SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0026
         (630 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_Q96483 Cluster: Actin-51; n=584; Eukaryota|Rep: Actin-5...   190   2e-47
UniRef50_O65314 Cluster: Actin; n=20; Eukaryota|Rep: Actin - Sch...   190   2e-47
UniRef50_Q4JSC0 Cluster: Actin; n=13; Coelomata|Rep: Actin - Ano...   186   5e-46
UniRef50_P14883 Cluster: Actin-2; n=75; Eukaryota|Rep: Actin-2 -...   184   2e-45
UniRef50_P02581 Cluster: Actin-1; n=1852; Eukaryota|Rep: Actin-1...   174   1e-42
UniRef50_Q0VHZ5 Cluster: Actin deviating protein; n=7; Eukaryota...   155   6e-37
UniRef50_Q7XB26 Cluster: Ubiquitin/actin fusion protein 4; n=1; ...   146   5e-34
UniRef50_A5E2K2 Cluster: Actin; n=5; Saccharomycetales|Rep: Acti...   146   5e-34
UniRef50_A2DKQ5 Cluster: Actin 58, putative; n=2; Trichomonas va...   136   5e-31
UniRef50_UPI000065FC19 Cluster: Homolog of Homo sapiens "Actin, ...   134   1e-30
UniRef50_Q2GY63 Cluster: Putative uncharacterized protein; n=1; ...   132   7e-30
UniRef50_UPI0000F2D825 Cluster: PREDICTED: similar to actin; n=1...   132   9e-30
UniRef50_A4QNT8 Cluster: Si:ch211-241j12.3 protein; n=3; Danio r...   129   6e-29
UniRef50_P61163 Cluster: Alpha-centractin; n=356; root|Rep: Alph...   129   6e-29
UniRef50_Q0VHZ6 Cluster: Actin deviating protein; n=2; Bolivina ...   128   8e-29
UniRef50_UPI0000F2D326 Cluster: PREDICTED: similar to actin; n=1...   126   4e-28
UniRef50_UPI00001E426E Cluster: PREDICTED: similar to actin-12; ...   124   2e-27
UniRef50_UPI0000605B09 Cluster: PREDICTED: similar to actin alph...   123   4e-27
UniRef50_UPI00005A2ACF Cluster: PREDICTED: similar to cytoplasmi...   122   9e-27
UniRef50_UPI00005864C8 Cluster: PREDICTED: similar to Actin; n=4...   121   2e-26
UniRef50_UPI0000449751 Cluster: PREDICTED: similar to gamma-acti...   117   2e-25
UniRef50_Q7M3B0 Cluster: Actin beta; n=1; Sus scrofa domestica|R...   114   1e-24
UniRef50_Q9XZB9 Cluster: Actin; n=1; Sterkiella nova|Rep: Actin ...   114   1e-24
UniRef50_Q4CV94 Cluster: Actin 2, putative; n=2; Trypanosoma cru...   113   2e-24
UniRef50_A2FRF9 Cluster: Actin family protein; n=1; Trichomonas ...   112   6e-24
UniRef50_Q8MVN5 Cluster: Cardiac actin-like protein; n=1; Bolten...   110   2e-23
UniRef50_Q5KB93 Cluster: Actin binding protein, putative; n=3; F...   110   3e-23
UniRef50_Q24C02 Cluster: Actin family protein; n=3; Oligohymenop...   109   5e-23
UniRef50_Q9DFB8 Cluster: Actin; n=1; Scomberomorus maculatus|Rep...   109   7e-23
UniRef50_A7QKV4 Cluster: Chromosome chr8 scaffold_115, whole gen...   109   7e-23
UniRef50_Q8TDY3 Cluster: Actin-related protein T2; n=26; Amniota...   109   7e-23
UniRef50_P61160 Cluster: Actin-related protein 2; n=96; Eukaryot...   108   1e-22
UniRef50_Q0J646 Cluster: Os08g0369300 protein; n=2; Oryza sativa...   106   4e-22
UniRef50_A2YUL5 Cluster: Putative uncharacterized protein; n=1; ...   106   5e-22
UniRef50_Q9BYD9 Cluster: Actin-related protein M1; n=12; Theria|...   105   1e-21
UniRef50_UPI0001554F81 Cluster: PREDICTED: similar to actin; n=1...   104   2e-21
UniRef50_Q9Y615 Cluster: Actin-like protein 7A; n=11; Mammalia|R...   103   4e-21
UniRef50_UPI0000588EB0 Cluster: PREDICTED: similar to actin; n=1...   102   6e-21
UniRef50_Q4SGD5 Cluster: Chromosome 17 SCAF14597, whole genome s...   102   6e-21
UniRef50_Q4N681 Cluster: Actin, putative; n=3; Piroplasmida|Rep:...   102   6e-21
UniRef50_Q6BG22 Cluster: Actin, putative; n=2; Paramecium tetrau...   101   2e-20
UniRef50_UPI0000D9A391 Cluster: PREDICTED: actin related protein...   100   6e-20
UniRef50_Q4QG59 Cluster: Actin-like protein, putative; n=3; Leis...   100   6e-20
UniRef50_Q9Y614 Cluster: Actin-like protein 7B; n=12; Theria|Rep...    99   8e-20
UniRef50_Q54UQ7 Cluster: Actin-like protein 6A; n=1; Dictyosteli...    99   1e-19
UniRef50_Q38F20 Cluster: Actin-like protein 3, putative; n=1; Tr...    99   1e-19
UniRef50_A2FH22 Cluster: Actin family protein; n=1; Trichomonas ...    99   1e-19
UniRef50_A0CQQ2 Cluster: Chromosome undetermined scaffold_24, wh...    99   1e-19
UniRef50_A2DBN6 Cluster: Actin family protein; n=1; Trichomonas ...    98   1e-19
UniRef50_A2VD47 Cluster: Zgc:158823 protein; n=3; Eukaryota|Rep:...    98   2e-19
UniRef50_UPI0000E466A7 Cluster: PREDICTED: similar to actin, alp...    97   4e-19
UniRef50_Q6X960 Cluster: HSD21; n=13; Theria|Rep: HSD21 - Homo s...    97   4e-19
UniRef50_P32392 Cluster: Actin-related protein 3; n=27; Eukaryot...    97   4e-19
UniRef50_UPI0000449ED3 Cluster: PREDICTED: similar to RIKEN cDNA...    96   5e-19
UniRef50_A2YQV6 Cluster: Putative uncharacterized protein; n=1; ...    96   7e-19
UniRef50_A7RPC3 Cluster: Predicted protein; n=3; Eumetazoa|Rep: ...    96   7e-19
UniRef50_A5B4L4 Cluster: Putative uncharacterized protein; n=1; ...    95   2e-18
UniRef50_Q55DS6 Cluster: Putative uncharacterized protein; n=1; ...    94   2e-18
UniRef50_P61158 Cluster: Actin-related protein 3; n=107; Eukaryo...    94   2e-18
UniRef50_O96819 Cluster: Actin-related protein; n=5; Trypanosoma...    92   9e-18
UniRef50_A7S2B1 Cluster: Predicted protein; n=1; Nematostella ve...    92   1e-17
UniRef50_Q75JT2 Cluster: Similar to Drosophila melanogaster (Fru...    91   2e-17
UniRef50_Q14BL3 Cluster: RIKEN cDNA 4921517D21 gene; n=7; Euther...    91   3e-17
UniRef50_Q55DY5 Cluster: Putative uncharacterized protein; n=1; ...    91   3e-17
UniRef50_Q54JL1 Cluster: Putative uncharacterized protein; n=1; ...    91   3e-17
UniRef50_UPI0000F2DE11 Cluster: PREDICTED: similar to testis-spe...    90   5e-17
UniRef50_UPI00005A3B5D Cluster: PREDICTED: similar to Actin-5C; ...    90   5e-17
UniRef50_A0E1S8 Cluster: Chromosome undetermined scaffold_73, wh...    89   8e-17
UniRef50_Q7M3Y6 Cluster: Actin homolog fat, testicular; n=3; Deu...    89   1e-16
UniRef50_UPI0000E23780 Cluster: PREDICTED: hypothetical protein ...    87   2e-16
UniRef50_Q8LKR2 Cluster: Actin-related protein 4; n=7; core eudi...    87   3e-16
UniRef50_Q4DMP2 Cluster: Actin-related protein 2, putative; n=4;...    85   1e-15
UniRef50_O96019 Cluster: Actin-like protein 6A; n=63; Eumetazoa|...    84   3e-15
UniRef50_UPI0000E47BC7 Cluster: PREDICTED: similar to ubiquitin/...    83   4e-15
UniRef50_A3BPG0 Cluster: Putative uncharacterized protein; n=3; ...    83   5e-15
UniRef50_UPI0000F2D272 Cluster: PREDICTED: similar to actin; n=1...    81   2e-14
UniRef50_Q9N4N4 Cluster: Putative uncharacterized protein; n=2; ...    81   2e-14
UniRef50_Q8IS27 Cluster: Actin-related protein 2; n=5; Oligohyme...    81   3e-14
UniRef50_Q6BG23 Cluster: Actin, putative; n=1; Paramecium tetrau...    80   5e-14
UniRef50_Q4QF44 Cluster: Actin-related protein 3, putative; n=3;...    79   9e-14
UniRef50_UPI000049A548 Cluster: actin; n=1; Entamoeba histolytic...    79   1e-13
UniRef50_Q5CSX9 Cluster: Actin; n=2; Cryptosporidium|Rep: Actin ...    77   3e-13
UniRef50_A2DNQ0 Cluster: Actin family protein; n=1; Trichomonas ...    77   3e-13
UniRef50_Q9H568 Cluster: Actin-like protein 8; n=10; Eutheria|Re...    76   6e-13
UniRef50_UPI00015B6274 Cluster: PREDICTED: similar to putative m...    74   2e-12
UniRef50_UPI0000EC9F4D Cluster: HSD21.; n=2; Gallus gallus|Rep: ...    73   6e-12
UniRef50_Q5KLG9 Cluster: 53 kDa brg1-associated factor b (Actin-...    73   6e-12
UniRef50_Q19R57 Cluster: Actin-like protein 1; n=2; Trypanosoma ...    72   1e-11
UniRef50_UPI00006C1719 Cluster: PREDICTED: similar to actin, alp...    72   1e-11
UniRef50_Q6FRF2 Cluster: Similar to sp|P38696 Saccharomyces cere...    72   1e-11
UniRef50_Q9LZY1 Cluster: Actin-like protein; n=4; core eudicotyl...    70   5e-11
UniRef50_Q9P7X7 Cluster: Actin-related protein 4; n=1; Schizosac...    69   7e-11
UniRef50_A4RW28 Cluster: Predicted protein; n=2; Ostreococcus|Re...    68   2e-10
UniRef50_A2ECQ8 Cluster: Actin family protein; n=1; Trichomonas ...    67   3e-10
UniRef50_Q8IIQ4 Cluster: Actin, putative; n=7; Apicomplexa|Rep: ...    67   4e-10
UniRef50_Q4N7N1 Cluster: Actin, putative; n=2; Theileria|Rep: Ac...    65   2e-09
UniRef50_Q22WQ4 Cluster: Actin family protein; n=1; Tetrahymena ...    65   2e-09
UniRef50_Q9Y7X8 Cluster: Actin-like protein Arp5; n=1; Schizosac...    64   2e-09
UniRef50_UPI0000F2D271 Cluster: PREDICTED: similar to actin-like...    64   3e-09
UniRef50_A7QZ13 Cluster: Chromosome undetermined scaffold_261, w...    64   3e-09
UniRef50_UPI0000E46266 Cluster: PREDICTED: similar to actin; n=1...    64   3e-09
UniRef50_Q9SRK2 Cluster: Putative actin; n=1; Arabidopsis thalia...    64   3e-09
UniRef50_Q8LKR0 Cluster: Actin-related protein 6; n=26; Magnolio...    64   3e-09
UniRef50_Q19R56 Cluster: Actin-like protein 3; n=4; Trypanosoma ...    64   3e-09
UniRef50_Q6C061 Cluster: Actin-related protein 4; n=1; Yarrowia ...    64   3e-09
UniRef50_Q4Q187 Cluster: Actin-like protein, putative; n=3; Leis...    63   6e-09
UniRef50_UPI0000D56C2F Cluster: PREDICTED: similar to Actin-57B;...    62   8e-09
UniRef50_Q4P2E8 Cluster: Actin-related protein 4; n=1; Ustilago ...    60   3e-08
UniRef50_A5K109 Cluster: Actin, putative; n=4; Plasmodium|Rep: A...    59   8e-08
UniRef50_Q4P303 Cluster: Putative uncharacterized protein; n=1; ...    58   1e-07
UniRef50_A2DEE0 Cluster: Actin family protein; n=1; Trichomonas ...    58   2e-07
UniRef50_UPI0000499930 Cluster: actin; n=1; Entamoeba histolytic...    57   4e-07
UniRef50_Q9VEC3 Cluster: Actin-related protein 5; n=1; Drosophil...    57   4e-07
UniRef50_UPI0000DD7E8B Cluster: PREDICTED: similar to ARP3 actin...    56   5e-07
UniRef50_Q5CKL2 Cluster: BRG1/brm-associated factor 53A; n=2; Cr...    56   5e-07
