SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0031
         (558 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_Q2HZG0 Cluster: Yellow; n=2; Bombyx mori|Rep: Yellow - ...   161   1e-38
UniRef50_A6P3A9 Cluster: Yellow; n=1; Papilio xuthus|Rep: Yellow...   121   1e-26
UniRef50_P09957 Cluster: Protein yellow precursor; n=68; Endopte...    76   6e-13
UniRef50_Q7Q0L3 Cluster: ENSANGP00000014433; n=1; Anopheles gamb...    68   2e-10
UniRef50_Q9VJQ3 Cluster: CG4182-PA; n=5; Neoptera|Rep: CG4182-PA...    65   9e-10
UniRef50_Q17AD1 Cluster: Dopachrome-conversion enzyme (DCE) isoe...    65   1e-09
UniRef50_Q2HZG4 Cluster: Yellow-c; n=2; Endopterygota|Rep: Yello...    64   3e-09
UniRef50_Q6DLY9 Cluster: Yellow-f-like protein; n=1; Apis mellif...    61   2e-08
UniRef50_UPI00015B44CA Cluster: PREDICTED: similar to yellow-f-l...    57   3e-07
UniRef50_A0EM58 Cluster: Yellow-h; n=1; Apis mellifera|Rep: Yell...    56   4e-07
UniRef50_Q9V4C0 Cluster: CG1629-PA; n=2; Drosophila melanogaster...    54   2e-06
UniRef50_UPI00003C0916 Cluster: PREDICTED: similar to yellow-h C...    54   3e-06
UniRef50_UPI0000D56BC9 Cluster: PREDICTED: similar to CG1629-PA;...    51   2e-05
UniRef50_UPI00015B581D Cluster: PREDICTED: similar to yellow-b; ...    49   8e-05
UniRef50_Q9VJI5 Cluster: CG17914-PA; n=5; Endopterygota|Rep: CG1...    47   3e-04
UniRef50_A0EM59 Cluster: Yellow e3-like protein; n=1; Apis melli...    47   3e-04
UniRef50_UPI00015B639A Cluster: PREDICTED: hypothetical protein;...    46   5e-04
UniRef50_UPI00015B6109 Cluster: PREDICTED: similar to ENSANGP000...    46   8e-04
UniRef50_UPI00015B6395 Cluster: PREDICTED: similar to major roya...    45   0.001
UniRef50_UPI0000D56BC6 Cluster: PREDICTED: similar to CG9792-PA;...    45   0.001
UniRef50_UPI00015B58E7 Cluster: PREDICTED: similar to ENSANGP000...    45   0.001
UniRef50_UPI00015B4E4E Cluster: PREDICTED: similar to ENSANGP000...    45   0.001
UniRef50_UPI0000D56E2A Cluster: PREDICTED: similar to CG17914-PA...    45   0.001
UniRef50_UPI00015B6399 Cluster: PREDICTED: similar to yellow e3-...    44   0.002
UniRef50_UPI0000DB7359 Cluster: PREDICTED: similar to yellow-b C...    43   0.004
UniRef50_Q9VG08 Cluster: CG8063-PA; n=3; Drosophila melanogaster...    42   0.007
UniRef50_Q7Q8V5 Cluster: ENSANGP00000016302; n=1; Anopheles gamb...    42   0.007
UniRef50_UPI00015B6108 Cluster: PREDICTED: similar to ENSANGP000...    42   0.013
UniRef50_UPI0000D55BA7 Cluster: PREDICTED: similar to Yellow pro...    41   0.022
UniRef50_Q2HZG2 Cluster: Yellow-b; n=1; Bombyx mori|Rep: Yellow-...    41   0.022
UniRef50_UPI00015B46D1 Cluster: PREDICTED: similar to major roya...    39   0.069
UniRef50_O97432 Cluster: Major royal jelly protein 5 precursor; ...    39   0.091
UniRef50_Q17060 Cluster: Major royal jelly protein 3 precursor; ...    38   0.16 
UniRef50_UPI00015B46CF Cluster: PREDICTED: similar to major roya...    38   0.21 
UniRef50_A4A2L2 Cluster: Probable mutator protein MutT; n=1; Bla...    38   0.21 
UniRef50_Q2HZG5 Cluster: Yellow-fa; n=2; Bombyx mori|Rep: Yellow...    37   0.37 
UniRef50_UPI00015B6396 Cluster: PREDICTED: similar to major roya...    36   0.64 
UniRef50_UPI00003C0D78 Cluster: PREDICTED: similar to yellow-g C...    36   0.64 
UniRef50_Q8MZM5 Cluster: Dopachrome conversion enzyme; n=10; Cul...    36   0.64 
UniRef50_UPI0000D56D70 Cluster: PREDICTED: similar to CG8063-PA;...    35   1.1  
UniRef50_Q2HZG3 Cluster: Yellow-fb; n=1; Bombyx mori|Rep: Yellow...    34   2.0  
UniRef50_A4RCK1 Cluster: Predicted protein; n=1; Magnaporthe gri...    34   2.0  
UniRef50_P32568 Cluster: Protein SNQ2; n=9; Saccharomycetales|Re...    34   2.0  
UniRef50_Q0C7C7 Cluster: Dopachrome-conversion enzyme (DCE), put...    34   2.6  
UniRef50_Q22847 Cluster: Putative uncharacterized protein; n=1; ...    33   3.4  
UniRef50_A0NDC3 Cluster: ENSANGP00000031925; n=1; Anopheles gamb...    33   3.4  
UniRef50_Q9VFV2 Cluster: CG17044-PA; n=4; Sophophora|Rep: CG1704...    33   4.5  
UniRef50_A2QYM5 Cluster: Remark: protein of the patent is useful...    33   4.5  
UniRef50_Q7QB87 Cluster: ENSANGP00000011250; n=2; Culicidae|Rep:...    33   6.0  
UniRef50_A0BLZ9 Cluster: Chromosome undetermined scaffold_115, w...    33   6.0  
UniRef50_Q4RYH4 Cluster: Chromosome 2 SCAF14976, whole genome sh...    32   7.9  
UniRef50_A7BCC0 Cluster: Putative uncharacterized protein; n=1; ...    32   7.9  
UniRef50_A5UXV3 Cluster: Periplasmic binding protein; n=3; Bacte...    32   7.9  
UniRef50_A1SAQ3 Cluster: HemY protein precursor; n=1; Shewanella...    32   7.9  

>UniRef50_Q2HZG0 Cluster: Yellow; n=2; Bombyx mori|Rep: Yellow -
           Bombyx mori (Silk moth)
          Length = 514

 Score =  161 bits (391), Expect = 1e-38
 Identities = 74/74 (100%), Positives = 74/74 (100%)
 Frame = +2

Query: 32  MAAKFLVFCGLVSLASATIKLQEIFSWNVVDWNYPDQFSKQQALRTGALIPENALPVGIE 211
           MAAKFLVFCGLVSLASATIKLQEIFSWNVVDWNYPDQFSKQQALRTGALIPENALPVGIE
Sbjct: 1   MAAKFLVFCGLVSLASATIKLQEIFSWNVVDWNYPDQFSKQQALRTGALIPENALPVGIE 60

Query: 212 RWRNKLFVSVPRWR 253
           RWRNKLFVSVPRWR
Sbjct: 61  RWRNKLFVSVPRWR 74



 Score =  142 bits (343), Expect = 7e-33
 Identities = 74/120 (61%), Positives = 85/120 (70%)
 Frame = +1

Query: 199 RWYRKVEEQIVRQRS*VALGIPATLNYIPLDAPYEPSPKLTPYPSFEGNELGNCQTGLTT 378
           RW  K+   + R RS    GIPATLNYIPLDAPYEPSPKLTPYPSFEGNELGNCQTGLTT
Sbjct: 61  RWRNKLFVSVPRWRS----GIPATLNYIPLDAPYEPSPKLTPYPSFEGNELGNCQTGLTT 116

