F
Sbjct: 59  VPHAGYAFSGRASAEAYSRLAGNQYRTVFILGNAHAYRF 97


>UniRef50_Q19R70 Cluster: Actin-like protein 3; n=4; Leishmania|Rep:
           Actin-like protein 3 - Leishmania major
          Length = 519

 Score = 31.9 bits (69), Expect = 4.5
 Identities = 13/27 (48%), Positives = 19/27 (70%), Gaps = 1/27 (3%)
 Frame = +1

Query: 304 VGDEAQSKRGILTLKYPIEH-GIATNW 381
           VG +A S+RG+L L  PI+H G+  +W
Sbjct: 84  VGSDAASRRGVLRLSRPIQHGGVIMDW 110


>UniRef50_Q8SRZ3 Cluster: ACTIN-RELATED PROTEIN; n=1;
           Encephalitozoon cuniculi|Rep: ACTIN-RELATED PROTEIN -
           Encephalitozoon cuniculi
          Length = 555

 Score = 31.9 bits (69), Expect = 4.5
 Identities = 12/28 (42%), Positives = 22/28 (78%)
 Frame = +2

Query: 167 LVVDNGSGMCKAGFAGYDAPRAVFPSIV 250
           +V+DNG+  CKAG+ G ++P+ VF +++
Sbjct: 23  IVIDNGTYECKAGYCG-ESPQMVFKNVL 49


>UniRef50_Q4WA13 Cluster: Chromatin remodeling complex subunit
           (Arp5), putative; n=14; Pezizomycotina|Rep: Chromatin
           remodeling complex subunit (Arp5), putative -
           Aspergillus fumigatus (Sartorya fumigata)
          Length = 757

 Score = 31.9 bits (69), Expect = 4.5
 Identities = 12/30 (40%), Positives = 22/30 (73%)
 Frame = +2

Query: 161 AALVVDNGSGMCKAGFAGYDAPRAVFPSIV 250
           +A+V+DNGS + KAG++   +PR + P ++
Sbjct: 59  SAIVIDNGSSLLKAGWSFDVSPRFILPPVM 88


>UniRef50_Q2H0E9 Cluster: Putative uncharacterized protein; n=1;
           Chaetomium globosum|Rep: Putative uncharacterized
           protein - Chaetomium globosum (Soil fungus)
          Length = 656

 Score = 31.9 bits (69), Expect = 4.5
 Identities = 13/30 (43%), Positives = 19/30 (63%)
 Frame = +2

Query: 161 AALVVDNGSGMCKAGFAGYDAPRAVFPSIV 250
           A +V+DNGS   +AG++  D PR   P I+
Sbjct: 54  AVIVIDNGSSTVRAGWSFEDKPRLAIPPIM 83


>UniRef50_UPI0000E80C06 Cluster: PREDICTED: hypothetical protein;
           n=1; Gallus gallus|Rep: PREDICTED: hypothetical protein
           - Gallus gallus
          Length = 65

 Score = 31.5 bits (68), Expect = 6.0
 Identities = 13/25 (52%), Positives = 17/25 (68%)
 Frame = +2

Query: 254 SPAIRA*WSVWDRRTLM*EMRHRAK 328
           +P I+  W VW RRT M EM+ RA+
Sbjct: 36  APGIKVSWWVWGRRTAMWEMKPRAR 60


>UniRef50_Q7QA11 Cluster: ENSANGP00000003921; n=1; Anopheles gambiae
           str. PEST|Rep: ENSANGP00000003921 - Anopheles gambiae
           str. PEST
          Length = 390

 Score = 31.5 bits (68), Expect = 6.0
 Identities = 13/31 (41%), Positives = 20/31 (64%)
 Frame = +2

Query: 167 LVVDNGSGMCKAGFAGYDAPRAVFPSIVGSP 259
           +V+DNGS  C+AG+   + P  VF +I+  P
Sbjct: 5   IVIDNGSFNCRAGWMLKEKPALVFRNILAKP 35


