SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0027
         (611 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_Q37953 Cluster: LacZ protein; n=1; Phage M13mp18|Rep: L...   112   7e-24
UniRef50_P00722 Cluster: Beta-galactosidase; n=35; root|Rep: Bet...   112   7e-24
UniRef50_Q8GEG0 Cluster: Putative uncharacterized protein; n=1; ...   110   3e-23
UniRef50_Q47336 Cluster: LacZ-alpha peptide; n=2; cellular organ...   100   2e-20
UniRef50_Q669R9 Cluster: Beta-galactosidase; n=14; Yersinia|Rep:...    77   4e-13
UniRef50_A7MN76 Cluster: Putative uncharacterized protein; n=1; ...    65   1e-09
UniRef50_UPI0000498F17 Cluster: beta-galactosidase; n=3; Eukaryo...    64   3e-09
UniRef50_P06219 Cluster: Beta-galactosidase; n=11; Gammaproteoba...    58   1e-07
UniRef50_A0ZLG1 Cluster: Beta-D-galactosidase; n=1; Nodularia sp...    57   4e-07
UniRef50_P81650 Cluster: Beta-galactosidase; n=26; Gammaproteoba...    54   3e-06
UniRef50_A6FJQ2 Cluster: 50S ribosomal protein L5; n=8; Bacteria...    52   1e-05
UniRef50_Q15XN9 Cluster: Glycoside hydrolase family 2, TIM barre...    49   1e-04
UniRef50_A6DI70 Cluster: Beta-D-galactosidase; n=1; Lentisphaera...    43   0.007
UniRef50_Q9JN59 Cluster: Beta-galactosidase; n=16; Vibrio choler...    42   0.009
UniRef50_A0M224 Cluster: Beta-galactosidase; n=1; Gramella forse...    42   0.009
UniRef50_A0UVE2 Cluster: Glycoside hydrolase family 2, TIM barre...    41   0.020
UniRef50_A7LU08 Cluster: Putative uncharacterized protein; n=1; ...    40   0.035
UniRef50_Q1II16 Cluster: Glycoside hydrolase family 2, TIM barre...    39   0.081
UniRef50_Q15NH4 Cluster: Glycoside hydrolase family 2, TIM barre...    38   0.19 
UniRef50_A5FCG4 Cluster: Beta-galactosidase precursor; n=1; Flav...    37   0.33 
UniRef50_Q4Z0C1 Cluster: Putative uncharacterized protein; n=3; ...    37   0.33 
UniRef50_A7CVC4 Cluster: Beta-galactosidase; n=1; Opitutaceae ba...    37   0.43 
UniRef50_Q8A2G5 Cluster: Beta-galactosidase; n=8; Bacteroidales|...    36   0.57 
UniRef50_Q2VT50 Cluster: Beta-galactosidase precursor; n=2; Flav...    36   0.57 
UniRef50_A3XMD4 Cluster: Beta-galactosidase; n=1; Leeuwenhoekiel...    36   0.76 
UniRef50_Q48727 Cluster: Beta-galactosidase; n=3; Lactococcus la...    36   0.76 
UniRef50_A4RLN6 Cluster: Putative uncharacterized protein; n=2; ...    35   1.8  
UniRef50_O52847 Cluster: Beta-galactosidase; n=3; Bacillus megat...    35   1.8  
UniRef50_Q9K9C6 Cluster: Beta-galactosidase; n=6; Firmicutes|Rep...    34   3.1  
UniRef50_Q1NHI7 Cluster: Beta-galactosidase; n=1; Sphingomonas s...    33   4.0  
UniRef50_A4AN51 Cluster: Beta-galactosidase; n=1; Flavobacterial...    33   5.3  
UniRef50_A2VBJ9 Cluster: Non-ribosomal peptide synthetase; n=1; ...    33   5.3  
UniRef50_Q98R61 Cluster: Putative uncharacterized protein MYPU_1...    33   7.1  
UniRef50_A6G4K3 Cluster: Putative uncharacterized protein; n=1; ...    33   7.1  
UniRef50_Q5DC94 Cluster: SJCHGC09076 protein; n=1; Schistosoma j...    33   7.1  
UniRef50_Q4Q1N0 Cluster: Putative uncharacterized protein; n=3; ...    33   7.1  
UniRef50_P11570 Cluster: (R)-2-hydroxyglutaryl-CoA dehydratase s...    33   7.1  
UniRef50_Q830R3 Cluster: Glycosyl hydrolase, family 2; n=1; Ente...    32   9.3  
UniRef50_A6KX57 Cluster: Glycoside hydrolase family 2; n=1; Bact...    32   9.3  
UniRef50_A4AWK8 Cluster: Beta-galactosidase; n=1; Flavobacterial...    32   9.3  
UniRef50_Q6CKZ5 Cluster: Kluyveromyces lactis strain NRRL Y-1140...    32   9.3  
UniRef50_Q2UM73 Cluster: Predicted protein; n=7; Trichocomaceae|...    32   9.3  