Query: 379 VYRVKADQV*SVFGY*TFGTYGYDNVTNVCPVHAQCILT*TLIKSSRKYVVTTQKTLSST 558
           VYRVKADQ   ++     GTYGYDNVTNVCP +   +      +  RKYV+  +  +S+T
Sbjct: 117 VYRVKADQCDRLWVL-DVGTYGYDNVTNVCP-YTLNVFDLNTDQIIRKYVLRPEDIVSTT 174


>UniRef50_A6P3A9 Cluster: Yellow; n=1; Papilio xuthus|Rep: Yellow -
           Papilio xuthus
          Length = 509

 Score =  121 bits (292), Expect = 1e-26
 Identities = 70/123 (56%), Positives = 83/123 (67%), Gaps = 3/123 (2%)
 Frame = +1

Query: 199 RWYRKVEEQIVRQRS*VALGIPATLNYIPLDAPYEPSPKLTPYPSFEGNELGNCQTGLTT 378
           RW  K+   + R R     GIPATLNYIPLDAP+E SPKLTPYPSFE NE+GNC TGLTT
Sbjct: 60  RWRNKLFVSVPRWRP----GIPATLNYIPLDAPHESSPKLTPYPSFEENEVGNCDTGLTT 115

Query: 379 VYRVKADQV*SVFGY*TFGTYGYD-NVTNVCP--VHAQCILT*TLIKSSRKYVVTTQKTL 549
           VYRVKAD+   ++     GTYGYD NVTNVCP  ++   + T T I   RKYV   +  +
Sbjct: 116 VYRVKADRCDRLWVL-DVGTYGYDPNVTNVCPYTLNVYDLHTNTRI---RKYVFRPEDIV 171

Query: 550 SST 558
           +ST
Sbjct: 172 AST 174



 Score =  116 bits (278), Expect = 5e-25
 Identities = 49/69 (71%), Positives = 60/69 (86%)
 Frame = +2

Query: 47  LVFCGLVSLASATIKLQEIFSWNVVDWNYPDQFSKQQALRTGALIPENALPVGIERWRNK 226
           L + GLV+ ASA +KLQE+FSWN +DWNYP++F +Q+A+ +G LI ENALPVGIERWRNK
Sbjct: 5   LFYLGLVAYASAAVKLQEVFSWNAMDWNYPNEFLRQEAIISGNLIRENALPVGIERWRNK 64

Query: 227 LFVSVPRWR 253
           LFVSVPRWR
Sbjct: 65  LFVSVPRWR 73


>UniRef50_P09957 Cluster: Protein yellow precursor; n=68;
           Endopterygota|Rep: Protein yellow precursor - Drosophila
           melanogaster (Fruit fly)
          Length = 541

 Score = 75.8 bits (178), Expect = 6e-13
 Identities = 34/64 (53%), Positives = 48/64 (75%)
 Frame = +2

Query: 62  LVSLASATIKLQEIFSWNVVDWNYPDQFSKQQALRTGALIPENALPVGIERWRNKLFVSV 241
           LV+ + A  KLQE +SW+ +D+ +P+   K QAL +G  IP+NALPVG+E + N+LFV+V
Sbjct: 15  LVTPSWAAYKLQERYSWSQLDFAFPNTRLKDQALASGDYIPQNALPVGVEHFGNRLFVTV 74

Query: 242 PRWR 253
           PRWR
Sbjct: 75  PRWR 78



 Score = 65.7 bits (153), Expect = 7e-10
 Identities = 33/73 (45%), Positives = 42/73 (57%), Gaps = 1/73 (1%)
 Frame = +1

Query: 256 GIPATLNYIPLDAPYEPSPKLTPYPSFEGNELGNCQTGLTTVYRVKADQV*SVFGY*TFG 435
           GIPATL YI +D     SP+L PYP +  N  G+C   +TT YR+K D+   ++   T G
Sbjct: 80  GIPATLTYINMDRSLTGSPELIPYPDWRSNTAGDCANSITTAYRIKVDECGRLWVLDT-G 138

Query: 436 TYGYDN-VTNVCP 471
           T G  N  TN CP
Sbjct: 139 TVGIGNTTTNPCP 151


>UniRef50_Q7Q0L3 Cluster: ENSANGP00000014433; n=1; Anopheles gambiae
           str. PEST|Rep: ENSANGP00000014433 - Anopheles gambiae
           str. PEST
          Length = 416

 Score = 67.7 bits (158), Expect = 2e-10
 Identities = 27/56 (48%), Positives = 40/56 (71%)
 Frame = +2

Query: 86  IKLQEIFSWNVVDWNYPDQFSKQQALRTGALIPENALPVGIERWRNKLFVSVPRWR 253
           +KL+E F W  V + +P + +K  AL +G  I  N LP+G+ERWR+KLF++VPRW+
Sbjct: 27  VKLKEKFKWREVSFAWPSEDAKVAALNSGKYIVHNNLPLGLERWRDKLFITVPRWK 82


>UniRef50_Q9VJQ3 Cluster: CG4182-PA; n=5; Neoptera|Rep: CG4182-PA -
           Drosophila melanogaster (Fruit fly)
          Length = 438

 Score = 65.3 bits (152), Expect = 9e-10
 Identities = 26/58 (44%), Positives = 42/58 (72%)
 Frame = +2

Query: 80  ATIKLQEIFSWNVVDWNYPDQFSKQQALRTGALIPENALPVGIERWRNKLFVSVPRWR 253
           A+ KL+E FSW  + +++P   ++ +A   G  I EN LP+G+ERW+N++FV+VPRW+
Sbjct: 23  ASAKLEEKFSWKQLAFDWPTPEAEAEAKSNGHYIVENNLPLGVERWQNRIFVTVPRWK 80



 Score = 43.2 bits (97), Expect = 0.004
 Identities = 22/51 (43%), Positives = 33/51 (64%)
 Frame = +1

Query: 199 RWYRKVEEQIVRQRS*VALGIPATLNYIPLDAPYEPSPKLTPYPSFEGNEL 351
           RW  ++   + R ++    G+ ATLNYI +++  E SPKL PYPS+E N+L
Sbjct: 67  RWQNRIFVTVPRWKA----GVAATLNYIDINST-EKSPKLHPYPSWEANKL 112


>UniRef50_Q17AD1 Cluster: Dopachrome-conversion enzyme (DCE)
           isoenzyme, putative; n=3; Culicidae|Rep:
           Dopachrome-conversion enzyme (DCE) isoenzyme, putative -
           Aedes aegypti (Yellowfever mosquito)
          Length = 485

 Score = 64.9 bits (151), Expect = 1e-09
 Identities = 24/61 (39%), Positives = 40/61 (65%)
 Frame = +2

Query: 68  SLASATIKLQEIFSWNVVDWNYPDQFSKQQALRTGALIPENALPVGIERWRNKLFVSVPR 247
           SL+        I+ W ++D+ YP   ++  A+RT   IPEN LP+G++R+RN++F++ PR
Sbjct: 75  SLSQGKNVFDVIYQWKIIDFLYPSLQARNDAIRTKQFIPENNLPLGVDRFRNRIFITTPR 134

Query: 248 W 250
           W
Sbjct: 135 W 135



 Score = 37.9 bits (84), Expect = 0.16
 Identities = 21/51 (41%), Positives = 30/51 (58%), Gaps = 2/51 (3%)
 Frame = +1

Query: 256 GIPATLNYIPLDAPYEPSPKLTPYP--SFEGNELGNCQTGLTTVYRVKADQ 402
           G+PATL+Y+PL    +PS  L PYP  SF  +      + L +VYR+  D+
Sbjct: 138 GVPATLSYLPLPV-QDPSLPLIPYPDWSFHTSPQNPDCSRLVSVYRIYVDE 187


>UniRef50_Q2HZG4 Cluster: Yellow-c; n=2; Endopterygota|Rep: Yellow-c
           - Bombyx mori (Silk moth)
          Length = 407