>UniRef50_Q5CSX9 Cluster: Actin; n=2; Cryptosporidium|Rep: Actin -
           Cryptosporidium parvum Iowa II
          Length = 405

 Score = 31.5 bits (68), Expect = 6.0
 Identities = 12/27 (44%), Positives = 20/27 (74%)
 Frame = +1

Query: 301 YVGDEAQSKRGILTLKYPIEHGIATNW 381
           +VG+EA ++R  L+L +PI+HG   +W
Sbjct: 67  FVGEEAIAQRKKLSLTFPIDHGHIDDW 93


>UniRef50_A2FYS8 Cluster: Actin family protein; n=1; Trichomonas
           vaginalis G3|Rep: Actin family protein - Trichomonas
           vaginalis G3
          Length = 306

 Score = 31.5 bits (68), Expect = 6.0
 Identities = 12/22 (54%), Positives = 17/22 (77%)
 Frame = +2

Query: 164 ALVVDNGSGMCKAGFAGYDAPR 229
           A+V+D GS  C+AGFAG + P+
Sbjct: 3   AVVIDLGSYRCRAGFAGQEVPK 24


>UniRef50_Q9Y7X8 Cluster: Actin-like protein Arp5; n=1;
           Schizosaccharomyces pombe|Rep: Actin-like protein Arp5 -
           Schizosaccharomyces pombe (Fission yeast)
          Length = 721

 Score = 31.5 bits (68), Expect = 6.0
 Identities = 13/28 (46%), Positives = 19/28 (67%)
 Frame = +2

Query: 167 LVVDNGSGMCKAGFAGYDAPRAVFPSIV 250
           LV+DNGS   +AG+ G   P+ VF ++V
Sbjct: 27  LVIDNGSWQLRAGWGGEKDPKLVFDNLV 54


>UniRef50_A6RD01 Cluster: Putative uncharacterized protein; n=1;
           Ajellomyces capsulatus NAm1|Rep: Putative
           uncharacterized protein - Ajellomyces capsulatus NAm1
          Length = 762

 Score = 31.5 bits (68), Expect = 6.0
 Identities = 12/30 (40%), Positives = 22/30 (73%)
 Frame = +2

Query: 161 AALVVDNGSGMCKAGFAGYDAPRAVFPSIV 250
           +A+V+DNGS + KAG++   +PR + P ++
Sbjct: 111 SAIVIDNGSYLVKAGWSFDKSPRFIIPPVM 140


>UniRef50_P54829 Cluster: Tyrosine-protein phosphatase non-receptor
           type 5; n=27; Euteleostomi|Rep: Tyrosine-protein
           phosphatase non-receptor type 5 - Homo sapiens (Human)
          Length = 541

 Score = 31.5 bits (68), Expect = 6.0
 Identities = 11/27 (40%), Positives = 15/27 (55%)
 Frame = -2

Query: 256 ASHDRGKHCARSIISCEAGLAHTGAIV 176
           A+   G HCA  I+ C AG+  TG  +
Sbjct: 457 AAQQEGPHCAPIIVHCSAGIGRTGCFI 483


>UniRef50_Q9Y614 Cluster: Actin-like protein 7B; n=12; Theria|Rep:
           Actin-like protein 7B - Homo sapiens (Human)
          Length = 415

 Score = 31.5 bits (68), Expect = 6.0
 Identities = 13/33 (39%), Positives = 19/33 (57%)
 Frame = +2

Query: 155 EVAALVVDNGSGMCKAGFAGYDAPRAVFPSIVG 253
           ++ A+++D GS  CK G+AG   P     S VG
Sbjct: 48  KIKAVIIDLGSQYCKCGYAGEPRPTYFISSTVG 80


>UniRef50_UPI0000F2D271 Cluster: PREDICTED: similar to actin-like 8;
           n=1; Monodelphis domestica|Rep: PREDICTED: similar to
           actin-like 8 - Monodelphis domestica
          Length = 370