>UniRef50_Q37953 Cluster: LacZ protein; n=1; Phage M13mp18|Rep: LacZ
           protein - Phage M13mp18
          Length = 102

 Score =  112 bits (269), Expect = 7e-24
 Identities = 49/50 (98%), Positives = 50/50 (100%)
 Frame = +1

Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQ 405
           VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+
Sbjct: 29  VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 78


>UniRef50_P00722 Cluster: Beta-galactosidase; n=35; root|Rep:
           Beta-galactosidase - Escherichia coli (strain K12)
          Length = 1024

 Score =  112 bits (269), Expect = 7e-24
 Identities = 49/50 (98%), Positives = 50/50 (100%)
 Frame = +1

Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQ 405
           VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW+
Sbjct: 11  VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR 60


>UniRef50_Q8GEG0 Cluster: Putative uncharacterized protein; n=1;
           Erwinia amylovora|Rep: Putative uncharacterized protein
           - Erwinia amylovora (Fire blight bacteria)
          Length = 123

 Score =  110 bits (264), Expect = 3e-23
 Identities = 48/50 (96%), Positives = 49/50 (98%)
 Frame = +1

Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQ 405
           VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR LNGEW+
Sbjct: 71  VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRXLNGEWR 120


>UniRef50_Q47336 Cluster: LacZ-alpha peptide; n=2; cellular
           organisms|Rep: LacZ-alpha peptide - Escherichia coli
          Length = 90

 Score =  100 bits (240), Expect = 2e-20
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +1

Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 390
           VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL
Sbjct: 25  VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSL 69


>UniRef50_Q669R9 Cluster: Beta-galactosidase; n=14; Yersinia|Rep:
           Beta-galactosidase - Yersinia pseudotuberculosis
          Length = 1066

 Score = 76.6 bits (180), Expect = 4e-13
 Identities = 31/50 (62%), Positives = 39/50 (78%)
 Frame = +1

Query: 253 RVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 402
           ++L RRDWENP +TQ +RL AHPPF SWR+ E A+ DRPS Q ++LNG W
Sbjct: 17  QILSRRDWENPQITQYHRLEAHPPFHSWRDVESAQKDRPSPQQQTLNGLW 66


>UniRef50_A7MN76 Cluster: Putative uncharacterized protein; n=1;
           Enterobacter sakazakii ATCC BAA-894|Rep: Putative
           uncharacterized protein - Enterobacter sakazakii ATCC
           BAA-894
          Length = 1043

 Score = 64.9 bits (151), Expect = 1e-09
 Identities = 24/50 (48%), Positives = 34/50 (68%)
 Frame = +1

Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQ 405
           +L R DW+NP +T +NRL +H P   WR+++ AR   PS  + SL+GEWQ
Sbjct: 21  ILARNDWQNPAITSVNRLPSHTPLHGWRDADRARRGEPSDAVLSLDGEWQ 70


>UniRef50_UPI0000498F17 Cluster: beta-galactosidase; n=3;
           Eukaryota|Rep: beta-galactosidase - Entamoeba
           histolytica HM-1:IMSS
          Length = 86

 Score = 64.1 bits (149), Expect = 3e-09
 Identities = 29/32 (90%), Positives = 32/32 (100%)
 Frame = +2

Query: 254 AFYNVVTGKTLALPNLIALQHIPLSPAGVIAK 349
           +FYNVVTGKTLALPNLIALQHIPLSPAGVI++
Sbjct: 8   SFYNVVTGKTLALPNLIALQHIPLSPAGVISE 39



 Score = 35.5 bits (78), Expect = 1.0
 Identities = 17/22 (77%), Positives = 20/22 (90%)
 Frame = +1