 Score = 63.7 bits (148), Expect = 3e-09
 Identities = 26/72 (36%), Positives = 45/72 (62%), Gaps = 1/72 (1%)
 Frame = +2

Query: 41  KFLVFCGLVSLASATIKLQEI-FSWNVVDWNYPDQFSKQQALRTGALIPENALPVGIERW 217
           K L F   + +AS      ++ F+W  VD+ +     ++ A+++G  +P N LP+G+ RW
Sbjct: 2   KLLAFAIALVVASCEAATPQLRFAWKEVDYEWNTPAERENAIKSGDFVPANNLPLGLGRW 61

Query: 218 RNKLFVSVPRWR 253
           +NKLFV+VP+W+
Sbjct: 62  KNKLFVTVPKWK 73


>UniRef50_Q6DLY9 Cluster: Yellow-f-like protein; n=1; Apis
           mellifera|Rep: Yellow-f-like protein - Apis mellifera
           (Honeybee)
          Length = 411

 Score = 60.9 bits (141), Expect = 2e-08
 Identities = 24/68 (35%), Positives = 45/68 (66%), Gaps = 1/68 (1%)
 Frame = +2

Query: 53  FCGLVSLASAT-IKLQEIFSWNVVDWNYPDQFSKQQALRTGALIPENALPVGIERWRNKL 229
           F  +V LA A   +++ I+SWNV+++N+P+   +   +  G  I EN +P G++ W +K+
Sbjct: 4   FLWIVFLALANGEEIKTIYSWNVIEYNFPNDNIRNTLISNGDYIEENNMPNGMQIWNDKV 63

Query: 230 FVSVPRWR 253
           F+++PRW+
Sbjct: 64  FITIPRWK 71



 Score = 36.7 bits (81), Expect = 0.37
 Identities = 18/55 (32%), Positives = 31/55 (56%)
 Frame = +1

Query: 256 GIPATLNYIPLDAPYEPSPKLTPYPSFEGNELGNCQTGLTTVYRVKADQV*SVFG 420
           G+P+ LN+  L      SPKL PYP++E N++    + +  + RV+ D    ++G
Sbjct: 73  GVPSNLNFF-LKNDESESPKLNPYPNWEMNDINKIDS-IINIIRVRVDACDRLWG 125


>UniRef50_UPI00015B44CA Cluster: PREDICTED: similar to yellow-f-like
           protein; n=1; Nasonia vitripennis|Rep: PREDICTED:
           similar to yellow-f-like protein - Nasonia vitripennis
          Length = 400

 Score = 56.8 bits (131), Expect = 3e-07
 Identities = 18/51 (35%), Positives = 37/51 (72%)
 Frame = +2

Query: 101 IFSWNVVDWNYPDQFSKQQALRTGALIPENALPVGIERWRNKLFVSVPRWR 253
           ++SW+ +D+N+P++  +   + +G  I  + LPVG+  W++K+F++VPRW+
Sbjct: 21  LYSWDKLDYNFPNESMRMAYIASGDFIQADNLPVGVSVWKDKMFITVPRWK 71



 Score = 47.2 bits (107), Expect = 3e-04
 Identities = 20/56 (35%), Positives = 34/56 (60%), Gaps = 1/56 (1%)
 Frame = +1

Query: 256 GIPATLNYIPLDAPYEPSPKLTPYPSFEGNELGNCQTG-LTTVYRVKADQV*SVFG 420
           G+PA LNYI +    + SP LTPYPS+E N++ +     + +++R + D    ++G
Sbjct: 73  GVPANLNYIQMSTTTDKSPPLTPYPSWEANDVHSTSNDVIISIFRTRVDACDRLWG 128


>UniRef50_A0EM58 Cluster: Yellow-h; n=1; Apis mellifera|Rep:
           Yellow-h - Apis mellifera (Honeybee)
          Length = 552

 Score = 56.4 bits (130), Expect = 4e-07
 Identities = 18/54 (33%), Positives = 38/54 (70%)
 Frame = +2

Query: 92  LQEIFSWNVVDWNYPDQFSKQQALRTGALIPENALPVGIERWRNKLFVSVPRWR 253
           ++ +++W+ +D+ Y    ++  A+  G  I EN LP+G+E WR+K+F+++P+W+
Sbjct: 154 MELVYAWSTIDYTYDSIEARDSAIFDGDFITENNLPLGLEVWRDKVFITLPKWK 207



 Score = 50.4 bits (115), Expect = 3e-05
 Identities = 23/49 (46%), Positives = 35/49 (71%)
 Frame = +1

Query: 256 GIPATLNYIPLDAPYEPSPKLTPYPSFEGNELGNCQTGLTTVYRVKADQ 402
           GIP TL  +P  +  + SPKL PYP++E + +GNC  GLT+V+R++ D+
Sbjct: 209 GIPVTLTTVPKHSKTK-SPKLRPYPNWEWHTVGNCD-GLTSVFRIQVDE 255


>UniRef50_Q9V4C0 Cluster: CG1629-PA; n=2; Drosophila
           melanogaster|Rep: CG1629-PA - Drosophila melanogaster
           (Fruit fly)
          Length = 463

 Score = 54.4 bits (125), Expect = 2e-06
 Identities = 20/55 (36%), Positives = 36/55 (65%)
 Frame = +2

Query: 89  KLQEIFSWNVVDWNYPDQFSKQQALRTGALIPENALPVGIERWRNKLFVSVPRWR 253
           +L+ ++ W  +D+ Y     +QQ++  G  +P+N LP+GI+   N+LFV+ PRW+
Sbjct: 52  QLEIVYEWKYLDFLYSTFVQRQQSILNGDFVPKNNLPLGIDVHNNRLFVTTPRWK 106


>UniRef50_UPI00003C0916 Cluster: PREDICTED: similar to yellow-h
           CG1629-PA; n=2; Apocrita|Rep: PREDICTED: similar to
           yellow-h CG1629-PA - Apis mellifera
          Length = 431

 Score = 53.6 bits (123), Expect = 3e-06
 Identities = 19/64 (29%), Positives = 38/64 (59%)
 Frame = +2

Query: 62  LVSLASATIKLQEIFSWNVVDWNYPDQFSKQQALRTGALIPENALPVGIERWRNKLFVSV 241
           LV++A      + +F WN +D  +P + +K+ A+     +P N    GI+ W+ K+++++
Sbjct: 10  LVAVAKCHEPFRVVFQWNTIDVMWPSEENKEYAISHNDYVPANNFIAGIKFWKGKMYLTI 69

Query: 242 PRWR 253
           PRW+
Sbjct: 70  PRWK 73


>UniRef50_UPI0000D56BC9 Cluster: PREDICTED: similar to CG1629-PA;
           n=1; Tribolium castaneum|Rep: PREDICTED: similar to
           CG1629-PA - Tribolium castaneum
          Length = 468

 Score = 50.8 bits (116), Expect = 2e-05
 Identities = 17/50 (34%), Positives = 35/50 (70%)
 Frame = +2

Query: 104 FSWNVVDWNYPDQFSKQQALRTGALIPENALPVGIERWRNKLFVSVPRWR 253
           + W ++D+ YP    +  A+ +   IPEN LP+G+E +++++FV++P+W+
Sbjct: 71  YKWKMLDYVYPSDEDRIAAIASEDFIPENNLPLGLEVYQDRIFVTMPKWK 120



 Score = 48.0 bits (109), Expect = 1e-04
 Identities = 23/48 (47%), Positives = 34/48 (70%)
 Frame = +1

Query: 256 GIPATLNYIPLDAPYEPSPKLTPYPSFEGNELGNCQTGLTTVYRVKAD 399
           G+PATL  IP     E SPKL PYP+++ +  G+C+ G+T+V+RV+ D
Sbjct: 122 GVPATLAVIP-KTRRELSPKLVPYPNWDYHRTGSCE-GITSVFRVQVD 167