UniRef50_Q5C683 Cluster: SJCHGC08418 protein; n=1; Schistosoma j...    56   7e-07
UniRef50_Q293V2 Cluster: Actin-related protein 5; n=2; Drosophil...    56   7e-07
UniRef50_Q0V0G6 Cluster: Putative uncharacterized protein; n=1; ...    55   1e-06
UniRef50_Q6C0A9 Cluster: Yarrowia lipolytica chromosome F of str...    55   2e-06
UniRef50_Q54KZ7 Cluster: Putative uncharacterized protein; n=1; ...    54   2e-06
UniRef50_Q383R8 Cluster: Actin-like protein, putative; n=4; Tryp...    54   2e-06
UniRef50_UPI0000E80C06 Cluster: PREDICTED: hypothetical protein;...    54   3e-06
UniRef50_UPI0000E4A0BF Cluster: PREDICTED: similar to Actin-rela...    54   4e-06
UniRef50_Q5C3R3 Cluster: SJCHGC08022 protein; n=1; Schistosoma j...    54   4e-06
UniRef50_Q4QF49 Cluster: Actin-like protein, putative; n=2; Leis...    53   5e-06
UniRef50_Q09849 Cluster: Uncharacterized protein C23D3.09; n=1; ...    53   5e-06
UniRef50_P53946 Cluster: Actin-related protein 5; n=7; Saccharom...    53   5e-06
UniRef50_UPI0000498A93 Cluster: actin; n=1; Entamoeba histolytic...    52   1e-05
UniRef50_Q8ILM5 Cluster: Actin, putative; n=1; Plasmodium falcip...    52   1e-05
UniRef50_UPI00004987CF Cluster: actin; n=2; Entamoeba histolytic...    52   2e-05
UniRef50_Q00UL2 Cluster: Alpha amylase 1; n=3; Ostreococcus|Rep:...    52   2e-05
UniRef50_A2EUM6 Cluster: Actin family protein; n=1; Trichomonas ...    51   3e-05
UniRef50_P80428 Cluster: Actin-related protein 4; n=4; Saccharom...    51   3e-05
UniRef50_UPI00006CBDF1 Cluster: Actin family protein; n=1; Tetra...    50   3e-05
UniRef50_UPI0000EBF019 Cluster: PREDICTED: similar to ribosomal ...    50   6e-05
UniRef50_Q18PR4 Cluster: Actin-related protein; n=1; Porphyra ye...    50   6e-05
UniRef50_Q23FF9 Cluster: Actin family protein; n=2; Tetrahymena ...    49   8e-05
UniRef50_Q19R52 Cluster: ALP5; n=6; Trypanosomatidae|Rep: ALP5 -...    49   8e-05
UniRef50_Q6CSB9 Cluster: Actin-related protein 4; n=1; Kluyverom...    49   8e-05
UniRef50_Q9LHH0 Cluster: Actin-like protein; n=11; Magnoliophyta...    49   1e-04
UniRef50_Q4YVG6 Cluster: Actin, putative; n=7; Plasmodium|Rep: A...    48   1e-04
UniRef50_A0D9D5 Cluster: Chromosome undetermined scaffold_42, wh...    48   2e-04
UniRef50_Q7SXV8 Cluster: ARP5 actin-related protein 5 homolog; n...    47   3e-04
UniRef50_Q54E71 Cluster: Putative uncharacterized protein; n=1; ...    47   3e-04
UniRef50_Q2H0E9 Cluster: Putative uncharacterized protein; n=1; ...    47   3e-04
UniRef50_Q12406 Cluster: Actin-related protein 7; n=2; Saccharom...    47   3e-04
UniRef50_Q6BIA3 Cluster: CA5059|IPF3691 Candida albicans IPF3691...    47   4e-04
UniRef50_Q4P4D4 Cluster: Putative uncharacterized protein; n=1; ...    47   4e-04
UniRef50_A3M088 Cluster: Vacuolar targeting, actin-related prote...    47   4e-04
UniRef50_Q9H9F9 Cluster: Actin-related protein 5; n=19; Euteleos...    47   4e-04
UniRef50_A6RD74 Cluster: Putative uncharacterized protein; n=1; ...    46   6e-04
UniRef50_A1CCH7 Cluster: Chromatin remodeling complex subunit (A...    46   6e-04
UniRef50_Q17GZ9 Cluster: Actin-related protein 5; n=4; Endoptery...    46   6e-04
UniRef50_Q6CF37 Cluster: Similar to sp|P53946 Saccharomyces cere...    46   7e-04
UniRef50_A7EG89 Cluster: Putative uncharacterized protein; n=2; ...    46   7e-04
UniRef50_Q6C982 Cluster: Actin-like protein ARP6; n=1; Yarrowia ...    46   7e-04
UniRef50_Q7S6X6 Cluster: Actin-like protein arp-6; n=5; Pezizomy...    46   7e-04
UniRef50_Q7QA11 Cluster: ENSANGP00000003921; n=1; Anopheles gamb...    45   0.002
UniRef50_Q7SHR0 Cluster: Actin-related protein 4; n=16; Pezizomy...    45   0.002
UniRef50_Q9UTQ7 Cluster: SWI/SNF and RSC complex subunit Arp9; n...    44   0.002
UniRef50_A4S826 Cluster: Predicted protein; n=1; Ostreococcus lu...    44   0.004
UniRef50_Q6FMT7 Cluster: Similar to sp|Q12406 Saccharomyces cere...    43   0.005
UniRef50_Q0UJ41 Cluster: Putative uncharacterized protein; n=1; ...    43   0.005
UniRef50_Q5KAQ4 Cluster: Actin-like protein ARP6; n=1; Filobasid...    43   0.005
UniRef50_A6R1X8 Cluster: Putative uncharacterized protein; n=1; ...    43   0.007
UniRef50_Q3M0X0 Cluster: Actin6-2; n=3; Paramecium tetraurelia|R...    42   0.012
UniRef50_Q7M3Y5 Cluster: Actin; n=1; Aplysia californica|Rep: Ac...    42   0.016
UniRef50_A4RLB1 Cluster: Putative uncharacterized protein; n=1; ...    41   0.021
UniRef50_Q10CH7 Cluster: Actin-related protein 7, putative, expr...    40   0.037
UniRef50_Q5AXH1 Cluster: Actin-like protein arp6; n=5; Trichocom...    40   0.037
UniRef50_UPI0000498FDF Cluster: actin; n=1; Entamoeba histolytic...    40   0.049
UniRef50_A7TST0 Cluster: Putative uncharacterized protein; n=1; ...    40   0.049
UniRef50_Q9GZN1 Cluster: Actin-related protein 6; n=26; Chordata...    40   0.049
UniRef50_A4S172 Cluster: Predicted protein; n=3; Ostreococcus|Re...    40   0.065
UniRef50_Q0IFH2 Cluster: Actin; n=4; Endopterygota|Rep: Actin - ...    40   0.065
UniRef50_Q0H7S7 Cluster: Actin; n=29; Sordariomycetes|Rep: Actin...    40   0.065
UniRef50_A7TM96 Cluster: Putative uncharacterized protein; n=1; ...    40   0.065
UniRef50_Q6BXN0 Cluster: Actin-related protein 4; n=7; Saccharom...    40   0.065
UniRef50_Q5CWA5 Cluster: Actin; n=2; Cryptosporidium|Rep: Actin ...    39   0.086
UniRef50_A1C924 Cluster: Actin family protein; n=4; Eurotiomycet...    39   0.086
UniRef50_Q963K1 Cluster: Actin-3; n=1; Cercomonas sp. ATCC 50318...    39   0.11 
UniRef50_Q4UGT7 Cluster: Actin-related protein, putative; n=2; T...    39   0.11 
UniRef50_A7AWQ4 Cluster: Actin, putative; n=1; Babesia bovis|Rep...    39   0.11 
UniRef50_A3FQH9 Cluster: Actin-like protein, putative; n=2; Cryp...    39   0.11 
UniRef50_Q4WA13 Cluster: Chromatin remodeling complex subunit (A...    39   0.11 
UniRef50_Q9NZ32 Cluster: Actin-related protein 10; n=40; Eumetaz...    39   0.11 
UniRef50_A6RD01 Cluster: Putative uncharacterized protein; n=1; ...    38   0.15 
UniRef50_UPI00006CC3F4 Cluster: Actin family protein; n=1; Tetra...    38   0.20 
UniRef50_A3FQE6 Cluster: Putative uncharacterized protein; n=2; ...    38   0.26 
UniRef50_Q5K9I3 Cluster: Protein-vacuolar targeting-related prot...    38   0.26 
UniRef50_P45890 Cluster: Actin-like protein 13E; n=8; Eumetazoa|...    38   0.26 
UniRef50_Q4UIK3 Cluster: Actin, putative; n=2; Theileria|Rep: Ac...    37   0.35 
UniRef50_Q09443 Cluster: Actin-like protein C08B11.6; n=2; Caeno...    37   0.35 
UniRef50_Q6SQL6 Cluster: Actin; n=1; Pandalus platyceros|Rep: Ac...    36   0.61 
UniRef50_Q75BT7 Cluster: ACR184Cp; n=1; Eremothecium gossypii|Re...    36   0.80 
UniRef50_Q4UF64 Cluster: Actin-related protein, putative; n=2; T...    35   1.4  
UniRef50_A7AQU0 Cluster: Actin-related, putative; n=1; Babesia b...    35   1.4  
UniRef50_Q9P708 Cluster: Putative uncharacterized protein 13E11....    35   1.4  
UniRef50_Q8I450 Cluster: Actin-related protein, putative; n=5; P...    35   1.9  
UniRef50_UPI00015B5EE4 Cluster: PREDICTED: similar to Actin-rela...    34   2.4  
UniRef50_Q7RR61 Cluster: Actin-like 6; n=3; Plasmodium (Vinckeia...    34   2.4  
UniRef50_Q2H309 Cluster: Putative uncharacterized protein; n=1; ...    34   2.4  
UniRef50_Q47QE0 Cluster: Probable amino-acid transmembrane lipop...    34   3.2  
UniRef50_A0UKU0 Cluster: FAD dependent oxidoreductase; n=5; Burk...    34   3.2  
UniRef50_UPI0000E477BD Cluster: PREDICTED: similar to uncharacte...    33   4.3  
UniRef50_Q4UAS1 Cluster: Theileria-specific sub-telomeric protei...    33   4.3  
UniRef50_A5KAY0 Cluster: Actin-related protein, putative; n=1; P...    33   4.3  
UniRef50_Q4PFM4 Cluster: Putative uncharacterized protein; n=2; ...    33   4.3  
UniRef50_Q4P820 Cluster: Putative uncharacterized protein; n=1; ...    33   4.3  
UniRef50_A7EFN6 Cluster: Putative uncharacterized protein; n=1; ...    33   4.3  
UniRef50_UPI0000E254E7 Cluster: PREDICTED: similar to putative c...    33   5.7  
UniRef50_A6CGF0 Cluster: Cation efflux system protein, AcrB/AcrD...    33   5.7  
UniRef50_A0VEX0 Cluster: Glycosyl transferase, family 39; n=1; D...    33   5.7  
UniRef50_Q8SRZ3 Cluster: ACTIN-RELATED PROTEIN; n=1; Encephalito...    33   5.7  
UniRef50_A5E5Q2 Cluster: Putative uncharacterized protein; n=1; ...    33   5.7  
UniRef50_UPI0000D56D2E Cluster: PREDICTED: hypothetical protein;...    33   7.5  
UniRef50_A4G6E1 Cluster: Putative uncharacterized protein; n=1; ...    33   7.5  
UniRef50_UPI0000DA243C Cluster: PREDICTED: similar to codanin 1;...    32   9.9  
UniRef50_UPI000061673C Cluster: Thrombospondin repeat containing...    32   9.9  
UniRef50_Q8AXX1 Cluster: Putative gag protein; n=1; Danio rerio|...    32   9.9  
UniRef50_Q910X7 Cluster: Capsid protein; n=3; Human astrovirus|R...    32   9.9  
UniRef50_Q1NK22 Cluster: Electron-transferring-flavoprotein dehy...    32   9.9  
UniRef50_A4FI13 Cluster: Integral membrane protein; n=1; Sacchar...    32   9.9  
UniRef50_A3N9F3 Cluster: Putative uncharacterized protein; n=7; ...    32   9.9  
UniRef50_Q5CWZ9 Cluster: Putative uncharacterized protein; n=3; ...    32   9.9  
UniRef50_Q5BXM4 Cluster: SJCHGC05761 protein; n=1; Schistosoma j...    32   9.9  
UniRef50_Q4D7T4 Cluster: Putative uncharacterized protein; n=2; ...    32   9.9  
UniRef50_Q2PE20 Cluster: CG10067-PB, isoform B; n=1; Drosophila ...    32   9.9  
UniRef50_Q7S8X5 Cluster: Putative uncharacterized protein NCU088...    32   9.9  
UniRef50_Q0W6D4 Cluster: Putative uncharacterized protein; n=1; ...    32   9.9  
UniRef50_Q9C073 Cluster: Protein FAM117A; n=17; Amniota|Rep: Pro...    32   9.9  
UniRef50_Q6BML9 Cluster: Actin-like protein ARP6; n=3; Saccharom...    32   9.9  