 Score = 31.1 bits (67), Expect = 7.9
 Identities = 11/30 (36%), Positives = 18/30 (60%)
 Frame = +2

Query: 164 ALVVDNGSGMCKAGFAGYDAPRAVFPSIVG 253
           ++V+D G+  CKAG  G + P    P ++G
Sbjct: 4   SVVIDIGNDWCKAGLGGKNYPTIAVPEVIG 33


>UniRef50_UPI00005A3B5D Cluster: PREDICTED: similar to Actin-5C;
           n=3; Laurasiatheria|Rep: PREDICTED: similar to Actin-5C
           - Canis familiaris
          Length = 1248

 Score = 31.1 bits (67), Expect = 7.9
 Identities = 14/33 (42%), Positives = 21/33 (63%)
 Frame = +2

Query: 152 EEVAALVVDNGSGMCKAGFAGYDAPRAVFPSIV 250
           +++AA+V+D G+G  K G A  D   +V PS V
Sbjct: 897 QDMAAVVIDTGTGFTKCGLAREDHVLSVLPSRV 929


>UniRef50_UPI000023ED98 Cluster: hypothetical protein FG07920.1;
           n=1; Gibberella zeae PH-1|Rep: hypothetical protein
           FG07920.1 - Gibberella zeae PH-1
          Length = 501

 Score = 31.1 bits (67), Expect = 7.9
 Identities = 13/36 (36%), Positives = 21/36 (58%)
 Frame = +1

Query: 220 CSSRSVSLDRGKPRHQGVMVGMGQKDSYVGDEAQSK 327
           C +R V  D GKP  Q  ++G   ++  +GD A+S+
Sbjct: 16  CKARKVKCDEGKPTCQRCVIGGRPRNHVLGDTARSE 51


>UniRef50_A4KCE4 Cluster: Tautomycetin biosynthetic PKS; n=2;
           cellular organisms|Rep: Tautomycetin biosynthetic PKS -
           Streptomyces sp. CK4412
          Length = 9648

 Score = 31.1 bits (67), Expect = 7.9
 Identities = 19/57 (33%), Positives = 27/57 (47%)
 Frame = -3

Query: 369 DSVFDGVFEGQDTSFALCLISYIRVLLSHTDHHALMAGLPTIEGNTARGASYPAKPA 199
           D+  DG   G+   F + L +  R L      HA++ G  T  G +ARG S P+  A
Sbjct: 344 DARADGYVRGEGGGFVV-LKTLARALADGDHIHAVIRGTATNNGGSARGLSVPSAAA 399


>UniRef50_Q8I450 Cluster: Actin-related protein, putative; n=5;
           Plasmodium|Rep: Actin-related protein, putative -
           Plasmodium falciparum (isolate 3D7)
          Length = 565

 Score = 31.1 bits (67), Expect = 7.9
 Identities = 14/35 (40%), Positives = 21/35 (60%)
 Frame = +2

Query: 155 EVAALVVDNGSGMCKAGFAGYDAPRAVFPSIVGSP 259
           ++ ++V+D G    K G+AG + P  VF S VG P
Sbjct: 6   DILSIVIDLGFENTKVGYAGDENPTNVFSSNVGMP 40


>UniRef50_Q4QJC9 Cluster: Putative uncharacterized protein; n=2;
           Leishmania|Rep: Putative uncharacterized protein -
           Leishmania major
          Length = 738

 Score = 31.1 bits (67), Expect = 7.9
 Identities = 18/58 (31%), Positives = 32/58 (55%), Gaps = 3/58 (5%)
 Frame = -2

Query: 322 SVPHLLHKSPSVPYRPSRPDGGASHDRGKHCARSIISCEA---GLAHTGAIVYYQRGN 158
           +V  L + S S+P+RP +P GGA+     +    + + +A   GL +T ++   QRG+
Sbjct: 477 AVESLSYASSSIPHRPCQPRGGAAGAAAMYAGHPVEASQAGSLGLVYTPSVT-PQRGS 533