Query: 343 SEEARTDRPSQQLRSLNGEWQI 408
           SEEARTDRPSQQLRSL  +W++
Sbjct: 38  SEEARTDRPSQQLRSL--KWRM 57


>UniRef50_P06219 Cluster: Beta-galactosidase; n=11;
           Gammaproteobacteria|Rep: Beta-galactosidase - Klebsiella
           pneumoniae
          Length = 1034

 Score = 58.4 bits (135), Expect = 1e-07
 Identities = 26/47 (55%), Positives = 31/47 (65%)
 Frame = +1

Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNG 396
           VL R DW N  +T LNRL AHP FASWR+   AR + PS + R L+G
Sbjct: 17  VLAREDWHNQTITHLNRLPAHPVFASWRDELAARDNLPSSRRRQLDG 63


>UniRef50_A0ZLG1 Cluster: Beta-D-galactosidase; n=1; Nodularia
           spumigena CCY 9414|Rep: Beta-D-galactosidase - Nodularia
           spumigena CCY 9414
          Length = 72

 Score = 56.8 bits (131), Expect = 4e-07
 Identities = 23/26 (88%), Positives = 26/26 (100%)
 Frame = +1

Query: 334 WRNSEEARTDRPSQQLRSLNGEWQIV 411
           WRNSEEARTDRPSQQLRSLNGEW+++
Sbjct: 47  WRNSEEARTDRPSQQLRSLNGEWRLM 72


>UniRef50_P81650 Cluster: Beta-galactosidase; n=26;
           Gammaproteobacteria|Rep: Beta-galactosidase -
           Pseudoalteromonas haloplanktis (Alteromonas
           haloplanktis)
          Length = 1039

 Score = 54.0 bits (124), Expect = 3e-06
 Identities = 22/49 (44%), Positives = 34/49 (69%)
 Frame = +1

Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 402
           ++ RRDWENP   Q+N++ AH P   ++  E+AR +  SQ+ +SLNG+W
Sbjct: 7   IINRRDWENPITVQVNQVKAHSPLNGFKTIEDARENTQSQK-KSLNGQW 54


>UniRef50_A6FJQ2 Cluster: 50S ribosomal protein L5; n=8;
           Bacteria|Rep: 50S ribosomal protein L5 - Moritella sp.
           PE36
          Length = 45

 Score = 51.6 bits (118), Expect = 1e-05
 Identities = 25/31 (80%), Positives = 26/31 (83%)
 Frame = -3

Query: 411 YNLPFAIQAAQLLGRAIGAGLFAITPAGERG 319
           +  PFAIQAAQLLGRAIGAGLFAITP  E G
Sbjct: 8   HQAPFAIQAAQLLGRAIGAGLFAITPEFELG 38


>UniRef50_Q15XN9 Cluster: Glycoside hydrolase family 2, TIM barrel
           precursor; n=1; Pseudoalteromonas atlantica T6c|Rep:
           Glycoside hydrolase family 2, TIM barrel precursor -
           Pseudoalteromonas atlantica (strain T6c / BAA-1087)
          Length = 1079

 Score = 48.8 bits (111), Expect = 1e-04
 Identities = 26/62 (41%), Positives = 36/62 (58%), Gaps = 4/62 (6%)
 Frame = +1

Query: 232 VVLQFTGR---VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEART-DRPSQQLRSLNGE 399
           ++  FTG    V  + DWENP V Q+NRL A     S+   E+A T DR    ++SLNG+
Sbjct: 17  LLFSFTGSAKTVQVKNDWENPDVIQINRLPARATSYSFDTPEQALTRDRNQSTIQSLNGQ 76

Query: 400 WQ 405
           W+
Sbjct: 77  WK 78


>UniRef50_A6DI70 Cluster: Beta-D-galactosidase; n=1; Lentisphaera
           araneosa HTCC2155|Rep: Beta-D-galactosidase -
           Lentisphaera araneosa HTCC2155
          Length = 991

 Score = 42.7 bits (96), Expect = 0.007
 Identities = 20/49 (40%), Positives = 24/49 (48%)
 Frame = +1

Query: 274 WENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVN 420
           WENP    LN LA  PP  S+ + E+A     S  + SLNG W     N
Sbjct: 6   WENPQFVSLNTLAPRPPLYSFDSLEKALEQDQSAYIHSLNGSWNFKLFN 54