>UniRef50_Q96483 Cluster: Actin-51; n=584; Eukaryota|Rep: Actin-51 -
           Solanum lycopersicum (Tomato) (Lycopersicon esculentum)
          Length = 336

 Score =  190 bits (464), Expect = 2e-47
 Identities = 91/112 (81%), Positives = 94/112 (83%)
 Frame = +3

Query: 252 QRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 431
           +RGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT
Sbjct: 43  KRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 102

Query: 432 QIMFETFNTPAMYVAIQAVLSLYASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           QIMFETFN PAMYVAIQAVLSLYASG        S    S   P  +GYALP
Sbjct: 103 QIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALP 154



 Score = 88.2 bits (209), Expect = 1e-16
 Identities = 40/43 (93%), Positives = 41/43 (95%)
 Frame = +1

Query: 127 AGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 255
           AGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKD+Y GDEAQSK
Sbjct: 1   AGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYDGDEAQSK 43


>UniRef50_O65314 Cluster: Actin; n=20; Eukaryota|Rep: Actin -
           Scherffelia dubia
          Length = 378

 Score =  190 bits (463), Expect = 2e-47
 Identities = 90/112 (80%), Positives = 94/112 (83%)
 Frame = +3

Query: 252 QRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 431
           +RGILTLKYPIEHG+V+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT
Sbjct: 64  KRGILTLKYPIEHGVVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 123

Query: 432 QIMFETFNTPAMYVAIQAVLSLYASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           QIMFETFN PAMYVAIQAVLSLYASG        S    S   P  +GYALP
Sbjct: 124 QIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALP 175



 Score =  118 bits (284), Expect = 1e-25
 Identities = 55/60 (91%), Positives = 57/60 (95%)
 Frame = +1

Query: 76  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 255
           D EV+ALV DNGSGM KAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKD+YVGDEAQSK
Sbjct: 5   DGEVSALVCDNGSGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDEAQSK 64


>UniRef50_Q4JSC0 Cluster: Actin; n=13; Coelomata|Rep: Actin -
           Anopheles gambiae (African malaria mosquito)
          Length = 376

 Score =  186 bits (452), Expect = 5e-46
 Identities = 88/112 (78%), Positives = 93/112 (83%)
 Frame = +3

Query: 252 QRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 431
           +RGILTLKYPIEHGI+TNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPK+NREKMT
Sbjct: 62  KRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKSNREKMT 121

Query: 432 QIMFETFNTPAMYVAIQAVLSLYASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           QIMFETF  PA+YVAIQAVLSLYASG        S    S   P  +GYALP
Sbjct: 122 QIMFETFAAPAVYVAIQAVLSLYASGRTTGVVLDSGDGVSHTVPIYEGYALP 173



 Score =  126 bits (304), Expect = 4e-28
 Identities = 56/62 (90%), Positives = 59/62 (95%)
 Frame = +1

Query: 70  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 249
           MCD++  ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMG KD+YVGDEAQ
Sbjct: 1   MCDDDAGALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGNKDAYVGDEAQ 60

Query: 250 SK 255
           SK
Sbjct: 61  SK 62


>UniRef50_P14883 Cluster: Actin-2; n=75; Eukaryota|Rep: Actin-2 -
           Plasmodium falciparum
          Length = 376

 Score =  184 bits (448), Expect = 2e-45
 Identities = 86/112 (76%), Positives = 92/112 (82%)
 Frame = +3

Query: 252 QRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 431
           +RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRV+PEEHPVLLTEAPLNPK NREKMT
Sbjct: 61  KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVSPEEHPVLLTEAPLNPKTNREKMT 120

Query: 432 QIMFETFNTPAMYVAIQAVLSLYASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           QIMFETF+ PAMYV+IQA+LSLYASG        S    S   P  +GY LP
Sbjct: 121 QIMFETFDVPAMYVSIQAILSLYASGRTTGIVLDSGDGVSHTVPIYEGYVLP 172



 Score = 94.7 bits (225), Expect = 2e-18
 Identities = 42/59 (71%), Positives = 49/59 (83%)
 Frame = +1

Query: 79  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 255
           EE  ALVVDNGSGM K+G AGDDAP+ VFPSIVGRP+   +M+GM QK+ YVGDEAQ+K
Sbjct: 3   EEAVALVVDNGSGMVKSGLAGDDAPKCVFPSIVGRPKMPNIMIGMEQKECYVGDEAQNK 61


>UniRef50_P02581 Cluster: Actin-1; n=1852; Eukaryota|Rep: Actin-1 -
           Glycine max (Soybean)
          Length = 377

 Score =  174 bits (424), Expect = 1e-42
 Identities = 83/112 (74%), Positives = 89/112 (79%)
 Frame = +3

Query: 252 QRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 431
           QRGILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPK NREKM 
Sbjct: 63  QRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKYNREKMX 122

Query: 432 QIMFETFNTPAMYVAIQAVLSLYASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           ++MFETF  PA+ VA+ AVLSLYASG        S    S   P  +GYALP
Sbjct: 123 RVMFETFGAPAVCVAVLAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALP 174



 Score =  100 bits (239), Expect = 3e-20
 Identities = 45/57 (78%), Positives = 50/57 (87%)
 Frame = +1

Query: 79  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 249
           E++  LV DNG+GM KAG AGDDAPRAVFPSIVGRPRH  V+VGMGQKD+YVGDEAQ
Sbjct: 5   EDIQPLVCDNGTGMVKAGLAGDDAPRAVFPSIVGRPRHTXVVVGMGQKDAYVGDEAQ 61


>UniRef50_Q0VHZ5 Cluster: Actin deviating protein; n=7;
           Eukaryota|Rep: Actin deviating protein - Bolivina sp.
           isolate 615
          Length = 360

 Score =  155 bits (377), Expect = 6e-37
 Identities = 71/112 (63%), Positives = 86/112 (76%)
 Frame = +3

Query: 252 QRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 431
           +RGIL+L++PI HGI T+WDD+E+IW HTFY ELR+ PEEHP+L+TE PLNPKANR+KMT
Sbjct: 39  KRGILSLRWPIVHGISTSWDDVEEIWRHTFYQELRIQPEEHPILMTEPPLNPKANRQKMT 98

Query: 432 QIMFETFNTPAMYVAIQAVLSLYASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           QIMFETFNTPA Y AIQ+VLSLYASG        S    +   P  +G+ LP
Sbjct: 99  QIMFETFNTPAFYTAIQSVLSLYASGRTTGIVVDSGYDVTYTVPVYEGHCLP 150



 Score = 68.5 bits (160), Expect = 1e-10
 Identities = 31/39 (79%), Positives = 33/39 (84%)
 Frame = +1

Query: 139 GDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 255
           GDDAPRAVFP+I GR R  GVMVGM QK+ YVGDEAQSK
Sbjct: 1   GDDAPRAVFPAITGRRRRNGVMVGMAQKNCYVGDEAQSK 39


>UniRef50_Q7XB26 Cluster: Ubiquitin/actin fusion protein 4; n=1;
           Bigelowiella natans|Rep: Ubiquitin/actin fusion protein
           4 - Bigelowiella natans (Pedinomonas minutissima)
           (Chlorarachnion sp.(strain CCMP 621))
          Length = 234