>UniRef50_UPI00015B581D Cluster: PREDICTED: similar to yellow-b;
           n=1; Nasonia vitripennis|Rep: PREDICTED: similar to
           yellow-b - Nasonia vitripennis
          Length = 444

 Score = 48.8 bits (111), Expect = 8e-05
 Identities = 19/50 (38%), Positives = 33/50 (66%)
 Frame = +2

Query: 104 FSWNVVDWNYPDQFSKQQALRTGALIPENALPVGIERWRNKLFVSVPRWR 253
           F WN +++ +P + +   AL  G  IPEN +  GI+ + +KLF+++PRW+
Sbjct: 55  FYWNYLNFTWPSEDAYNSALVDGLYIPENNIITGIKIYEDKLFLTLPRWK 104



 Score = 32.7 bits (71), Expect = 6.0
 Identities = 16/36 (44%), Positives = 22/36 (61%), Gaps = 1/36 (2%)
 Frame = +1

Query: 256 GIPATLNYIPLD-APYEPSPKLTPYPSFEGNELGNC 360
           G+PATL   PL     + SP L PYP+++  +L NC
Sbjct: 106 GVPATLVSTPLTPVNNDRSPLLEPYPNWDMQKLDNC 141


>UniRef50_Q9VJI5 Cluster: CG17914-PA; n=5; Endopterygota|Rep:
           CG17914-PA - Drosophila melanogaster (Fruit fly)
          Length = 453

 Score = 47.2 bits (107), Expect = 3e-04
 Identities = 20/60 (33%), Positives = 33/60 (55%)
 Frame = +2

Query: 74  ASATIKLQEIFSWNVVDWNYPDQFSKQQALRTGALIPENALPVGIERWRNKLFVSVPRWR 253
           A A   L+  + W  +D+ Y +   +  A+  G   P N +P G+E   ++LFV++PRWR
Sbjct: 16  ALANDNLRVAYEWREMDFKYANPDQRWSAIERGEFKPANVIPFGLEVAGHRLFVTLPRWR 75



 Score = 41.5 bits (93), Expect = 0.013
 Identities = 17/49 (34%), Positives = 30/49 (61%)
 Frame = +1

Query: 256 GIPATLNYIPLDAPYEPSPKLTPYPSFEGNELGNCQTGLTTVYRVKADQ 402
           G+PA+L Y+ L+      P L P+PS++ + L   +  L + +RV+AD+
Sbjct: 77  GVPASLAYLDLNDTSSKGPALKPFPSWQAHNLQEAEPELVSPFRVRADR 125


>UniRef50_A0EM59 Cluster: Yellow e3-like protein; n=1; Apis
           mellifera|Rep: Yellow e3-like protein - Apis mellifera
           (Honeybee)
          Length = 424

 Score = 47.2 bits (107), Expect = 3e-04
 Identities = 20/71 (28%), Positives = 47/71 (66%), Gaps = 4/71 (5%)
 Frame = +2

Query: 47  LVFCGLVSLASATIKLQEIFSWNVVDWNYPDQFSKQQALRTGALIPENALPVGIERW--- 217
           ++F   +S + A  KL+ I+SW  +++ +P+ ++K  A+++G+ IP  +LP+ ++ +   
Sbjct: 9   ILFLLAISDSQAQEKLKNIYSWKALEFAFPNGYAKLAAIKSGSYIPGASLPIDVDVYNTE 68

Query: 218 -RNKLFVSVPR 247
            ++ +FV++PR
Sbjct: 69  QQSTVFVAIPR 79



 Score = 45.6 bits (103), Expect = 8e-04
 Identities = 18/49 (36%), Positives = 32/49 (65%)
 Frame = +1

Query: 256 GIPATLNYIPLDAPYEPSPKLTPYPSFEGNELGNCQTGLTTVYRVKADQ 402
           G+P TL Y+  +   + +P + PYP++  N++  C  GLT+VYR++ D+
Sbjct: 83  GVPLTLGYVTREVSIDGNPLIAPYPNWSYNDVKYCD-GLTSVYRMQVDK 130


>UniRef50_UPI00015B639A Cluster: PREDICTED: hypothetical protein;
           n=1; Nasonia vitripennis|Rep: PREDICTED: hypothetical
           protein - Nasonia vitripennis
          Length = 425

 Score = 46.4 bits (105), Expect = 5e-04
 Identities = 26/76 (34%), Positives = 42/76 (55%), Gaps = 4/76 (5%)
 Frame = +1

Query: 256 GIPATLNYIPLDAPYEPSPKLTPYPSFEGNELG----NCQTGLTTVYRVKADQV*SVFGY 423
           G+PAT+ ++P D P   +P L  YPS++ +  G    NC + L +VYRV+AD+   ++  
Sbjct: 82  GVPATITFMPRDVPVGSTPHLQAYPSWDWHSAGKGDFNC-SKLISVYRVRADRCNRLWVL 140

Query: 424 *TFGTYGYDNVTNVCP 471
            +      D+ T  CP
Sbjct: 141 DSGINTSIDDFTVACP 156


>UniRef50_UPI00015B6109 Cluster: PREDICTED: similar to
           ENSANGP00000016302; n=1; Nasonia vitripennis|Rep:
           PREDICTED: similar to ENSANGP00000016302 - Nasonia
           vitripennis
          Length = 495

 Score = 45.6 bits (103), Expect = 8e-04
 Identities = 15/48 (31%), Positives = 33/48 (68%)
 Frame = +2

Query: 104 FSWNVVDWNYPDQFSKQQALRTGALIPENALPVGIERWRNKLFVSVPR 247
           + WN V++ +P   +  QA+  G+ IPE+ +  G++ W+++++++VPR
Sbjct: 49  YQWNYVNYTWPSSQAHDQAILDGSYIPEHNVISGVKVWKDRIYLTVPR 96



 Score = 41.5 bits (93), Expect = 0.013
 Identities = 17/37 (45%), Positives = 25/37 (67%)
 Frame = +1

Query: 256 GIPATLNYIPLDAPYEPSPKLTPYPSFEGNELGNCQT 366
           G+P+TLN++PLD+   PSP L PYPS+      +C +
Sbjct: 100 GVPSTLNFVPLDSS-NPSPLLRPYPSWSMQREDDCNS 135


>UniRef50_UPI00015B6395 Cluster: PREDICTED: similar to major royal
           jelly protein 9; n=2; Nasonia vitripennis|Rep:
           PREDICTED: similar to major royal jelly protein 9 -
           Nasonia vitripennis
          Length = 413

 Score = 45.2 bits (102), Expect = 0.001
 Identities = 20/67 (29%), Positives = 40/67 (59%)
 Frame = +2

Query: 47  LVFCGLVSLASATIKLQEIFSWNVVDWNYPDQFSKQQALRTGALIPENALPVGIERWRNK 226
           ++  G VS++S   KL  ++ W  +D+ +     K++ +R+G    EN +P+ +++ R K
Sbjct: 7   IIILGAVSVSSH--KLDTVYEWKYIDYLWDSNAQKERYIRSGDYDYENIVPIDVDKARGK 64

Query: 227 LFVSVPR 247
           +FV+V R
Sbjct: 65  VFVTVIR 71



 Score = 35.9 bits (79), Expect = 0.64
 Identities = 26/72 (36%), Positives = 38/72 (52%)
 Frame = +1

Query: 256 GIPATLNYIPLDAPYEPSPKLTPYPSFEGNELGNCQTGLTTVYRVKADQV*SVFGY*TFG 435
           G+PA+L  +  +      P L PYP +   + G+C  G+T+VYRV  D+   ++   T G
Sbjct: 74  GVPASLATVT-ERVGPSGPLLRPYPDWSWYKAGDCD-GITSVYRVAMDECNKLYVLDT-G 130

Query: 436 TYGYDNVTNVCP 471
             G DN T  CP
Sbjct: 131 YIG-DNYT--CP 139


>UniRef50_UPI0000D56BC6 Cluster: PREDICTED: similar to CG9792-PA;
           n=2; Endopterygota|Rep: PREDICTED: similar to CG9792-PA
           - Tribolium castaneum
          Length = 1057