>UniRef50_Q9JN59 Cluster: Beta-galactosidase; n=16; Vibrio
           cholerae|Rep: Beta-galactosidase - Vibrio cholerae
          Length = 56

 Score = 42.3 bits (95), Expect = 0.009
 Identities = 18/50 (36%), Positives = 30/50 (60%)
 Frame = +1

Query: 256 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQ 405
           +L  +DW+NP + + +    H P  S+R  +EAR D    + +SLNG+W+
Sbjct: 7   ILLSQDWQNPHIVKWHCRTPHVPLHSYRTEQEARLDVGGNR-QSLNGQWR 55


>UniRef50_A0M224 Cluster: Beta-galactosidase; n=1; Gramella forsetii
           KT0803|Rep: Beta-galactosidase - Gramella forsetii
           (strain KT0803)
          Length = 1049

 Score = 42.3 bits (95), Expect = 0.009
 Identities = 20/47 (42%), Positives = 27/47 (57%), Gaps = 2/47 (4%)
 Frame = +1

Query: 271 DWENPGVTQLNRLAAHPPFASWRNSEEA--RTDRPSQQLRSLNGEWQ 405
           DWENP VT +N+L A     S+ N + A       S +++SLNG WQ
Sbjct: 26  DWENPAVTGINKLPARATMYSFSNKQAAINLNKENSDRVKSLNGTWQ 72


>UniRef50_A0UVE2 Cluster: Glycoside hydrolase family 2, TIM barrel;
           n=1; Clostridium cellulolyticum H10|Rep: Glycoside
           hydrolase family 2, TIM barrel - Clostridium
           cellulolyticum H10
          Length = 1033

 Score = 41.1 bits (92), Expect = 0.020
 Identities = 17/48 (35%), Positives = 31/48 (64%), Gaps = 2/48 (4%)
 Frame = +1

Query: 268 RDWENPGVTQLNRLAAHPPFASWRNSEEARTDR--PSQQLRSLNGEWQ 405
           R+WEN  +TQ+NR   H P+ ++ + E+A +     S+ ++SL+G W+
Sbjct: 3   REWENQYITQINRYPMHSPYGAYESVEQAMSCNRWTSKYVKSLSGIWK 50


>UniRef50_A7LU08 Cluster: Putative uncharacterized protein; n=1;
           Bacteroides ovatus ATCC 8483|Rep: Putative
           uncharacterized protein - Bacteroides ovatus ATCC 8483
          Length = 1046

 Score = 40.3 bits (90), Expect = 0.035
 Identities = 18/52 (34%), Positives = 27/52 (51%), Gaps = 2/52 (3%)
 Frame = +1

Query: 262 QRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP--SQQLRSLNGEWQIV 411
           Q  +WENP   + N+   H  F  +  +E+A  D+P  S    SLNG W+ +
Sbjct: 26  QNNEWENPAKYEWNKERPHADFRLYEQAEDAVNDKPRKSSWQHSLNGVWKFI 77


>UniRef50_Q1II16 Cluster: Glycoside hydrolase family 2, TIM barrel
           precursor; n=1; Acidobacteria bacterium Ellin345|Rep:
           Glycoside hydrolase family 2, TIM barrel precursor -
           Acidobacteria bacterium (strain Ellin345)
          Length = 1049

 Score = 39.1 bits (87), Expect = 0.081
 Identities = 20/50 (40%), Positives = 28/50 (56%), Gaps = 2/50 (4%)
 Frame = +1

Query: 262 QRRDWENPGVTQLNRLAAHPPFASWRNSEEA--RTDRPSQQLRSLNGEWQ 405
           Q  DWENP V  +NR A    F  + +   A  R ++PS  ++SLNG W+
Sbjct: 21  QTPDWENPRVFGINREAPRATFTPFPDEASALKRREQPSVFMQSLNGMWK 70


>UniRef50_Q15NH4 Cluster: Glycoside hydrolase family 2, TIM barrel;
           n=1; Pseudoalteromonas atlantica T6c|Rep: Glycoside
           hydrolase family 2, TIM barrel - Pseudoalteromonas
           atlantica (strain T6c / BAA-1087)
          Length = 1045

 Score = 37.9 bits (84), Expect = 0.19
 Identities = 18/46 (39%), Positives = 24/46 (52%), Gaps = 2/46 (4%)
 Frame = +1