 Score =  146 bits (353), Expect = 5e-34
 Identities = 66/86 (76%), Positives = 73/86 (84%)
 Frame = +3

Query: 252 QRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 431
           +RG+L  KY IEHGIVT+WD M KIW HTF NEL+VAPEEHPVLLTE PLNPKANREK  
Sbjct: 133 KRGVLINKYAIEHGIVTDWDAMLKIWDHTFLNELKVAPEEHPVLLTEPPLNPKANREKTI 192

Query: 432 QIMFETFNTPAMYVAIQAVLSLYASG 509
           ++MFETF TPA Y+AIQA LSLYASG
Sbjct: 193 KVMFETFKTPATYIAIQAALSLYASG 218



 Score = 60.5 bits (140), Expect = 3e-08
 Identities = 30/53 (56%), Positives = 35/53 (66%)
 Frame = +1

Query: 79  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVG 237
           EE   LVVDNGS M KAGFAGD APR  FPS+   PR +  M   G++D Y+G
Sbjct: 78  EECQPLVVDNGSDMIKAGFAGDGAPRTAFPSVFKVPRVRNTMT--GKQDVYIG 128


>UniRef50_A5E2K2 Cluster: Actin; n=5; Saccharomycetales|Rep: Actin -
           Lodderomyces elongisporus (Yeast) (Saccharomyces
           elongisporus)
          Length = 417

 Score =  146 bits (353), Expect = 5e-34
 Identities = 65/114 (57%), Positives = 82/114 (71%)
 Frame = +3

Query: 249 EQRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKM 428
           + RG+L L YP+EHGIVT W DME IW H F  +L++ PE+HP+L+TEAPLNP++NREKM
Sbjct: 73  KNRGLLRLNYPVEHGIVTKWSDMEIIWDHMFTQDLKIKPEDHPLLITEAPLNPRSNREKM 132

Query: 429 TQIMFETFNTPAMYVAIQAVLSLYASGVPPVSCWTSATVSSTPCPFTKGYALPP 590
            Q+MFE FN P MY++IQAVL+LYASG        S    S   P  +G+ALPP
Sbjct: 133 CQVMFEQFNVPCMYISIQAVLALYASGRTTGVVVDSGDGVSHIVPVYEGFALPP 186



 Score = 52.0 bits (119), Expect = 1e-05
 Identities = 22/39 (56%), Positives = 29/39 (74%)
 Frame = +1

Query: 94  LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVG 210
           +VVDNG G  KAGFAG++ PR    SI+GRP++Q +M G
Sbjct: 10  VVVDNGLGTLKAGFAGEEKPRTYASSIIGRPKYQKLMAG 48



 Score = 39.9 bits (89), Expect = 0.049
 Identities = 16/28 (57%), Positives = 20/28 (71%)
 Frame = +2

Query: 509 RTTGIVLDFGDGVFHTVPIYERIRTSPT 592
           RTTG+V+D GDGV H VP+YE     P+
Sbjct: 160 RTTGVVVDSGDGVSHIVPVYEGFALPPS 187


>UniRef50_A2DKQ5 Cluster: Actin 58, putative; n=2; Trichomonas
           vaginalis G3|Rep: Actin 58, putative - Trichomonas
           vaginalis G3
          Length = 373

 Score =  136 bits (328), Expect = 5e-31
 Identities = 58/113 (51%), Positives = 78/113 (69%)
 Frame = +3

Query: 249 EQRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKM 428
           ++  +L L+ PIE+G ++NWDD+EKIWHHTFYNEL VAPEEHPV+L E P++P+ NREK 
Sbjct: 58  QKSDLLVLRQPIENGTISNWDDIEKIWHHTFYNELLVAPEEHPVILAEKPMSPRMNREKK 117

Query: 429 TQIMFETFNTPAMYVAIQAVLSLYASGVPPVSCWTSATVSSTPCPFTKGYALP 587
            Q+MFETFN    Y+ +QAVL+L++ G      W +    S   P  + Y LP
Sbjct: 118 IQMMFETFNVSGFYLGMQAVLALFSIGCTTGVVWDAGEGVSFTVPIYEAYGLP 170



 Score = 66.1 bits (154), Expect = 7e-10
 Identities = 29/54 (53%), Positives = 40/54 (74%)
 Frame = +1

Query: 94  LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 255
           +V+DNG+G+ KAGFAG +AP++VFP+I+G P+    MVG   KD +VG EA  K
Sbjct: 6   IVIDNGTGLTKAGFAGAEAPKSVFPTIIGSPKSNMQMVGGQNKDFFVGFEAVQK 59


>UniRef50_UPI000065FC19 Cluster: Homolog of Homo sapiens "Actin,
           cytoplasmic 2; n=1; Takifugu rubripes|Rep: Homolog of
           Homo sapiens "Actin, cytoplasmic 2 - Takifugu rubripes
          Length = 396

 Score =  134 bits (325), Expect = 1e-30
 Identities = 64/111 (57%), Positives = 79/111 (71%)
 Frame = +3

Query: 255 RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQ 434
           RG+L LK+PI++GI+ NWD+MEKIWHHTF  ++RV PE+HPVLLTEA +NP  NR +M +
Sbjct: 56  RGVLALKHPIKNGIIQNWDEMEKIWHHTFL-QMRVDPEDHPVLLTEAAMNPLENRRRMVE 114

Query: 435 IMFETFNTPAMYVAIQAVLSLYASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           IMFE FN P  YVA+QAVLSLYASG      + S    S   P   G+ LP
Sbjct: 115 IMFECFNVPFTYVAMQAVLSLYASGRSTGVVFDSGDGVSHSVPVFDGHYLP 165



 Score = 65.7 bits (153), Expect = 9e-10
 Identities = 25/52 (48%), Positives = 39/52 (75%)
 Frame = +1

Query: 94  LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 249
           +V+D GSG  KAGFA +D P  VFP+I+G P+++ +M G  ++++Y+G EAQ
Sbjct: 2   IVLDTGSGFMKAGFADEDLPNVVFPTIIGMPKYEEIMNGRAERETYIGHEAQ 53


>UniRef50_Q2GY63 Cluster: Putative uncharacterized protein; n=1;
           Chaetomium globosum|Rep: Putative uncharacterized
           protein - Chaetomium globosum (Soil fungus)
          Length = 350

 Score =  132 bits (319), Expect = 7e-30
 Identities = 57/87 (65%), Positives = 73/87 (83%)
 Frame = +3

Query: 249 EQRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKM 428
           E RG+L ++YP+EHGIVT+WDDMEKIW H  Y+EL+   E+HP+LLTE PLNP++NR+  
Sbjct: 63  ELRGLLKIRYPLEHGIVTDWDDMEKIWSHV-YSELKCDAEQHPLLLTEPPLNPRSNRDTA 121

Query: 429 TQIMFETFNTPAMYVAIQAVLSLYASG 509
            QI+FETFN PA++ +IQAVLSLYASG
Sbjct: 122 AQILFETFNVPALHTSIQAVLSLYASG 148



 Score = 56.8 bits (131), Expect = 4e-07
 Identities = 24/55 (43%), Positives = 39/55 (70%)
 Frame = +1

Query: 91  ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 255
           A+V+DNGSG  +AG++G+  P+  FPS VGRP+H  V+ G  + + +VG +A ++
Sbjct: 9   AVVLDNGSGNIRAGYSGESEPKVNFPSWVGRPKHLRVLAGALEGEVFVGKKAAAE 63



 Score = 39.5 bits (88), Expect = 0.065
 Identities = 15/21 (71%), Positives = 18/21 (85%)
 Frame = +2

Query: 509 RTTGIVLDFGDGVFHTVPIYE 571
           RTTG+VLD GDGV H VP+Y+
Sbjct: 149 RTTGVVLDVGDGVSHAVPVYQ 169


>UniRef50_UPI0000F2D825 Cluster: PREDICTED: similar to actin; n=1;
           Monodelphis domestica|Rep: PREDICTED: similar to actin -
           Monodelphis domestica
          Length = 416

 Score =  132 bits (318), Expect = 9e-30
 Identities = 54/82 (65%), Positives = 69/82 (84%)
 Frame = +3

Query: 264 LTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMF 443
           L +KYPIEHGI+ NWDDMEKIWHH+FYN L V PE+HP+L+TE    PKAN+EK+ ++MF
Sbjct: 109 LLVKYPIEHGIIVNWDDMEKIWHHSFYNVLHVDPEKHPLLVTEHLFTPKANKEKLIEVMF 168

Query: 444 ETFNTPAMYVAIQAVLSLYASG 509
           E+F  PA+YVAIQ +LSL++SG
Sbjct: 169 ESFRVPALYVAIQDILSLFSSG 190



 Score = 50.8 bits (116), Expect = 3e-05
 Identities = 22/58 (37%), Positives = 34/58 (58%)
 Frame = +1

Query: 82  EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 255
           E   ++ D GS   K G+ G+ +PR VFPS +G  R Q +  GM  +D+++G+E   K
Sbjct: 48  ESLPVIFDGGSRYFKVGYGGEYSPRFVFPSAIGHYRWQNIKSGMDLRDTFIGNEVIEK 105


>UniRef50_A4QNT8 Cluster: Si:ch211-241j12.3 protein; n=3; Danio
           rerio|Rep: Si:ch211-241j12.3 protein - Danio rerio
           (Zebrafish) (Brachydanio rerio)
          Length = 389

 Score =  129 bits (311), Expect = 6e-29
 Identities = 60/111 (54%), Positives = 76/111 (68%)
 Frame = +3

Query: 255 RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQ 434
           RG+LTL+YPI HG+V+NWD+ME +W H F   L  APE+HPVLLTEA LNP  NR++M +
Sbjct: 79  RGVLTLRYPIRHGVVSNWDEMEMLWTHAF-QLLSAAPEDHPVLLTEAALNPLQNRQRMVE 137

Query: 435 IMFETFNTPAMYVAIQAVLSLYASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           +MFE F+ P  +VA+QAVL+LYASG        S    S   P  +GY LP
Sbjct: 138 LMFEAFSVPLTFVAVQAVLALYASGRTTGVVLDSGDGVSHSVPVFEGYCLP 188



 Score = 63.3 bits (147), Expect = 5e-09
 Identities = 26/52 (50%), Positives = 39/52 (75%)
 Frame = +1

Query: 94  LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 249
           +V+D+GSG+ KAGFA  D P AVFP+++GRP+++ VM     ++ YVG +AQ
Sbjct: 25  IVLDSGSGLMKAGFADQDLPAAVFPTVIGRPKYEEVMNSCVDRELYVGHDAQ 76


>UniRef50_P61163 Cluster: Alpha-centractin; n=356; root|Rep:
           Alpha-centractin - Homo sapiens (Human)
          Length = 376

 Score =  129 bits (311), Expect = 6e-29
 Identities = 58/119 (48%), Positives = 86/119 (72%), Gaps = 1/119 (0%)
 Frame = +3