 Score = 45.2 bits (102), Expect = 0.001
 Identities = 26/76 (34%), Positives = 39/76 (51%), Gaps = 4/76 (5%)
 Frame = +1

Query: 256 GIPATLNYIPLDAPYEPSPKLTPYPSFEGNELGNCQT----GLTTVYRVKADQV*SVFGY 423
           G+ ATL  IP   P   SP L  YP++E ++ G  Q     GLT+VYR++AD    ++  
Sbjct: 95  GVSATLAVIPRHTPPGSSPMLQAYPNWEAHKFGRGQNDSCDGLTSVYRIRADSCNRLWVL 154

Query: 424 *TFGTYGYDNVTNVCP 471
            +      ++   VCP
Sbjct: 155 DSGVNLALEDFQRVCP 170


>UniRef50_UPI00015B58E7 Cluster: PREDICTED: similar to
           ENSANGP00000016302; n=1; Nasonia vitripennis|Rep:
           PREDICTED: similar to ENSANGP00000016302 - Nasonia
           vitripennis
          Length = 435

 Score = 44.8 bits (101), Expect = 0.001
 Identities = 18/74 (24%), Positives = 41/74 (55%)
 Frame = +2

Query: 32  MAAKFLVFCGLVSLASATIKLQEIFSWNVVDWNYPDQFSKQQALRTGALIPENALPVGIE 211
           +    L+   L  LA A       F WN +++ +P++ +  +A +  + + +N +  GI+
Sbjct: 2   LRCSLLILGALAGLALAHEPFIVQFQWNYLNYTWPNKEAYLKADKDDSYLEKNNVVSGIK 61

Query: 212 RWRNKLFVSVPRWR 253
            W +K+++++PRW+
Sbjct: 62  LWEDKMYLTIPRWK 75


>UniRef50_UPI00015B4E4E Cluster: PREDICTED: similar to
           ENSANGP00000012608; n=1; Nasonia vitripennis|Rep:
           PREDICTED: similar to ENSANGP00000012608 - Nasonia
           vitripennis
          Length = 456

 Score = 44.8 bits (101), Expect = 0.001
 Identities = 23/69 (33%), Positives = 42/69 (60%)
 Frame = +2

Query: 47  LVFCGLVSLASATIKLQEIFSWNVVDWNYPDQFSKQQALRTGALIPENALPVGIERWRNK 226
           L+F   VS A+A   L   + W  +D+++P++ +K+   +      E+ LP+G+E   ++
Sbjct: 6   LLFVATVSGAAAIDHLHVKYQWKQIDYDWPNEETKRLFPKYKQ---EDNLPLGLEVAGDR 62

Query: 227 LFVSVPRWR 253
           LF++VPRWR
Sbjct: 63  LFITVPRWR 71



 Score = 37.9 bits (84), Expect = 0.16
 Identities = 19/50 (38%), Positives = 31/50 (62%), Gaps = 1/50 (2%)
 Frame = +1

Query: 256 GIPATLNYIPLDAPYEPSPKLTPYPSFEGNEL-GNCQTGLTTVYRVKADQ 402
           G+ A+LNYI ++     SP L PYPS+E ++  G     + + +RV+AD+
Sbjct: 73  GVVASLNYIKINDS-RTSPPLIPYPSWEAHQYSGGSPPEIVSTFRVRADR 121


>UniRef50_UPI0000D56E2A Cluster: PREDICTED: similar to CG17914-PA;
           n=1; Tribolium castaneum|Rep: PREDICTED: similar to
           CG17914-PA - Tribolium castaneum
          Length = 473

 Score = 44.8 bits (101), Expect = 0.001
 Identities = 22/77 (28%), Positives = 42/77 (54%)
 Frame = +2

Query: 23  VNKMAAKFLVFCGLVSLASATIKLQEIFSWNVVDWNYPDQFSKQQALRTGALIPENALPV 202
           +N +    L FC   S+ + T K   I  W  +++ +PD+ + + A  TG  IPEN +  
Sbjct: 1   MNTLTFLLLTFC--TSIHTQTSKFYVIRQWKYLNFTWPDEDALKTATATGDYIPENNIVS 58

Query: 203 GIERWRNKLFVSVPRWR 253
           GI+ + +  ++++PR +
Sbjct: 59  GIKYFEDYYYLTLPRMK 75



 Score = 37.5 bits (83), Expect = 0.21
 Identities = 19/48 (39%), Positives = 27/48 (56%)
 Frame = +1

Query: 256 GIPATLNYIPLDAPYEPSPKLTPYPSFEGNELGNCQTGLTTVYRVKAD 399
           G+PATL  I      + +P L P+PS+  N+LG+C   L  V  V+ D
Sbjct: 77  GVPATLARIKAGPTRDTAPPLEPFPSWGMNQLGDC-NNLQNVQNVEID 123


>UniRef50_UPI00015B6399 Cluster: PREDICTED: similar to yellow
           e3-like protein; n=1; Nasonia vitripennis|Rep:
           PREDICTED: similar to yellow e3-like protein - Nasonia
           vitripennis
          Length = 525

 Score = 44.0 bits (99), Expect = 0.002
 Identities = 19/48 (39%), Positives = 29/48 (60%)
 Frame = +1

Query: 256 GIPATLNYIPLDAPYEPSPKLTPYPSFEGNELGNCQTGLTTVYRVKAD 399
           GIP T+ Y+      + +P + PYP +E N LG+C   +T+ YRV+ D
Sbjct: 89  GIPVTVGYVTELMSKDGNPLIAPYPDWEWNRLGDCD-AITSTYRVQID 135



 Score = 39.9 bits (89), Expect = 0.039
 Identities = 16/59 (27%), Positives = 36/59 (61%), Gaps = 4/59 (6%)
 Frame = +2

Query: 83  TIKLQEIFSWNVVDWNYPDQFSKQQALRTGALIPENALPVGIERW----RNKLFVSVPR 247
           T KL+ +FSW  +D+ +    +++ A+RTG   P  ++P+ ++ +     + +F+++PR
Sbjct: 27  TNKLRTVFSWKALDFAFGSDIAREAAIRTGRFKPGASIPIDVDVYYGNHSSMVFIAMPR 85


>UniRef50_UPI0000DB7359 Cluster: PREDICTED: similar to yellow-b
           CG17914-PA; n=1; Apis mellifera|Rep: PREDICTED: similar
           to yellow-b CG17914-PA - Apis mellifera
          Length = 455

 Score = 43.2 bits (97), Expect = 0.004
 Identities = 21/55 (38%), Positives = 32/55 (58%)
 Frame = +2

Query: 89  KLQEIFSWNVVDWNYPDQFSKQQALRTGALIPENALPVGIERWRNKLFVSVPRWR 253
           KL+ IF W  +D+ +P   S +  L       E+ LP+G+E    ++FV+VPRWR
Sbjct: 32  KLRVIFQWKQLDYEWP---SNETKLLFPGYKQEDNLPLGLEITSTRIFVTVPRWR 83



 Score = 32.7 bits (71), Expect = 6.0
 Identities = 17/50 (34%), Positives = 29/50 (58%), Gaps = 1/50 (2%)
 Frame = +1

Query: 256 GIPATLNYIPLDAPYEPSPKLTPYPSFEGNEL-GNCQTGLTTVYRVKADQ 402
           G+ A+LNY  ++   E SP L PYPSFE ++        + + +R++ D+
Sbjct: 85  GVVASLNYFYVNDTRE-SPTLIPYPSFEAHQYEAGSVPEIISPFRIRVDR 133


>UniRef50_Q9VG08 Cluster: CG8063-PA; n=3; Drosophila
           melanogaster|Rep: CG8063-PA - Drosophila melanogaster
           (Fruit fly)
          Length = 452

 Score = 42.3 bits (95), Expect = 0.007
 Identities = 22/50 (44%), Positives = 28/50 (56%), Gaps = 1/50 (2%)
 Frame = +1