Query: 271 DWENPGVTQLNRLAAHPPFASWRNSEEARTDRP--SQQLRSLNGEW 402
           DW+NP V  +N+  A   F  + +  +   D P  SQ   SLNGEW
Sbjct: 11  DWQNPEVFAINKEPARSSFYGFSDDPQGYVDSPFMSQDYLSLNGEW 56


>UniRef50_A5FCG4 Cluster: Beta-galactosidase precursor; n=1;
           Flavobacterium johnsoniae UW101|Rep: Beta-galactosidase
           precursor - Flavobacterium johnsoniae UW101
          Length = 1108

 Score = 37.1 bits (82), Expect = 0.33
 Identities = 17/52 (32%), Positives = 31/52 (59%), Gaps = 2/52 (3%)
 Frame = +1

Query: 274 WENPGVTQLNRLAAHPPFASWRNSEEA-RTDRPSQQLRSLNGEWQI-VSVNI 423
           WE+P +T +NR  +     S+ + E+A + DR   +++ LNG+W    +VN+
Sbjct: 57  WEDPTITSINRQPSRATAYSYSSVEDALKGDRTKSRIQMLNGDWDFKYAVNL 108


>UniRef50_Q4Z0C1 Cluster: Putative uncharacterized protein; n=3;
           Plasmodium (Vinckeia)|Rep: Putative uncharacterized
           protein - Plasmodium berghei
          Length = 275

 Score = 37.1 bits (82), Expect = 0.33
 Identities = 16/16 (100%), Positives = 16/16 (100%)
 Frame = +3

Query: 195 RGGARYPIRPIVSRIT 242
           RGGARYPIRPIVSRIT
Sbjct: 260 RGGARYPIRPIVSRIT 275


>UniRef50_A7CVC4 Cluster: Beta-galactosidase; n=1; Opitutaceae
           bacterium TAV2|Rep: Beta-galactosidase - Opitutaceae
           bacterium TAV2
          Length = 1130

 Score = 36.7 bits (81), Expect = 0.43
 Identities = 18/46 (39%), Positives = 25/46 (54%), Gaps = 2/46 (4%)
 Frame = +1

Query: 274 WENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR--SLNGEWQ 405
           WE P +T LN+L     F  + + +EAR  +  +  R  SLNG WQ
Sbjct: 10  WEAPELTSLNKLPPRATFHGFGSVKEARAGKSEKSTRHHSLNGTWQ 55


>UniRef50_Q8A2G5 Cluster: Beta-galactosidase; n=8;
           Bacteroidales|Rep: Beta-galactosidase - Bacteroides
           thetaiotaomicron
          Length = 1036

 Score = 36.3 bits (80), Expect = 0.57
 Identities = 15/47 (31%), Positives = 29/47 (61%), Gaps = 2/47 (4%)
 Frame = +1

Query: 271 DWENPGVTQLNRLAAHPPFASWRNSEEAR--TDRPSQQLRSLNGEWQ 405
           +W++P V  +NR A H  + ++ +++EA+  +   SQ   +LNG W+
Sbjct: 26  EWKDPEVNSVNRSAMHTNYFAYASADEAKAGSKEDSQNFMTLNGLWK 72


>UniRef50_Q2VT50 Cluster: Beta-galactosidase precursor; n=2;
           Flavobacterium|Rep: Beta-galactosidase precursor -
           Flavobacterium sp. 4214
          Length = 1046

 Score = 36.3 bits (80), Expect = 0.57
 Identities = 20/59 (33%), Positives = 28/59 (47%), Gaps = 2/59 (3%)
 Frame = +1

Query: 235 VLQFTGRVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTD--RPSQQLRSLNGEWQ 405
           ++ F      R DWENP V Q+NR  A   F  + +   A  D    S    SL+G+W+
Sbjct: 18  IIVFAQEKPSRNDWENPEVFQINREPARAAFLPFADEASAIADDYTRSPWYMSLDGKWK 76


>UniRef50_A3XMD4 Cluster: Beta-galactosidase; n=1; Leeuwenhoekiella
           blandensis MED217|Rep: Beta-galactosidase -
           Leeuwenhoekiella blandensis MED217
          Length = 1033

 Score = 35.9 bits (79), Expect = 0.76
 Identities = 16/50 (32%), Positives = 27/50 (54%), Gaps = 2/50 (4%)
 Frame = +1