Query: 249 EQRGILTLKYPIEHGIVTNWDDMEKIWHHTFY-NELRVAPEEHPVLLTEAPLNPKANREK 425
           E RG+L+++YP+EHGIV +W+DME+IW + +  ++L+   EEHPVLLTEAPLNP+ NRE+
Sbjct: 64  EHRGLLSIRYPMEHGIVKDWNDMERIWQYVYSKDQLQTFSEEHPVLLTEAPLNPRKNRER 123

Query: 426 MTQIMFETFNTPAMYVAIQAVLSLYASGVPPVSCWTSATVSSTPCPFTKGYALPPRHSL 602
             ++ FETFN PA+++++QAVLSLYA+G        S    +   P  +G+A+P  HS+
Sbjct: 124 AAEVFFETFNVPALFISMQAVLSLYATGRTTGVVLDSGDGVTHAVPIYEGFAMP--HSI 180



 Score = 64.9 bits (151), Expect = 2e-09
 Identities = 27/52 (51%), Positives = 38/52 (73%)
 Frame = +1

Query: 94  LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 249
           +V+DNGSG+ KAGFAGD  P+  FP+ VGRP+H  VM G  + D ++G +A+
Sbjct: 12  VVIDNGSGVIKAGFAGDQIPKYCFPNYVGRPKHVRVMAGALEGDIFIGPKAE 63


>UniRef50_Q0VHZ6 Cluster: Actin deviating protein; n=2; Bolivina sp.
           isolate 615|Rep: Actin deviating protein - Bolivina sp.
           isolate 615
          Length = 387

 Score =  128 bits (310), Expect = 8e-29
 Identities = 54/86 (62%), Positives = 69/86 (80%)
 Frame = +3

Query: 252 QRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 431
           +RGIL L +P++ G+V NWDDMEKIWHHT Y+ELRV PEEHP+L+T+ P   K +REKM 
Sbjct: 39  KRGILKLMHPMQRGVVKNWDDMEKIWHHTLYHELRVQPEEHPILMTDTPFASKMDREKMA 98

Query: 432 QIMFETFNTPAMYVAIQAVLSLYASG 509
           QIMFETF+TP  YV + ++L+L ASG
Sbjct: 99  QIMFETFDTPKFYVTLGSLLALNASG 124



 Score = 62.9 bits (146), Expect = 6e-09
 Identities = 28/39 (71%), Positives = 32/39 (82%)
 Frame = +1

Query: 139 GDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 255
           G DAPRAVFP+IVG  +H+G+ VGM QK  YVGDEAQSK
Sbjct: 1   GVDAPRAVFPTIVGTLKHRGIFVGMAQKSYYVGDEAQSK 39


>UniRef50_UPI0000F2D326 Cluster: PREDICTED: similar to actin; n=1;
           Monodelphis domestica|Rep: PREDICTED: similar to actin -
           Monodelphis domestica
          Length = 378

 Score =  126 bits (304), Expect = 4e-28
 Identities = 52/87 (59%), Positives = 69/87 (79%)
 Frame = +3

Query: 249 EQRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKM 428
           + R ILTL +P++HG+VT+WDDMEKIW H + + LR  P++ PVLLTEAPLNP  NR KM
Sbjct: 64  DNRSILTLNHPMQHGVVTSWDDMEKIWEHLYKDGLRETPKQRPVLLTEAPLNPPENRAKM 123

Query: 429 TQIMFETFNTPAMYVAIQAVLSLYASG 509
            +I FETF  PA+YVA+Q +++LYA+G
Sbjct: 124 VEIFFETFQVPALYVALQGLMALYATG 150



 Score = 52.8 bits (121), Expect = 7e-06
 Identities = 22/56 (39%), Positives = 34/56 (60%)
 Frame = +1

Query: 82  EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 249
           ++ + + DNGSG+CK G +G+  PR +  +++G P+    M    QK  YVG EAQ
Sbjct: 8   KIPSAIFDNGSGLCKVGISGEQNPRFIQATVLGYPQSINSMANTWQKAYYVGQEAQ 63


>UniRef50_UPI00001E426E Cluster: PREDICTED: similar to actin-12;
           n=11; Eutheria|Rep: PREDICTED: similar to actin-12 - Mus
           musculus
          Length = 372

 Score =  124 bits (299), Expect = 2e-27
 Identities = 56/107 (52%), Positives = 74/107 (69%)
 Frame = +3

Query: 264 LTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMF 443
           L + YPI  G +TNWD++EKIWH++FY+ L++APE+HP+L+TEAPL  K  + +MTQI+F
Sbjct: 63  LNMYYPISRGAITNWDNVEKIWHYSFYHSLQIAPEQHPILITEAPLTSKEAKSRMTQILF 122

Query: 444 ETFNTPAMYVAIQAVLSLYASGVPPVSCWTSATVSSTPCPFTKGYAL 584
           ETFN PA+Y A QAVLSL ASG    +   S    +   P   GY L
Sbjct: 123 ETFNFPALYTANQAVLSLIASGRTSGTAIESGDGMTYFVPVMNGYPL 169



 Score = 64.5 bits (150), Expect = 2e-09
 Identities = 27/57 (47%), Positives = 40/57 (70%)
 Frame = +1

Query: 82  EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQS 252
           E   LV D GSG  K GF+G  AP+AVFP+I+G+ +H  V+ G+G++D ++G E Q+
Sbjct: 2   EKTPLVCDYGSGFSKVGFSGTQAPQAVFPTILGKMKHTNVLEGLGEQDWFIGAETQT 58


>UniRef50_UPI0000605B09 Cluster: PREDICTED: similar to actin alpha 1
           skeletal muscle protein; n=1; Mus musculus|Rep:
           PREDICTED: similar to actin alpha 1 skeletal muscle
           protein - Mus musculus
          Length = 255

 Score =  123 bits (296), Expect = 4e-27
 Identities = 51/82 (62%), Positives = 67/82 (81%)
 Frame = +3

Query: 264 LTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMF 443
           L + YPI  G +TNWD++EKIWH++FY+ L++APE+HP+L+TEAPL  K  + +MTQI+F
Sbjct: 63  LNMYYPISRGAITNWDNVEKIWHYSFYHSLQIAPEQHPILITEAPLTSKEAKSRMTQILF 122

Query: 444 ETFNTPAMYVAIQAVLSLYASG 509
           ETFN PA+Y A QAVLSL ASG
Sbjct: 123 ETFNFPALYTANQAVLSLIASG 144



 Score = 64.5 bits (150), Expect = 2e-09
 Identities = 27/57 (47%), Positives = 40/57 (70%)
 Frame = +1

Query: 82  EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQS 252
           E   LV D GSG  K GF+G  AP+AVFP+I+G+ +H  V+ G+G++D ++G E Q+
Sbjct: 2   EKTPLVCDYGSGFSKVGFSGTQAPQAVFPTILGKMKHTNVLEGLGEQDWFIGAETQT 58


>UniRef50_UPI00005A2ACF Cluster: PREDICTED: similar to cytoplasmic
           beta-actin; n=1; Canis lupus familiaris|Rep: PREDICTED:
           similar to cytoplasmic beta-actin - Canis familiaris
          Length = 268

 Score =  122 bits (293), Expect = 9e-27
 Identities = 63/86 (73%), Positives = 67/86 (77%)
 Frame = +3

Query: 258 GILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQI 437
           GILT KY IEHGIV NWDDME I HH FYN+L +APEE  +LLTE PLN KA  E MTQI
Sbjct: 117 GILTFKYCIEHGIVINWDDME-IQHHNFYNKLCMAPEELYILLTEIPLNLKAKGE-MTQI 174

Query: 438 MFETFNTPAMYVAIQAVLSLYASGVP 515
           MFETFNTPAMY+AIQ VL LYA   P
Sbjct: 175 MFETFNTPAMYLAIQTVLFLYAVVTP 200



 Score = 34.7 bits (76), Expect = 1.9
 Identities = 14/19 (73%), Positives = 17/19 (89%)
 Frame = +1

Query: 199 VMVGMGQKDSYVGDEAQSK 255
           +MVGMGQKDSY+ +EAQ K
Sbjct: 97  IMVGMGQKDSYIRNEAQRK 115


>UniRef50_UPI00005864C8 Cluster: PREDICTED: similar to Actin; n=4;
           Strongylocentrotus purpuratus|Rep: PREDICTED: similar to
           Actin - Strongylocentrotus purpuratus
          Length = 383

 Score =  121 bits (291), Expect = 2e-26
 Identities = 62/113 (54%), Positives = 76/113 (67%), Gaps = 1/113 (0%)
 Frame = +3

Query: 249 EQRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKM 428
           + R +L + YPIEHGIV +W+DMEKIWH+ F  +L V   EHPVL+TE P NP  NR+KM
Sbjct: 61  KHREVLGINYPIEHGIVKDWEDMEKIWHYLFDVDLMVDTTEHPVLMTEPPGNPMYNRQKM 120

Query: 429 TQIMFETFNTPAMYVAIQAVLSLYASG-VPPVSCWTSATVSSTPCPFTKGYAL 584
            QIMFETF  PA YVA  A+LSLY+SG V      T A V+ T   + +GY L
Sbjct: 121 AQIMFETFQIPAFYVANPALLSLYSSGRVSGFVIETGAGVTQTLAVY-EGYCL 172



 Score = 47.2 bits (107), Expect = 3e-04
 Identities = 23/55 (41%), Positives = 35/55 (63%)
 Frame = +1

Query: 76  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGD 240
           D+    +VVDNGSG  +AGFAG    RA FPS +GR +   V    G++++++G+
Sbjct: 6   DDGPDPVVVDNGSGTIQAGFAGGKTCRATFPSCIGRSKKSHV---DGKREAFIGE 57


>UniRef50_UPI0000449751 Cluster: PREDICTED: similar to gamma-actin;
           n=3; Amniota|Rep: PREDICTED: similar to gamma-actin -
           Gallus gallus
          Length = 377

 Score =  117 bits (282), Expect = 2e-25
 Identities = 49/84 (58%), Positives = 69/84 (82%)
 Frame = +3

Query: 252 QRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 431
           +RGIL+L YP+E+G+VT+WD+MEKIW + + +EL V P E PVLLTE PLNP ++REKM 
Sbjct: 65  KRGILSLTYPMENGVVTSWDNMEKIWRYLYEHELGVKPSEGPVLLTETPLNPPSHREKMA 124

Query: 432 QIMFETFNTPAMYVAIQAVLSLYA 503
           ++MFE+F  PA+YVA+Q + +L+A
Sbjct: 125 ELMFESFQVPALYVALQGLAALHA 148



 Score = 75.8 bits (178), Expect = 8e-13
 Identities = 33/54 (61%), Positives = 42/54 (77%)
 Frame = +1

Query: 94  LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 255
           +V DNGSG CKAG +G+ APR+V P+IVG P+   VM+GM  +D YVG+EAQSK
Sbjct: 12  VVFDNGSGQCKAGLSGEQAPRSVIPTIVGYPKFTFVMIGMEHRDWYVGEEAQSK 65



 Score = 33.5 bits (73), Expect = 4.3
 Identities = 15/20 (75%), Positives = 17/20 (85%)
 Frame = +2

Query: 509 RTTGIVLDFGDGVFHTVPIY 568
           RTTG+VLD GDGV  TVPI+
Sbjct: 151 RTTGMVLDSGDGVTVTVPIH 170


>UniRef50_Q7M3B0 Cluster: Actin beta; n=1; Sus scrofa domestica|Rep:
           Actin beta - Sus scrofa domestica (domestic pig)
          Length = 195