Query: 253 LGIPATLNYIPL-DAPYEPSPKLTPYPSFEGNELGNCQTGLTTVYRVKAD 399
           +GIP+TLNYI L +     SPKL  YP+F  N+       L +VYR   D
Sbjct: 122 VGIPSTLNYIDLAEDGSNRSPKLRAYPNFALNQFNASAENLVSVYRTSVD 171


>UniRef50_Q7Q8V5 Cluster: ENSANGP00000016302; n=1; Anopheles gambiae
           str. PEST|Rep: ENSANGP00000016302 - Anopheles gambiae
           str. PEST
          Length = 412

 Score = 42.3 bits (95), Expect = 0.007
 Identities = 15/49 (30%), Positives = 33/49 (67%)
 Frame = +2

Query: 101 IFSWNVVDWNYPDQFSKQQALRTGALIPENALPVGIERWRNKLFVSVPR 247
           ++ WNV+D+ + ++  + QAL +G  IP+N +    + + N+L++++PR
Sbjct: 7   VYEWNVLDFAFTNEDERAQALYSGHYIPKNVIISDCKPFANRLYLTIPR 55



 Score = 37.9 bits (84), Expect = 0.16
 Identities = 20/50 (40%), Positives = 29/50 (58%), Gaps = 1/50 (2%)
 Frame = +1

Query: 256 GIPATLNYIPL-DAPYEPSPKLTPYPSFEGNELGNCQTGLTTVYRVKADQ 402
           G+PATL Y+   +      P++ P+PS+E NE GNC + L  V  V  D+
Sbjct: 59  GVPATLGYVVRPENNGRTDPEIVPFPSWEMNERGNC-SALQFVQGVAVDK 107


>UniRef50_UPI00015B6108 Cluster: PREDICTED: similar to
           ENSANGP00000016302; n=1; Nasonia vitripennis|Rep:
           PREDICTED: similar to ENSANGP00000016302 - Nasonia
           vitripennis
          Length = 450

 Score = 41.5 bits (93), Expect = 0.013
 Identities = 21/63 (33%), Positives = 39/63 (61%), Gaps = 1/63 (1%)
 Frame = +2

Query: 62  LVSLASATIKLQEI-FSWNVVDWNYPDQFSKQQALRTGALIPENALPVGIERWRNKLFVS 238
           LVS A  +    E+   W+ V++++P   + +QA+   + I EN +  GI+ WR++L+++
Sbjct: 15  LVSGAKLSTGPAEVHMQWDYVNYSWPSWEAYEQAVADKSYIRENNVVSGIKLWRDRLYLA 74

Query: 239 VPR 247
           VPR
Sbjct: 75  VPR 77


>UniRef50_UPI0000D55BA7 Cluster: PREDICTED: similar to Yellow
           protein precursor; n=2; Tribolium castaneum|Rep:
           PREDICTED: similar to Yellow protein precursor -
           Tribolium castaneum
          Length = 393

 Score = 40.7 bits (91), Expect = 0.022
 Identities = 13/48 (27%), Positives = 32/48 (66%)
 Frame = +2

Query: 110 WNVVDWNYPDQFSKQQALRTGALIPENALPVGIERWRNKLFVSVPRWR 253
           W+ +++ +    + ++A+ +G  IPEN    GI+ +RN+ ++++P++R
Sbjct: 32  WSYINFTWESSITYEEAIDSGDYIPENVAMTGIKFYRNRWYIALPKFR 79



 Score = 33.1 bits (72), Expect = 4.5
 Identities = 19/50 (38%), Positives = 28/50 (56%), Gaps = 1/50 (2%)
 Frame = +1

Query: 256 GIPATLNYIPLD-APYEPSPKLTPYPSFEGNELGNCQTGLTTVYRVKADQ 402
           G+P TL Y   D AP   +P LTPYP ++ N    C+ G+  V  ++ D+
Sbjct: 81  GVPVTLAYFFADEAPI--NPLLTPYPDWDSNTDPTCE-GIKAVQSMEIDR 127


>UniRef50_Q2HZG2 Cluster: Yellow-b; n=1; Bombyx mori|Rep: Yellow-b -
           Bombyx mori (Silk moth)
          Length = 457

 Score = 40.7 bits (91), Expect = 0.022
 Identities = 20/49 (40%), Positives = 29/49 (59%)
 Frame = +1

Query: 256 GIPATLNYIPLDAPYEPSPKLTPYPSFEGNELGNCQTGLTTVYRVKADQ 402
           G+PATL  IP+      +PKL P+PS+  N +GNC   L  V  ++ D+
Sbjct: 96  GVPATLATIPIQQ-VNTAPKLKPFPSWADNAIGNC-NALQFVQNIEIDR 142



 Score = 39.5 bits (88), Expect = 0.052
 Identities = 15/49 (30%), Positives = 27/49 (55%)
 Frame = +2

Query: 101 IFSWNVVDWNYPDQFSKQQALRTGALIPENALPVGIERWRNKLFVSVPR 247
           ++ WN +D+ +     ++  L T   IP+N L  GI  +   LF+++PR
Sbjct: 44  VYEWNAIDFEWTSPEDREAYLNTSQYIPQNVLISGINFYGENLFLTMPR 92


>UniRef50_UPI00015B46D1 Cluster: PREDICTED: similar to major royal
           jelly protein 9; n=1; Nasonia vitripennis|Rep:
           PREDICTED: similar to major royal jelly protein 9 -
           Nasonia vitripennis
          Length = 417

 Score = 39.1 bits (87), Expect = 0.069
 Identities = 16/48 (33%), Positives = 28/48 (58%)
 Frame = +1

Query: 256 GIPATLNYIPLDAPYEPSPKLTPYPSFEGNELGNCQTGLTTVYRVKAD 399
           GIPATL  +  ++  E    + PYP++  ++  NCQ+G+T+   +  D
Sbjct: 79  GIPATLGVVTNESSAESGSLVMPYPNWSWHKSDNCQSGITSACGITID 126


>UniRef50_O97432 Cluster: Major royal jelly protein 5 precursor;
           n=5; Apis|Rep: Major royal jelly protein 5 precursor -
           Apis mellifera (Honeybee)
          Length = 598

 Score = 38.7 bits (86), Expect = 0.091
 Identities = 16/57 (28%), Positives = 30/57 (52%)
 Frame = +2

Query: 101 IFSWNVVDWNYPDQFSKQQALRTGALIPENALPVGIERWRNKLFVSVPRWR*VSQLL 271
           I  W  +D+++     +Q A+++G        P  +++WR   FV+VPR++ V   L
Sbjct: 38  IHEWKYLDYDFGSDERRQAAMQSGEYDHTKNYPFDVDQWRGMTFVTVPRYKGVPSSL 94


>UniRef50_Q17060 Cluster: Major royal jelly protein 3 precursor;
           n=32; Apis|Rep: Major royal jelly protein 3 precursor -
           Apis mellifera (Honeybee)
          Length = 544

 Score = 37.9 bits (84), Expect = 0.16
 Identities = 13/52 (25%), Positives = 29/52 (55%)
 Frame = +2

Query: 92  LQEIFSWNVVDWNYPDQFSKQQALRTGALIPENALPVGIERWRNKLFVSVPR 247
           ++ I+ W  +D+++     +  A+++G        P  ++RWR+K FV++ R
Sbjct: 37  MKVIYEWKHIDFDFGSDERRDAAIKSGEFDHTKNYPFDVDRWRDKTFVTIER 88


>UniRef50_UPI00015B46CF Cluster: PREDICTED: similar to major royal
           jelly protein 9; n=2; Nasonia vitripennis|Rep:
           PREDICTED: similar to major royal jelly protein 9 -
           Nasonia vitripennis
          Length = 426

 Score = 37.5 bits (83), Expect = 0.21
 Identities = 17/49 (34%), Positives = 28/49 (57%)
 Frame = +1