Query: 262 QRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQ--LRSLNGEWQ 405
           Q+ +WENP +   N+      F  +  +++A+T   SQ    +SLNG W+
Sbjct: 20  QQNEWENPKIIDRNKEEGRASFVLFEKTQKAKTRDASQSQFYKSLNGVWK 69


>UniRef50_Q48727 Cluster: Beta-galactosidase; n=3; Lactococcus
           lactis|Rep: Beta-galactosidase - Lactococcus lactis
           subsp. lactis (Streptococcus lactis)
          Length = 998

 Score = 35.9 bits (79), Expect = 0.76
 Identities = 14/23 (60%), Positives = 17/23 (73%)
 Frame = +1

Query: 256 VLQRRDWENPGVTQLNRLAAHPP 324
           VL+R+DWENP V+  NRL  H P
Sbjct: 9   VLERKDWENPVVSNWNRLPMHTP 31


>UniRef50_A4RLN6 Cluster: Putative uncharacterized protein; n=2;
           Magnaporthe grisea|Rep: Putative uncharacterized protein
           - Magnaporthe grisea (Rice blast fungus) (Pyricularia
           grisea)
          Length = 1047

 Score = 34.7 bits (76), Expect = 1.8
 Identities = 18/46 (39%), Positives = 22/46 (47%), Gaps = 1/46 (2%)
 Frame = +1

Query: 271 DWENPGVTQLNRLAAHPPFASWRNSEEART-DRPSQQLRSLNGEWQ 405
           DW N  V   N L A   F S+ +   A T DR   +  SLNG W+
Sbjct: 9   DWSNLAVLHTNALPARAHFYSYASETAALTHDRHQSEYHSLNGTWK 54


>UniRef50_O52847 Cluster: Beta-galactosidase; n=3; Bacillus
           megaterium|Rep: Beta-galactosidase - Bacillus megaterium
          Length = 1034

 Score = 34.7 bits (76), Expect = 1.8
 Identities = 20/47 (42%), Positives = 26/47 (55%), Gaps = 3/47 (6%)
 Frame = +1

Query: 271 DWEN-PGVTQLNRLAAHPPFASWRNSEEA-RTDRPSQ-QLRSLNGEW 402
           +W N P + QLNR  AH     ++  EEA + DR S    +SLNG W
Sbjct: 19  EWNNNPEIFQLNRSKAHALLMPYQTVEEALKNDRKSSVYYQSLNGSW 65


>UniRef50_Q9K9C6 Cluster: Beta-galactosidase; n=6; Firmicutes|Rep:
           Beta-galactosidase - Bacillus halodurans
          Length = 1014

 Score = 33.9 bits (74), Expect = 3.1
 Identities = 15/39 (38%), Positives = 20/39 (51%)
 Frame = +1

Query: 289 VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQ 405
           V  +NRL AH     +   EEA+ + P     SLNG W+
Sbjct: 15  VFAVNRLPAHSDHVYYETVEEAKKEPPMSMRHSLNGHWK 53


>UniRef50_Q1NHI7 Cluster: Beta-galactosidase; n=1; Sphingomonas sp.
           SKA58|Rep: Beta-galactosidase - Sphingomonas sp. SKA58
          Length = 1078

 Score = 33.5 bits (73), Expect = 4.0
 Identities = 20/50 (40%), Positives = 27/50 (54%), Gaps = 3/50 (6%)
 Frame = +1

Query: 265 RRDWENPGVTQLNRLAAHP---PFASWRNSEEARTDRPSQQLRSLNGEWQ 405
           R DWENP V  + +L A     PF S R++  A     S++  SLNG W+
Sbjct: 39  RPDWENPAVFAIGKLPARATAFPFES-RDAALAGDRSRSRRFLSLNGPWK 87


>UniRef50_A4AN51 Cluster: Beta-galactosidase; n=1; Flavobacteriales
           bacterium HTCC2170|Rep: Beta-galactosidase -
           Flavobacteriales bacterium HTCC2170
          Length = 1126

 Score = 33.1 bits (72), Expect = 5.3
 Identities = 16/46 (34%), Positives = 25/46 (54%), Gaps = 2/46 (4%)
 Frame = +1