 Score =  114 bits (275), Expect = 1e-24
 Identities = 59/77 (76%), Positives = 59/77 (76%)
 Frame = +3

Query: 276 YPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN 455
           YPIEHGIVTNWDDMEKIWHHTFYNELRVAPEE                  MTQIMFETFN
Sbjct: 21  YPIEHGIVTNWDDMEKIWHHTFYNELRVAPEE------------------MTQIMFETFN 62

Query: 456 TPAMYVAIQAVLSLYAS 506
           TPAMYVAIQAVLSLYAS
Sbjct: 63  TPAMYVAIQAVLSLYAS 79



 Score = 46.4 bits (105), Expect = 6e-04
 Identities = 20/20 (100%), Positives = 20/20 (100%)
 Frame = +1

Query: 127 AGFAGDDAPRAVFPSIVGRP 186
           AGFAGDDAPRAVFPSIVGRP
Sbjct: 1   AGFAGDDAPRAVFPSIVGRP 20


>UniRef50_Q9XZB9 Cluster: Actin; n=1; Sterkiella nova|Rep: Actin -
           Oxytricha nova
          Length = 374

 Score =  114 bits (275), Expect = 1e-24
 Identities = 49/116 (42%), Positives = 73/116 (62%)
 Frame = +3

Query: 252 QRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 431
           +RG+L   YP++HGI+ +WDDMEK+W+H F  EL+V   EHP L++E+PL P+  RE+  
Sbjct: 60  KRGVLKFSYPVQHGIIKDWDDMEKVWNHLFSYELKVDSSEHPFLISESPLTPEFIREQTV 119

Query: 432 QIMFETFNTPAMYVAIQAVLSLYASGVPPVSCWTSATVSSTPCPFTKGYALPPRHS 599
           Q+MFETFN P++Y+AI A L L++ G            ++   P   G+ +P   S
Sbjct: 120 QMMFETFNVPSLYMAISAALQLHSIGKTTGIVCDIGDSATHAVPVKDGFVIPDTSS 175



 Score = 66.5 bits (155), Expect = 5e-10
 Identities = 26/59 (44%), Positives = 40/59 (67%)
 Frame = +1

Query: 79  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 255
           E    +V+DNGSG  KAGF G+D P  V  ++VGRP++Q  ++G+  KD ++G++A  K
Sbjct: 2   ESSKTIVIDNGSGFVKAGFVGEDGPSVVLRNLVGRPKNQNAIIGVEAKDEFIGEDAYLK 60


>UniRef50_Q4CV94 Cluster: Actin 2, putative; n=2; Trypanosoma
           cruzi|Rep: Actin 2, putative - Trypanosoma cruzi
          Length = 392

 Score =  113 bits (273), Expect = 2e-24
 Identities = 49/78 (62%), Positives = 63/78 (80%)
 Frame = +3

Query: 276 YPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN 455
           YP+EHGIV++WD ME++W H  Y +LRV PE   VLLTEAPLNP +NREKM + +FE+F 
Sbjct: 72  YPMEHGIVSDWDQMERVWRHA-YEQLRVPPERQAVLLTEAPLNPISNREKMAETLFESFG 130

Query: 456 TPAMYVAIQAVLSLYASG 509
            PA++V IQAVL+LY+SG
Sbjct: 131 VPALHVQIQAVLTLYSSG 148



 Score = 54.8 bits (126), Expect = 2e-06
 Identities = 26/56 (46%), Positives = 34/56 (60%)
 Frame = +1

Query: 79  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA 246
           +E  A+V+DNGSG  K GFAG++ PR VFPS+ G   +         +  YVGDEA
Sbjct: 7   DEEPAVVLDNGSGNIKCGFAGEEIPRCVFPSVTGVSMNTRSSGSSSSQRVYVGDEA 62



 Score = 35.5 bits (78), Expect = 1.1
 Identities = 14/21 (66%), Positives = 17/21 (80%)
 Frame = +2

Query: 509 RTTGIVLDFGDGVFHTVPIYE 571
           RT G+VLD GDGV H VP++E
Sbjct: 149 RTDGLVLDSGDGVTHLVPVFE 169


>UniRef50_A2FRF9 Cluster: Actin family protein; n=1; Trichomonas
           vaginalis G3|Rep: Actin family protein - Trichomonas
           vaginalis G3
          Length = 543

 Score =  112 bits (270), Expect = 6e-24
 Identities = 46/109 (42%), Positives = 68/109 (62%)
 Frame = +3

Query: 261 ILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIM 440
           ++ +  PIE+G++ NWDD+EK+WHHT+YNEL V P++HPV++TE     +  REK  Q+ 
Sbjct: 62  LVDISKPIENGVIVNWDDIEKVWHHTYYNELLVVPDQHPVIITEKQCATQHAREKTIQMF 121

Query: 441 FETFNTPAMYVAIQAVLSLYASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           FETFN P  Y  +Q+V +L + G+     W      S+  P  +GY  P
Sbjct: 122 FETFNVPGYYSGVQSVFALLSCGLTTGIVWDGGEGYSSVVPVYEGYQQP 170



 Score = 50.8 bits (116), Expect = 3e-05
 Identities = 22/54 (40%), Positives = 33/54 (61%)
 Frame = +1

Query: 94  LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 255
           +V+D GSG  K GFAG   P+  FP++VG P+    ++G    D +VG+E  +K
Sbjct: 6   VVIDTGSGFTKVGFAGYYEPKVEFPTVVGVPKDSTALIGGKNVDFFVGNEVFTK 59


>UniRef50_Q8MVN5 Cluster: Cardiac actin-like protein; n=1; Boltenia
           villosa|Rep: Cardiac actin-like protein - Boltenia
           villosa
          Length = 137

 Score =  110 bits (265), Expect = 2e-23
 Identities = 53/94 (56%), Positives = 61/94 (64%)
 Frame = +3

Query: 189 PSGRDGRYGTEGLLCRR*GTEQRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPE 368
           PSG  G    + ++  R  +  R I   K P+E  I+TNWD  EKIWHHT  NEL VAPE
Sbjct: 10  PSGVRGGRDRKTVMGYRTQSIGREICLSKIPLERXIITNWDXQEKIWHHTLNNELEVAPE 69

Query: 369 EHPVLLTEAPLNPKANREKMTQIMFETFNTPAMY 470
           EHP L T+A  NPKANREKM Q MFE F+ PAMY
Sbjct: 70  EHPTLFTKAAWNPKANREKMAQXMFEPFSVPAMY 103


>UniRef50_Q5KB93 Cluster: Actin binding protein, putative; n=3;
           Filobasidiella neoformans|Rep: Actin binding protein,
           putative - Cryptococcus neoformans (Filobasidiella
           neoformans)
          Length = 390

 Score =  110 bits (264), Expect = 3e-23
 Identities = 50/113 (44%), Positives = 71/113 (62%)
 Frame = +3

Query: 249 EQRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKM 428
           E R  L + +P+EHG+V NW+DM  +W +TF  ++ + P    +LLTE P+NPKANR+KM
Sbjct: 61  ENRSYLQVTHPMEHGVVKNWEDMRHLWDYTFNEKMHMDPRGKKILLTEPPMNPKANRQKM 120

Query: 429 TQIMFETFNTPAMYVAIQAVLSLYASGVPPVSCWTSATVSSTPCPFTKGYALP 587
            ++MFE +    +YVAIQAVL+LYA G+       S    +   P   G+ALP
Sbjct: 121 CEVMFEEYGFGGVYVAIQAVLTLYAQGLQTGVVVDSGDGVTHIVPVYDGFALP 173



 Score = 52.4 bits (120), Expect = 9e-06
 Identities = 29/53 (54%), Positives = 34/53 (64%), Gaps = 2/53 (3%)
 Frame = +1

Query: 94  LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRP-RHQGVMVGMGQ-KDSYVGDEA 246
           LVVDNG+G  K G+AG + P  VFPSIVGRP       +G  Q KD  +GDEA
Sbjct: 7   LVVDNGTGFVKCGWAGSNFPDYVFPSIVGRPILRAEERLGTSQLKDIMIGDEA 59


>UniRef50_Q24C02 Cluster: Actin family protein; n=3;
           Oligohymenophorea|Rep: Actin family protein -
           Tetrahymena thermophila SB210
          Length = 398

 Score =  109 bits (262), Expect = 5e-23
 Identities = 47/87 (54%), Positives = 68/87 (78%)
 Frame = +3

Query: 249 EQRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKM 428
           EQRG+L L+YPI HGI+ NW+DM+ IW +  Y+EL+V+ +E+PVLLTE  +NP  ++ ++
Sbjct: 65  EQRGLLKLQYPINHGIIQNWNDMDLIWKYC-YSELKVSAKEYPVLLTEPAINPINHKFRV 123

Query: 429 TQIMFETFNTPAMYVAIQAVLSLYASG 509
            Q  FE FN PA+++A+Q VLSL+ASG
Sbjct: 124 AQQFFENFNAPALFIAVQGVLSLFASG 150



 Score = 50.8 bits (116), Expect = 3e-05
 Identities = 21/49 (42%), Positives = 34/49 (69%)
 Frame = +1

Query: 94  LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGD 240
           +V+DNGSG+ +AG AG+D  +  F S +GRP+++ V+    Q D Y+G+
Sbjct: 13  VVIDNGSGIIRAGIAGEDKAKLQFDSYIGRPKYKMVLPTNTQSDYYLGN 61


>UniRef50_Q9DFB8 Cluster: Actin; n=1; Scomberomorus maculatus|Rep:
           Actin - Scomberomorus maculatus (Spanish mackerel)
          Length = 101

 Score =  109 bits (261), Expect = 7e-23
 Identities = 48/76 (63%), Positives = 57/76 (75%)
 Frame = +2

Query: 254 KRYPDPQIPHRTRNRH*LG*HGEDLASYLLQ*AACRPRGTPSPAH*GSPQPQGQQREDDP 433
           KR+PDP++ HR R+ H LG HGEDLA +LLQ AAC PR  P P   G  QP+ QQREDDP
Sbjct: 26  KRHPDPEVSHRARHHHQLGRHGEDLAPHLLQRAACGPRRAPHPGDRGPSQPKSQQREDDP 85

Query: 434 DHVRNIQHARHVRRHP 481
           DHVR++Q  R+VRRHP
Sbjct: 86  DHVRDVQCTRNVRRHP 101


>UniRef50_A7QKV4 Cluster: Chromosome chr8 scaffold_115, whole genome
           shotgun sequence; n=1; Vitis vinifera|Rep: Chromosome
           chr8 scaffold_115, whole genome shotgun sequence - Vitis
           vinifera (Grape)
          Length = 431

 Score =  109 bits (261), Expect = 7e-23
 Identities = 57/102 (55%), Positives = 72/102 (70%), Gaps = 1/102 (0%)
 Frame = +3

Query: 252 QRGILTLKYPIEHGIVTNWDDMEK-IWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKM 428
           ++ +LTLKYP + GIV NWDD  K IWHHTFY EL VAPE H VLLTE  LN K N +KM
Sbjct: 33  KKDMLTLKYPTKSGIVGNWDDKGKTIWHHTFYIELCVAPEAHLVLLTEVLLNLKVNHDKM 92