Query: 256 GIPATLNYIPLDAPYEPSPKLTPYPSFEGNELGNCQTGLTTVYRVKADQ 402
           G+PA L+ +   +     P L+PYP +  +  G+C  G+T+VY +  DQ
Sbjct: 77  GVPARLSTVSSRSSASSGPLLSPYPDWSWHARGDC-NGITSVYGLAIDQ 124


>UniRef50_A4A2L2 Cluster: Probable mutator protein MutT; n=1;
           Blastopirellula marina DSM 3645|Rep: Probable mutator
           protein MutT - Blastopirellula marina DSM 3645
          Length = 217

 Score = 37.5 bits (83), Expect = 0.21
 Identities = 18/44 (40%), Positives = 24/44 (54%)
 Frame = +1

Query: 40  EVFSFLWASLTSISNDKAPRNILVERGRLELPGPVLEAAGSQDW 171
           EV   L+  + ++ ND+    I V R  L+L GP LE  GSQ W
Sbjct: 155 EVAELLFMPIANLGNDQLRSTIRVNRRGLQLAGPALEIGGSQLW 198


>UniRef50_Q2HZG5 Cluster: Yellow-fa; n=2; Bombyx mori|Rep: Yellow-fa
           - Bombyx mori (Silk moth)
          Length = 459

 Score = 36.7 bits (81), Expect = 0.37
 Identities = 23/51 (45%), Positives = 29/51 (56%), Gaps = 2/51 (3%)
 Frame = +1

Query: 256 GIPATLNYIPLDAPYEP-SPKLTPYPSF-EGNELGNCQTGLTTVYRVKADQ 402
           GIP+TLNY+ L       SP L PYPS  EG       + L +VYR +AD+
Sbjct: 134 GIPSTLNYVDLTTDSNTRSPALRPYPSLREG-------SSLVSVYRTRADE 177


>UniRef50_UPI00015B6396 Cluster: PREDICTED: similar to major royal
           jelly protein 9; n=2; Nasonia vitripennis|Rep:
           PREDICTED: similar to major royal jelly protein 9 -
           Nasonia vitripennis
          Length = 412

 Score = 35.9 bits (79), Expect = 0.64
 Identities = 20/50 (40%), Positives = 29/50 (58%), Gaps = 1/50 (2%)
 Frame = +1

Query: 256 GIPATLNYIPLDAPYEPSPKLTPYPSFEGNE-LGNCQTGLTTVYRVKADQ 402
           G+PA+++ +  D      P L PYP +   E  GNC  G+T+VYRV  D+
Sbjct: 87  GVPASVHTVS-DMEGPSGPLLRPYPDWSWYENTGNCN-GITSVYRVAIDK 134


>UniRef50_UPI00003C0D78 Cluster: PREDICTED: similar to yellow-g
           CG5717-PA; n=1; Apis mellifera|Rep: PREDICTED: similar
           to yellow-g CG5717-PA - Apis mellifera
          Length = 375

 Score = 35.9 bits (79), Expect = 0.64
 Identities = 27/91 (29%), Positives = 43/91 (47%), Gaps = 13/91 (14%)
 Frame = +1

Query: 130 LPGPVLEAAGSQDW-CSDTR---ERTARWYRK----VEEQIVRQRS*VAL-----GIPAT 270
           LP  ++ +  S DW C  T+   E + R+  +       QI   ++ +AL     G+P T
Sbjct: 27  LPQSLIFSGLSLDWPCQSTKNIYETSGRYIARNVIATRAQIFEDKAILALPRYKPGVPFT 86

Query: 271 LNYIPLDAPYEPSPKLTPYPSFEGNELGNCQ 363
           L  + L +     PK+ P+P +   E GNCQ
Sbjct: 87  LGILDLKSQNNCEPKVAPFPCWAIQEEGNCQ 117


>UniRef50_Q8MZM5 Cluster: Dopachrome conversion enzyme; n=10;
           Culicidae|Rep: Dopachrome conversion enzyme - Anopheles
           gambiae (African malaria mosquito)
          Length = 462

 Score = 35.9 bits (79), Expect = 0.64
 Identities = 22/54 (40%), Positives = 31/54 (57%), Gaps = 5/54 (9%)
 Frame = +1

Query: 256 GIPATLNYIPLDAPY-EPSPKLTPYPSFEGNEL-GNCQ---TGLTTVYRVKADQ 402
           GIP+TLN + L  P+   +  L PYP+F  NEL  + Q     + TVYR + D+
Sbjct: 74  GIPSTLNVVDLSPPFPNTNVILKPYPNFALNELRADLQPDANRIVTVYRPRVDR 127


>UniRef50_UPI0000D56D70 Cluster: PREDICTED: similar to CG8063-PA;
           n=1; Tribolium castaneum|Rep: PREDICTED: similar to
           CG8063-PA - Tribolium castaneum
          Length = 454

 Score = 35.1 bits (77), Expect = 1.1
 Identities = 14/23 (60%), Positives = 18/23 (78%)
 Frame = +2

Query: 185 ENALPVGIERWRNKLFVSVPRWR 253
           EN +P+G   WR+KLFV+VPR R
Sbjct: 91  ENNIPMGANLWRDKLFVTVPRRR 113


>UniRef50_Q2HZG3 Cluster: Yellow-fb; n=1; Bombyx mori|Rep: Yellow-fb
           - Bombyx mori (Silk moth)
          Length = 418

 Score = 34.3 bits (75), Expect = 2.0
 Identities = 21/49 (42%), Positives = 26/49 (53%)
 Frame = +1

Query: 253 LGIPATLNYIPLDAPYEPSPKLTPYPSFEGNELGNCQTGLTTVYRVKAD 399
           LGIP+TLNYI      +  P L PYP+ E        + LT+VYR   D
Sbjct: 98  LGIPSTLNYIDRRHSKKLDPLLKPYPNPE------AVSSLTSVYRTAID 140


>UniRef50_A4RCK1 Cluster: Predicted protein; n=1; Magnaporthe
           grisea|Rep: Predicted protein - Magnaporthe grisea (Rice
           blast fungus) (Pyricularia grisea)
          Length = 72

 Score = 34.3 bits (75), Expect = 2.0
 Identities = 20/49 (40%), Positives = 25/49 (51%), Gaps = 1/49 (2%)
 Frame = +1

Query: 34  GSEVFSFLWASLTSISNDKAPRNI-LVERGRLELPGPVLEAAGSQDWCS 177
           G +VF  L   LTS +  K+ R   LV   RLE+PG  + A G   W S
Sbjct: 19  GLDVFKMLLVDLTSRAQKKSNRQYALVFEVRLEIPGLSIRAGGMAQWLS 67


>UniRef50_P32568 Cluster: Protein SNQ2; n=9; Saccharomycetales|Rep:
           Protein SNQ2 - Saccharomyces cerevisiae (Baker's yeast)
          Length = 1501

 Score = 34.3 bits (75), Expect = 2.0
 Identities = 16/45 (35%), Positives = 24/45 (53%)
 Frame = -3

Query: 331 SGRALISGMVHMERPVECSSK*LGYLAPPRNADEQFVPPPFDTNG 197
           SG+ +  G++H  +P       +GYL PPR A  +F+    D NG
Sbjct: 385 SGKQIYFGLIHEAKPYFAK---MGYLCPPRQATAEFLTALTDPNG 426


>UniRef50_Q0C7C7 Cluster: Dopachrome-conversion enzyme (DCE),
           putative; n=2; Culicidae|Rep: Dopachrome-conversion
           enzyme (DCE), putative - Aedes aegypti (Yellowfever
           mosquito)
          Length = 426

 Score = 33.9 bits (74), Expect = 2.6
 Identities = 22/54 (40%), Positives = 28/54 (51%), Gaps = 5/54 (9%)
 Frame = +1