Query: 271 DWENPGVTQLNRLAAHPPFASWRNSEEART--DRPSQQLRSLNGEW 402
           DWENP +  +N+L  H  F  +++ E A +     S + + LNG W
Sbjct: 27  DWENPEIFGINKLEPHAFFIPFQSQESALSFDATRSDRYQLLNGYW 72


>UniRef50_A2VBJ9 Cluster: Non-ribosomal peptide synthetase; n=1;
           uncultured bacterium|Rep: Non-ribosomal peptide
           synthetase - uncultured bacterium
          Length = 338

 Score = 33.1 bits (72), Expect = 5.3
 Identities = 14/15 (93%), Positives = 14/15 (93%)
 Frame = -3

Query: 237 YDSL*GELGTGPPLE 193
           YDSL GELGTGPPLE
Sbjct: 278 YDSLYGELGTGPPLE 292


>UniRef50_Q98R61 Cluster: Putative uncharacterized protein
           MYPU_1490; n=1; Mycoplasma pulmonis|Rep: Putative
           uncharacterized protein MYPU_1490 - Mycoplasma pulmonis
          Length = 464

 Score = 32.7 bits (71), Expect = 7.1
 Identities = 17/47 (36%), Positives = 28/47 (59%)
 Frame = -2

Query: 244 IVIRLTIGRIGYRAPPRVDVYKHLLLQKYKKNIHLKYRISLLTKQFR 104
           IV  +TI ++GY+   ++D +K L L     +I  KY+ S +TK+ R
Sbjct: 416 IVFSITIKKLGYKIQ-KIDYFKILFLPILANSILKKYKSSFMTKEDR 461


>UniRef50_A6G4K3 Cluster: Putative uncharacterized protein; n=1;
           Plesiocystis pacifica SIR-1|Rep: Putative
           uncharacterized protein - Plesiocystis pacifica SIR-1
          Length = 531

 Score = 32.7 bits (71), Expect = 7.1
 Identities = 15/34 (44%), Positives = 22/34 (64%)
 Frame = +2

Query: 269 VTGKTLALPNLIALQHIPLSPAGVIAKRPAPIAL 370
           V+G  L LP+L+     PL P G++A++  PIAL
Sbjct: 64  VSGPNLQLPHLVDELATPLPPTGLLARKMDPIAL 97


>UniRef50_Q5DC94 Cluster: SJCHGC09076 protein; n=1; Schistosoma
           japonicum|Rep: SJCHGC09076 protein - Schistosoma
           japonicum (Blood fluke)
          Length = 109

 Score = 32.7 bits (71), Expect = 7.1
 Identities = 18/49 (36%), Positives = 27/49 (55%)
 Frame = +1

Query: 259 LQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQ 405
           L+RR+ +NPG  QLN L A P F     +++A  +R S+      G+ Q
Sbjct: 60  LKRREGKNPGCPQLNPLEALPLFPGGEKTKKAPPNRLSKNWPPPEGQRQ 108


>UniRef50_Q4Q1N0 Cluster: Putative uncharacterized protein; n=3;
           Leishmania|Rep: Putative uncharacterized protein -
           Leishmania major
          Length = 300

 Score = 32.7 bits (71), Expect = 7.1
 Identities = 20/60 (33%), Positives = 28/60 (46%), Gaps = 1/60 (1%)
 Frame = +1

Query: 199 GGPGTQFAL**VVLQFTGRVLQRRDWENPGVTQLNRLAAHPPFASWRNSE-EARTDRPSQ 375
           GG G  F++  V +         R+W        NRL  HP  A+   +E EA TDRP++
Sbjct: 191 GGTGVLFSILVVAIWTLYHYAPWREWVQVSAHWYNRLRGHPEPANTSQAEHEATTDRPTR 250


>UniRef50_P11570 Cluster: (R)-2-hydroxyglutaryl-CoA dehydratase
           subunit beta; n=2; Clostridiales|Rep:
           (R)-2-hydroxyglutaryl-CoA dehydratase subunit beta -
           Acidaminococcus fermentans
          Length = 379

 Score = 32.7 bits (71), Expect = 7.1
 Identities = 19/52 (36%), Positives = 29/52 (55%)
 Frame = +1

Query: 43  VCNKNLI*RRLICELEHEHRDEIV*SIKISYILDVYFFCISVIKDVYKRRLE 198
           V NK+   RR  C+L +EH D I  S++ + +   YF    ++KD Y  +LE
Sbjct: 169 VYNKSRAARREFCKLANEHPDLIPASVRATVLRAAYF----MLKDEYTEKLE 216