Query: 429 TQIMFETFNTPAMYVAIQAVLSLYASGVPPVSCWTSATVSST 554
           TQ MFETF+TPA+ V+ Q++L  + +   PV    S ++SS+
Sbjct: 93  TQSMFETFSTPAI-VSSQSMLLDFDNSTSPVFSLKSISLSSS 133


>UniRef50_Q8TDY3 Cluster: Actin-related protein T2; n=26;
           Amniota|Rep: Actin-related protein T2 - Homo sapiens
           (Human)
          Length = 377

 Score =  109 bits (261), Expect = 7e-23
 Identities = 50/108 (46%), Positives = 66/108 (61%)
 Frame = +3

Query: 264 LTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMF 443
           L L  P E G++T WDD+E++W H F  EL V P + P+L TE  LNP+ NREKM ++MF
Sbjct: 69  LQLHSPFERGLITGWDDVERLWKHLFEWELGVKPSDQPLLATEPSLNPRENREKMAEVMF 128

Query: 444 ETFNTPAMYVAIQAVLSLYASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           E F  PA Y++ QAVL+LYAS         S    +   P  +GY+LP
Sbjct: 129 ENFGVPAFYLSDQAVLALYASACVTGLVVDSGDAVTCTVPIFEGYSLP 176



 Score = 52.8 bits (121), Expect = 7e-06
 Identities = 25/55 (45%), Positives = 33/55 (60%)
 Frame = +1

Query: 91  ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 255
           A++ DNGSG CKAG +G+  PR +  SIVG  + Q       QK  +VG+EA  K
Sbjct: 11  AVIFDNGSGFCKAGLSGEFGPRHMVSSIVGHLKFQAPSAEANQKKYFVGEEALYK 65


>UniRef50_P61160 Cluster: Actin-related protein 2; n=96;
           Eukaryota|Rep: Actin-related protein 2 - Homo sapiens
           (Human)
          Length = 394

 Score =  108 bits (259), Expect = 1e-22
 Identities = 52/115 (45%), Positives = 74/115 (64%), Gaps = 1/115 (0%)
 Frame = +3

Query: 246 TEQRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNE-LRVAPEEHPVLLTEAPLNPKANRE 422
           +E R +L + YP+E+GIV NWDDM+ +W +TF  E L +      +LLTE P+NP  NRE
Sbjct: 62  SELRSMLEVNYPMENGIVRNWDDMKHLWDYTFGPEKLNIDTRNCKILLTEPPMNPTKNRE 121

Query: 423 KMTQIMFETFNTPAMYVAIQAVLSLYASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           K+ ++MFET+    +YVAIQAVL+LYA G+       S    +  CP  +G++LP
Sbjct: 122 KIVEVMFETYQFSGVYVAIQAVLTLYAQGLLTGVVVDSGDGVTHICPVYEGFSLP 176



 Score = 48.4 bits (110), Expect = 1e-04
 Identities = 24/53 (45%), Positives = 33/53 (62%), Gaps = 2/53 (3%)
 Frame = +1

Query: 94  LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRP--RHQGVMVGMGQKDSYVGDEA 246
           +V DNG+G  K G+AG + P  +FP++VGRP  R    +  +  KD  VGDEA
Sbjct: 9   VVCDNGTGFVKCGYAGSNFPEHIFPALVGRPIIRSTTKVGNIEIKDLMVGDEA 61


>UniRef50_Q0J646 Cluster: Os08g0369300 protein; n=2; Oryza sativa
           (japonica cultivar-group)|Rep: Os08g0369300 protein -
           Oryza sativa subsp. japonica (Rice)
          Length = 495

 Score =  106 bits (255), Expect = 4e-22
 Identities = 49/108 (45%), Positives = 67/108 (62%)
 Frame = +3

Query: 264 LTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMF 443
           L + YP+ +GIV +WDDM  IW H FY+EL+V P E  +LLT+ PLNP  NREKM + MF
Sbjct: 66  LDVSYPVTNGIVQSWDDMGHIWDHAFYSELKVDPSECKILLTDPPLNPVKNREKMIETMF 125

Query: 444 ETFNTPAMYVAIQAVLSLYASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           E +N   +++ +QAVLSLYA G+       S    +   P   G++ P
Sbjct: 126 EKYNFAGVFIQVQAVLSLYAQGLLTGLVIDSGDGVTHVVPVVDGFSYP 173



 Score = 45.6 bits (103), Expect = 0.001
 Identities = 18/31 (58%), Positives = 24/31 (77%)
 Frame = +1

Query: 94  LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRP 186
           +V DNG+G  K GFAG++ P +VFP +VGRP
Sbjct: 7   VVCDNGTGYVKCGFAGENFPTSVFPCVVGRP 37


>UniRef50_A2YUL5 Cluster: Putative uncharacterized protein; n=1;
           Oryza sativa (indica cultivar-group)|Rep: Putative
           uncharacterized protein - Oryza sativa subsp. indica
           (Rice)
          Length = 367

 Score =  106 bits (254), Expect = 5e-22
 Identities = 45/83 (54%), Positives = 60/83 (72%)
 Frame = +3

Query: 264 LTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMF 443
           L + YP+ +GIV +WDDM  IW H FY+EL+V P E  +LLT+ PLNP  NREKM + MF
Sbjct: 66  LDVSYPVTNGIVQSWDDMGHIWDHAFYSELKVDPSECKILLTDPPLNPVKNREKMIETMF 125

Query: 444 ETFNTPAMYVAIQAVLSLYASGV 512
           E +N   +++ +QAVLSLYA G+
Sbjct: 126 EKYNFAGVFIQVQAVLSLYAQGL 148



 Score = 45.6 bits (103), Expect = 0.001
 Identities = 18/31 (58%), Positives = 24/31 (77%)
 Frame = +1

Query: 94  LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRP 186
           +V DNG+G  K GFAG++ P +VFP +VGRP
Sbjct: 7   VVCDNGTGYVKCGFAGENFPTSVFPCVVGRP 37


>UniRef50_Q9BYD9 Cluster: Actin-related protein M1; n=12;
           Theria|Rep: Actin-related protein M1 - Homo sapiens
           (Human)
          Length = 372

 Score =  105 bits (251), Expect = 1e-21
 Identities = 52/137 (37%), Positives = 79/137 (57%)
 Frame = +3

Query: 177 GKAPPSGRDGRYGTEGLLCRR*GTEQRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELR 356
           G+A    R  + G E L       + R  L + YP+E G++T+W+DME +W H +   L+
Sbjct: 36  GRAKGQSRAAQGGLE-LCVGDQAQDWRSSLFISYPVERGLITSWEDMEIMWKHIYDYNLK 94

Query: 357 VAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGVPPVSCWTS 536
           + P + PVL+TE  LNP ANR+++T++ FE    PA Y++IQAVL+L+A+G        S
Sbjct: 95  LKPCDGPVLITEPALNPLANRQQITEMFFEHLGVPAFYMSIQAVLALFAAGFTTGLVLNS 154

Query: 537 ATVSSTPCPFTKGYALP 587
               +   P  +GY LP
Sbjct: 155 GAGVTQSVPIFEGYCLP 171



 Score = 50.4 bits (115), Expect = 3e-05
 Identities = 24/52 (46%), Positives = 34/52 (65%)
 Frame = +1

Query: 94  LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 249
           +V+DNGSGM KAG AG   P+ ++P+I+GR + Q      G  +  VGD+AQ
Sbjct: 8   VVIDNGSGMIKAGVAGCREPQFIYPNIIGRAKGQS-RAAQGGLELCVGDQAQ 58


>UniRef50_UPI0001554F81 Cluster: PREDICTED: similar to actin; n=1;
           Ornithorhynchus anatinus|Rep: PREDICTED: similar to
           actin - Ornithorhynchus anatinus
          Length = 376

 Score =  104 bits (249), Expect = 2e-21
 Identities = 45/108 (41%), Positives = 71/108 (65%)
 Frame = +3

Query: 264 LTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMF 443
           L L +P+  G+VT+WD+ME++W + F  +L   P +HPVLLTE+P N  A+R+K+ QIMF
Sbjct: 67  LALTFPVTRGVVTDWDEMERLWGYVF-QKLHARPTKHPVLLTESPKNRAADRDKLLQIMF 125

Query: 444 ETFNTPAMYVAIQAVLSLYASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           ETFN P+ ++ +Q +L+LYA G+       S   ++   P  +G+ +P
Sbjct: 126 ETFNVPSTFLGVQGLLALYACGLVTGVVLESGAGATHVVPVHQGFGIP 173



 Score = 51.6 bits (118), Expect = 2e-05
 Identities = 20/32 (62%), Positives = 27/32 (84%)
 Frame = +1

Query: 85  VAALVVDNGSGMCKAGFAGDDAPRAVFPSIVG 180
           +  LV+DNG+G+CKAGFAGD+AP+ V P+ VG
Sbjct: 1   MTTLVIDNGTGLCKAGFAGDNAPKLVVPTAVG 32


>UniRef50_Q9Y615 Cluster: Actin-like protein 7A; n=11; Mammalia|Rep:
           Actin-like protein 7A - Homo sapiens (Human)
          Length = 435

 Score =  103 bits (247), Expect = 4e-21
 Identities = 46/108 (42%), Positives = 68/108 (62%)
 Frame = +3

Query: 264 LTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMF 443
           L L  P+ HGI+ +WD ++ IW + F  E+++APEEH VL+++ PL+P  NREK  +++F
Sbjct: 129 LKLVNPLRHGIIVDWDTVQDIWEYLFRQEMKIAPEEHAVLVSDPPLSPHTNREKYAEMLF 188

Query: 444 ETFNTPAMYVAIQAVLSLYASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           E FNTPAM++A Q+ LS+Y+ G             S   P  +GY LP
Sbjct: 189 EAFNTPAMHIAYQSRLSMYSYGRTSGLVVEVGHGVSYVVPIYEGYPLP 236



 Score = 46.4 bits (105), Expect = 6e-04
 Identities = 22/55 (40%), Positives = 31/55 (56%)
 Frame = +1

Query: 79  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDE 243
           E   A+VVD G+G CK GFAG   P     + VG+P  +    G  +K+++VG E
Sbjct: 67  EVTKAVVVDLGTGYCKCGFAGLPRPTHKISTTVGKPYMETAKTGDNRKETFVGQE 121


>UniRef50_UPI0000588EB0 Cluster: PREDICTED: similar to actin; n=1;
           Strongylocentrotus purpuratus|Rep: PREDICTED: similar to
           actin - Strongylocentrotus purpuratus
          Length = 386

 Score =  102 bits (245), Expect = 6e-21
 Identities = 43/86 (50%), Positives = 63/86 (73%)
 Frame = +3

Query: 252 QRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 431
           +RG+LTL YPIE GI+T WDDME +W HTF +E++  P++   +L++ P NPK N+EKM 
Sbjct: 71  RRGVLTLTYPIERGIITKWDDMEAVWSHTF-SEIKFNPQDEGAVLSQIPNNPKPNKEKMA 129