Query: 256 GIPATLNYIPLDAPYE-PSPKLTPYPSFEGNELGNCQTG----LTTVYRVKADQ 402
           GIPATLN I +    +  SP LT YP +  N+L +        L +VYR   DQ
Sbjct: 88  GIPATLNVIDIKKQGDNKSPTLTAYPEYRINQLHSDYHADLKRLVSVYRTTVDQ 141


>UniRef50_Q22847 Cluster: Putative uncharacterized protein; n=1;
           Caenorhabditis elegans|Rep: Putative uncharacterized
           protein - Caenorhabditis elegans
          Length = 459

 Score = 33.5 bits (73), Expect = 3.4
 Identities = 21/68 (30%), Positives = 30/68 (44%)
 Frame = +1

Query: 139 PVLEAAGSQDWCSDTRERTARWYRKVEEQIVRQRS*VALGIPATLNYIPLDAPYEPSPKL 318
           P L A  S    +   ER AR        ++ QR  +      T +  PLD P++PS KL
Sbjct: 90  PSLMAHSSVPLSNSKSERRAR--SSSPGHVIAQRKTMVSSSSGTFSPPPLDPPFDPSSKL 147

Query: 319 TPYPSFEG 342
           +  P  +G
Sbjct: 148 SALPDIDG 155


>UniRef50_A0NDC3 Cluster: ENSANGP00000031925; n=1; Anopheles gambiae
           str. PEST|Rep: ENSANGP00000031925 - Anopheles gambiae
           str. PEST
          Length = 400

 Score = 33.5 bits (73), Expect = 3.4
 Identities = 24/55 (43%), Positives = 29/55 (52%), Gaps = 6/55 (10%)
 Frame = +1

Query: 256 GIPATLNYIPLDAPYE--PSPKLTPYPSFEGNELGN----CQTGLTTVYRVKADQ 402
           GIP+TLN I LD   E   SPKL  YP+   NEL          L +VYR + D+
Sbjct: 102 GIPSTLNVIVLDQVPEGDKSPKLIAYPNALTNELRTPYQPDPKKLISVYRTRVDR 156


>UniRef50_Q9VFV2 Cluster: CG17044-PA; n=4; Sophophora|Rep:
           CG17044-PA - Drosophila melanogaster (Fruit fly)
          Length = 426

 Score = 33.1 bits (72), Expect = 4.5
 Identities = 10/37 (27%), Positives = 21/37 (56%)
 Frame = +2

Query: 101 IFSWNVVDWNYPDQFSKQQALRTGALIPENALPVGIE 211
           +F W  + + +P +  + Q LR G   P++ +P+ I+
Sbjct: 35  VFEWKNLQYGFPSEQERDQVLRNGRYNPDSPIPIDID 71


>UniRef50_A2QYM5 Cluster: Remark: protein of the patent is useful
           useful for diagnosis or vaccine production; n=2;
           Aspergillus niger|Rep: Remark: protein of the patent is
           useful useful for diagnosis or vaccine production -
           Aspergillus niger
          Length = 518

 Score = 33.1 bits (72), Expect = 4.5
 Identities = 17/49 (34%), Positives = 25/49 (51%), Gaps = 1/49 (2%)
 Frame = -3

Query: 412 PITP-GLL*PCIQ*SVLFDNCLIRCLRSSGRALISGMVHMERPVECSSK 269
           P+TP   L PC    +  D+CL++C  +    L+S M+H    V C  K
Sbjct: 390 PVTPLWQLLPCSLKHLFIDHCLLQCSEALYTELVSLMIHCSTHVPCLRK 438


>UniRef50_Q7QB87 Cluster: ENSANGP00000011250; n=2; Culicidae|Rep:
           ENSANGP00000011250 - Anopheles gambiae str. PEST
          Length = 392

 Score = 32.7 bits (71), Expect = 6.0
 Identities = 14/53 (26%), Positives = 30/53 (56%)
 Frame = +2

Query: 89  KLQEIFSWNVVDWNYPDQFSKQQALRTGALIPENALPVGIERWRNKLFVSVPR 247
           K++ +  WN++++N+P  +    A       PEN +  G+E   +++F++ PR
Sbjct: 24  KMEVVKQWNLLNFNFPWDYP---AASKEFYNPENVVATGLEVGYDRIFIATPR 73


>UniRef50_A0BLZ9 Cluster: Chromosome undetermined scaffold_115,
           whole genome shotgun sequence; n=1; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_115,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 797

 Score = 32.7 bits (71), Expect = 6.0
 Identities = 17/34 (50%), Positives = 20/34 (58%)
 Frame = +2

Query: 125 WNYPDQFSKQQALRTGALIPENALPVGIERWRNK 226
           W +P QFSK    +TG LI +N   V I RWR K
Sbjct: 717 WLFPQQFSK----KTGILINKNCHLVNIIRWRRK 746


>UniRef50_Q4RYH4 Cluster: Chromosome 2 SCAF14976, whole genome
           shotgun sequence; n=2; Tetraodontidae|Rep: Chromosome 2
           SCAF14976, whole genome shotgun sequence - Tetraodon
           nigroviridis (Green puffer)
          Length = 517

 Score = 32.3 bits (70), Expect = 7.9
 Identities = 23/67 (34%), Positives = 32/67 (47%)
 Frame = +1

Query: 133 PGPVLEAAGSQDWCSDTRERTARWYRKVEEQIVRQRS*VALGIPATLNYIPLDAPYEPSP 312
           P P L  A S    S +  RT+ W     EQ+V + S    G P   N +  +  +EP  
Sbjct: 288 PSPPLSPAFSPSTASPSSARTSDW-----EQLVDETS----GRPYFYNPMSGETTWEPPE 338

Query: 313 KLTPYPS 333
           +L+PYPS
Sbjct: 339 QLSPYPS 345


>UniRef50_A7BCC0 Cluster: Putative uncharacterized protein; n=1;
           Actinomyces odontolyticus ATCC 17982|Rep: Putative
           uncharacterized protein - Actinomyces odontolyticus ATCC
           17982
          Length = 314

 Score = 32.3 bits (70), Expect = 7.9
 Identities = 12/28 (42%), Positives = 16/28 (57%)
 Frame = +2

Query: 170 GALIPENALPVGIERWRNKLFVSVPRWR 253
           G L+P N L + +  W N  F  +PRWR
Sbjct: 88  GGLVPPNVLAMPVHGWVNLHFSDLPRWR 115


>UniRef50_A5UXV3 Cluster: Periplasmic binding protein; n=3;
           Bacteria|Rep: Periplasmic binding protein - Roseiflexus
           sp. RS-1
          Length = 297

 Score = 32.3 bits (70), Expect = 7.9
 Identities = 19/45 (42%), Positives = 25/45 (55%), Gaps = 3/45 (6%)
 Frame = +3

Query: 303 TIPEINALPELRR---QRIRQLSNRTDYCIQGQSRPGVIGLWVLD 428
           TI E   +PE  R   +R+RQ  +R    + GQ RPGV+ L  LD
Sbjct: 133 TIAEAVGMPERGRRLNERLRQRLDRVRRTVAGQPRPGVVALEWLD 177


>UniRef50_A1SAQ3 Cluster: HemY protein precursor; n=1; Shewanella
           amazonensis SB2B|Rep: HemY protein precursor -
           Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)
          Length = 388

 Score = 32.3 bits (70), Expect = 7.9
 Identities = 15/40 (37%), Positives = 26/40 (65%)
 Frame = +1

Query: 142 VLEAAGSQDWCSDTRERTARWYRKVEEQIVRQRS*VALGI 261
           +LE AGS+DW  D+ ++  +W  + E+Q+   R+  ALG+
Sbjct: 234 LLEQAGSKDW--DSLDKEWQWLSRSEKQLSANRAAYALGL 271


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 584,315,152
Number of Sequences: 1657284
Number of extensions: 12353345
Number of successful extensions: 31214
Number of sequences better than 10.0: 54
Number of HSP's better than 10.0 without gapping: 29958
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 31195
length of database: 575,637,011
effective HSP length: 96
effective length of database: 416,537,747
effective search space used: 37071859483
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).