>UniRef50_Q830R3 Cluster: Glycosyl hydrolase, family 2; n=1;
           Enterococcus faecalis|Rep: Glycosyl hydrolase, family 2
           - Enterococcus faecalis (Streptococcus faecalis)
          Length = 1025

 Score = 32.3 bits (70), Expect = 9.3
 Identities = 16/50 (32%), Positives = 27/50 (54%), Gaps = 2/50 (4%)
 Frame = +1

Query: 268 RDWENPGVTQLNRLAAHPPFASWRNSEEA--RTDRPSQQLRSLNGEWQIV 411
           + WEN  V  +NRL     F+S+ + E A    ++ +Q  ++LNG W  +
Sbjct: 2   KTWENYKVDSINRLPGRAHFSSFPSKETALLNENKYTQAYKNLNGCWHFL 51


>UniRef50_A6KX57 Cluster: Glycoside hydrolase family 2; n=1;
           Bacteroides vulgatus ATCC 8482|Rep: Glycoside hydrolase
           family 2 - Bacteroides vulgatus (strain ATCC 8482 / DSM
           1447 / NCTC 11154)
          Length = 1076

 Score = 32.3 bits (70), Expect = 9.3
 Identities = 18/47 (38%), Positives = 23/47 (48%), Gaps = 2/47 (4%)
 Frame = +1

Query: 271 DWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQ--LRSLNGEWQ 405
           DWEN  V  +NRL +   F  +   E A     SQ    +SLNG W+
Sbjct: 55  DWENFDVLHINRLPSAANFMGYPTKELALQGDKSQSPYFQSLNGTWK 101


>UniRef50_A4AWK8 Cluster: Beta-galactosidase; n=1; Flavobacteriales
           bacterium HTCC2170|Rep: Beta-galactosidase -
           Flavobacteriales bacterium HTCC2170
          Length = 1072

 Score = 32.3 bits (70), Expect = 9.3
 Identities = 17/57 (29%), Positives = 27/57 (47%), Gaps = 3/57 (5%)
 Frame = +1

Query: 241 QFTGRVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP---SQQLRSLNGEW 402
           ++T    +  DWENP + Q+NR      F  + +   A  ++    S   +SLNG W
Sbjct: 27  EYTADKWENPDWENPEIFQINREEPTASFYRYADESTALKNQSWENSPLYKSLNGTW 83


>UniRef50_Q6CKZ5 Cluster: Kluyveromyces lactis strain NRRL Y-1140
            chromosome F of strain NRRL Y- 1140 of Kluyveromyces
            lactis; n=1; Kluyveromyces lactis|Rep: Kluyveromyces
            lactis strain NRRL Y-1140 chromosome F of strain NRRL Y-
            1140 of Kluyveromyces lactis - Kluyveromyces lactis
            (Yeast) (Candida sphaerica)
          Length = 1322

 Score = 32.3 bits (70), Expect = 9.3
 Identities = 12/32 (37%), Positives = 21/32 (65%)
 Frame = -1

Query: 449  QKFNANFNKILTLTICHSPFRLRNCWEGRSVR 354
            +K++ N N++L + I H  F LR+C+E   +R
Sbjct: 1137 KKYDENLNELLKIVIIHEKFILRHCFESIELR 1168


>UniRef50_Q2UM73 Cluster: Predicted protein; n=7;
           Trichocomaceae|Rep: Predicted protein - Aspergillus
           oryzae
          Length = 167

 Score = 32.3 bits (70), Expect = 9.3
 Identities = 13/27 (48%), Positives = 19/27 (70%)
 Frame = +1

Query: 319 PPFASWRNSEEARTDRPSQQLRSLNGE 399
           PP +S RN E  R ++P+  LR+L+GE
Sbjct: 56  PPSSSSRNDESQREEKPAPHLRNLSGE 82


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 629,105,559
Number of Sequences: 1657284
Number of extensions: 12855857
Number of successful extensions: 31375
Number of sequences better than 10.0: 42
Number of HSP's better than 10.0 without gapping: 30519
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 31365
length of database: 575,637,011
effective HSP length: 97
effective length of database: 414,880,463
effective search space used: 43977329078
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).