>UniRef50_Q4QAS6 Cluster: Putative uncharacterized protein; n=4;
           Leishmania|Rep: Putative uncharacterized protein -
           Leishmania major
          Length = 513

 Score = 31.1 bits (67), Expect = 7.9
 Identities = 29/96 (30%), Positives = 40/96 (41%), Gaps = 4/96 (4%)
 Frame = -2

Query: 343 GSGYLFCSVPHLLHKSPSVPYRPSRPD---GGASHDRGKHCARSIISCEAGL-AHTGAIV 176
           GS   FC +  L   + SV  R    D    GAS    K   R ++SC  G+ A   A+V
Sbjct: 417 GSAATFCHLTRLTDWNASVYQRLQGVDLSARGASAPVSKKSVRHLVSCPEGIAASVEAVV 476

Query: 175 YYQRGNFFVAHLELVKLVRCRCDKMKIKRPAVTANR 68
              R  +   H  +V+LV    D +  K   + A R
Sbjct: 477 SQGRVQWLQRHGYIVRLVEYVPDCVTPKNRCMVAYR 512


>UniRef50_A7AQU0 Cluster: Actin-related, putative; n=1; Babesia
           bovis|Rep: Actin-related, putative - Babesia bovis
          Length = 508

 Score = 31.1 bits (67), Expect = 7.9
 Identities = 14/30 (46%), Positives = 17/30 (56%)
 Frame = +2

Query: 170 VVDNGSGMCKAGFAGYDAPRAVFPSIVGSP 259
           VVDNGSG+ K   A    P  V P+ +G P
Sbjct: 13  VVDNGSGLLKFSLASSVKPPFVLPNCIGHP 42


>UniRef50_A1CF15 Cluster: Phospholipase, patatin family protein;
           n=1; Aspergillus clavatus|Rep: Phospholipase, patatin
           family protein - Aspergillus clavatus
          Length = 627

 Score = 31.1 bits (67), Expect = 7.9
 Identities = 17/41 (41%), Positives = 23/41 (56%), Gaps = 1/41 (2%)
 Frame = +3

Query: 222 LLAQCFPRSWEAPPSGRDGRYGTEG-LLCRR*GTEQKRYPD 341
           +LA CF    + PPS  DG+Y   G +LC R  T+ +R  D
Sbjct: 467 VLASCFFFELDTPPSRADGQYRLHGSILCAR--TQSRRIVD 505


>UniRef50_Q5UR55 Cluster: Uncharacterized protein L581; n=1;
           Acanthamoeba polyphaga mimivirus|Rep: Uncharacterized
           protein L581 - Mimivirus
          Length = 742

 Score = 31.1 bits (67), Expect = 7.9
 Identities = 13/32 (40%), Positives = 22/32 (68%)
 Frame = +1

Query: 295 DSYVGDEAQSKRGILTLKYPIEHGIATNWDDM 390
           +S + D++Q KR ++T K+P E+GI+   D M
Sbjct: 355 ESIITDKSQLKRIVVTTKFPTEYGISVVIDTM 386


>UniRef50_P10220 Cluster: Large tegument protein; n=18; root|Rep:
            Large tegument protein - Human herpesvirus 1 (strain 17)
            (HHV-1) (Human herpes simplex virus1)
          Length = 3164

 Score = 31.1 bits (67), Expect = 7.9
 Identities = 14/34 (41%), Positives = 21/34 (61%)
 Frame = -3

Query: 273  HALMAGLPTIEGNTARGASYPAKPALHIPEPLST 172
            HAL++G+P   G  A G + PA P   +P P++T
Sbjct: 2734 HALVSGVPLPLGPQAAGQASPALPIDPVPPPVAT 2767


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 446,392,515
Number of Sequences: 1657284
Number of extensions: 9833681
Number of successful extensions: 30560
Number of sequences better than 10.0: 145
Number of HSP's better than 10.0 without gapping: 29016
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 30547
length of database: 575,637,011
effective HSP length: 92
effective length of database: 423,166,883
effective search space used: 16080341554
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).