Query: 432 QIMFETFNTPAMYVAIQAVLSLYASG 509
           +I FE F +P + +A QA L+L++ G
Sbjct: 130 EIFFEKFQSPGICLANQAALALFSLG 155



 Score = 64.1 bits (149), Expect = 3e-09
 Identities = 32/58 (55%), Positives = 42/58 (72%), Gaps = 4/58 (6%)
 Frame = +1

Query: 94  LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQK----DSYVGDEAQSK 255
           +V+D+GS   +AGFA +D PR VF SIVGRPRHQ V+  +  K    DSYVG+EAQ++
Sbjct: 14  MVIDHGSFEIQAGFAEEDCPRTVFQSIVGRPRHQEVLDDLTTKLNFRDSYVGEEAQNR 71


>UniRef50_Q4SGD5 Cluster: Chromosome 17 SCAF14597, whole genome
           shotgun sequence; n=1; Tetraodon nigroviridis|Rep:
           Chromosome 17 SCAF14597, whole genome shotgun sequence -
           Tetraodon nigroviridis (Green puffer)
          Length = 425

 Score =  102 bits (245), Expect = 6e-21
 Identities = 48/109 (44%), Positives = 70/109 (64%), Gaps = 1/109 (0%)
 Frame = +3

Query: 264 LTLKYPIEHGIVTNWDDMEKIWHHTFYNE-LRVAPEEHPVLLTEAPLNPKANREKMTQIM 440
           + + YP+E+GIV NWDDM+ +W +TF  E L +      +LLTE P+NP  NREK+ ++M
Sbjct: 52  IKVNYPMENGIVRNWDDMKHLWDYTFGPEKLNIDSRNCKILLTEPPMNPTKNREKIIEVM 111

Query: 441 FETFNTPAMYVAIQAVLSLYASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           FET+    +Y+AIQAVL+LYA G+       S    +  CP  +G++LP
Sbjct: 112 FETYQFAGVYIAIQAVLTLYAQGLLTGVVVDSGDGVTHICPVYEGFSLP 160



 Score = 43.2 bits (97), Expect = 0.005
 Identities = 16/31 (51%), Positives = 23/31 (74%)
 Frame = +1

Query: 94  LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRP 186
           +V DNG+G  K G+AG + P  +FP++VGRP
Sbjct: 9   VVCDNGTGFVKCGYAGSNFPEHIFPALVGRP 39


>UniRef50_Q4N681 Cluster: Actin, putative; n=3; Piroplasmida|Rep:
           Actin, putative - Theileria parva
          Length = 380

 Score =  102 bits (245), Expect = 6e-21
 Identities = 42/76 (55%), Positives = 56/76 (73%)
 Frame = +3

Query: 279 PIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNT 458
           P++HGIV NW   E +W HTF NEL+++ EEHPVLLTE PL PK +RE   Q+ FE+F  
Sbjct: 75  PVQHGIVRNWALAESVWRHTFTNELKISQEEHPVLLTEPPLTPKLHRELCCQLFFESFGV 134

Query: 459 PAMYVAIQAVLSLYAS 506
           PA+Y+A  ++LS+Y S
Sbjct: 135 PALYLATTSLLSMYGS 150



 Score = 43.2 bits (97), Expect = 0.005
 Identities = 20/49 (40%), Positives = 29/49 (59%), Gaps = 3/49 (6%)
 Frame = +1

Query: 79  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIV---GRPRHQGVMVGMG 216
           +E  AL++D GS + KAGFAG + P+  FP++V   G       +VG G
Sbjct: 3   DETLALIIDTGSAVTKAGFAGSETPKVRFPTLVAIDGNQESDDPLVGNG 51


>UniRef50_Q6BG22 Cluster: Actin, putative; n=2; Paramecium
           tetraurelia|Rep: Actin, putative - Paramecium
           tetraurelia
          Length = 370

 Score =  101 bits (241), Expect = 2e-20
 Identities = 45/103 (43%), Positives = 67/103 (65%)
 Frame = +3

Query: 276 YPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN 455
           YPI++G + +W+ +E+IW + F  +L+++P  HPVLLTEAP N K N+EKMTQIMFE F 
Sbjct: 63  YPIQNGQIMDWESIEQIWRYIFEVQLKISPSNHPVLLTEAPCNSKINQEKMTQIMFENFE 122

Query: 456 TPAMYVAIQAVLSLYASGVPPVSCWTSATVSSTPCPFTKGYAL 584
            P ++++ Q VLSLY+ G        S   ++   P  +G+ L
Sbjct: 123 VPFLHISNQTVLSLYSLGKTTGVILDSGEGATYCVPIYEGFQL 165


>UniRef50_UPI0000D9A391 Cluster: PREDICTED: actin related protein M1
           isoform 1; n=1; Macaca mulatta|Rep: PREDICTED: actin
           related protein M1 isoform 1 - Macaca mulatta
          Length = 319

 Score = 99.5 bits (237), Expect = 6e-20
 Identities = 40/85 (47%), Positives = 62/85 (72%)
 Frame = +3

Query: 255 RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQ 434
           R  L++ YP+E G++T+WDDME +W H +   L++ P + PVL+TE  LNP ANR+++ +
Sbjct: 124 RSSLSISYPVERGLITSWDDMEIMWKHIYDYNLKLKPCDGPVLITEPALNPLANRQQIVE 183

Query: 435 IMFETFNTPAMYVAIQAVLSLYASG 509
           + FE    PA Y++IQAVL+L+A+G
Sbjct: 184 VFFEHLGVPAFYMSIQAVLALFAAG 208



 Score = 49.6 bits (113), Expect = 6e-05
 Identities = 23/52 (44%), Positives = 34/52 (65%)
 Frame = +1

Query: 94  LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 249
           +V+DNGSG+ KAG AG   P+ ++P+I+GR + Q      G  +  VGD+AQ
Sbjct: 71  VVIDNGSGVIKAGLAGSREPQFIYPNIIGRAKGQS-RAAPGGLELCVGDQAQ 121


>UniRef50_Q4QG59 Cluster: Actin-like protein, putative; n=3;
           Leishmania|Rep: Actin-like protein, putative -
           Leishmania major
          Length = 483

 Score = 99.5 bits (237), Expect = 6e-20
 Identities = 46/111 (41%), Positives = 68/111 (61%)
 Frame = +3

Query: 252 QRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 431
           ++GIL + +PI +G + +W D+EK+W H F+NELRV+PE H  LLT+    P A RE+  
Sbjct: 63  KQGILDVHHPIRNGFINDWGDVEKLWSHLFFNELRVSPETHCFLLTQPVNTPAAQRERTL 122

Query: 432 QIMFETFNTPAMYVAIQAVLSLYASGVPPVSCWTSATVSSTPCPFTKGYAL 584
           +IM ETF+  ++Y+    VLSLY+ G+       S    +   P  +GYAL
Sbjct: 123 EIMMETFHAHSLYLGTSQVLSLYSYGLTTGLVVDSGKDVTHAVPIHEGYAL 173



 Score = 53.2 bits (122), Expect = 5e-06
 Identities = 24/56 (42%), Positives = 35/56 (62%)
 Frame = +1

Query: 88  AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 255
           AA+V+D GS   +AGF G+  PR   P++VG PRH+ + +  G  +  VG+EA  K
Sbjct: 8   AAVVLDCGSFHSRAGFGGEKGPRLDVPTLVGYPRHRSIAMAAGMNEQEVGEEALLK 63


>UniRef50_Q9Y614 Cluster: Actin-like protein 7B; n=12; Theria|Rep:
           Actin-like protein 7B - Homo sapiens (Human)
          Length = 415

 Score = 99.1 bits (236), Expect = 8e-20
 Identities = 45/108 (41%), Positives = 68/108 (62%)
 Frame = +3

Query: 264 LTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMF 443
           L L  P++HGIV +WD ++ IW + F   +++ PEEH VL+++ PL+P +NREK  ++MF
Sbjct: 109 LKLVNPLKHGIVVDWDCVQDIWEYIFRTAMKILPEEHAVLVSDPPLSPSSNREKYAELMF 168

Query: 444 ETFNTPAMYVAIQAVLSLYASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           ETF  PAM+V  Q++LS+Y+ G        S    S   P ++G  LP
Sbjct: 169 ETFGIPAMHVTSQSLLSIYSYGKTSGLVVESGHGVSHVVPISEGDVLP 216



 Score = 37.5 bits (83), Expect = 0.26
 Identities = 18/54 (33%), Positives = 29/54 (53%)
 Frame = +1

Query: 82  EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDE 243
           ++ A+++D GS  CK G+AG+  P     S VG+   +    G  +K + VG E
Sbjct: 48  KIKAVIIDLGSQYCKCGYAGEPRPTYFISSTVGKRCPEAADAGDTRKWTLVGHE 101


>UniRef50_Q54UQ7 Cluster: Actin-like protein 6A; n=1; Dictyostelium
           discoideum AX4|Rep: Actin-like protein 6A -
           Dictyostelium discoideum AX4
          Length = 440

 Score = 98.7 bits (235), Expect = 1e-19
 Identities = 42/87 (48%), Positives = 61/87 (70%)
 Frame = +3

Query: 246 TEQRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK 425
           T +R  + +  P+  G++ NWD ME+IW+HTFY  L + P EHP+LL E   N +A REK
Sbjct: 75  TYRRPHMEIINPLSDGLIKNWDAMEQIWNHTFYERLHINPIEHPILLAEPTYNTRAIREK 134

Query: 426 MTQIMFETFNTPAMYVAIQAVLSLYAS 506
           +T+IMFE ++ PA+++A  AVLS +AS
Sbjct: 135 VTEIMFEKYHAPALFIAKNAVLSSFAS 161



 Score = 47.2 bits (107), Expect = 3e-04
 Identities = 21/60 (35%), Positives = 40/60 (66%), Gaps = 1/60 (1%)
 Frame = +1

Query: 79  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRP-RHQGVMVGMGQKDSYVGDEAQSK 255
           ++V+A+V+D G+   K G+AG+D+P+AVFP+ +G   +++   VG G  +    D+++ K
Sbjct: 5   DDVSAIVIDVGTFSTKGGYAGEDSPKAVFPTDIGVVYKNENETVGTGDSEMGEKDDSEPK 64


>UniRef50_Q38F20 Cluster: Actin-like protein 3, putative; n=1;
           Trypanosoma brucei|Rep: Actin-like protein 3, putative -
           Trypanosoma brucei
          Length = 416

 Score = 98.7 bits (235), Expect = 1e-19
 Identities = 42/79 (53%), Positives = 54/79 (68%)
 Frame = +3

Query: 270 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 449
           L +PI+HGIV +WD ME+IW H  Y  LRV PEEH  +LTE P NP  NRE   ++MFET
Sbjct: 67  LYHPIKHGIVEDWDKMERIWQHCVYKYLRVDPEEHGFILTEPPANPPENREHTAEVMFET 126

Query: 450 FNTPAMYVAIQAVLSLYAS 506
           F    +++A+Q  L+L AS
Sbjct: 127 FGVKQLHIAVQGALALRAS 145



 Score = 36.7 bits (81), Expect = 0.46
 Identities = 21/56 (37%), Positives = 30/56 (53%), Gaps = 5/56 (8%)
 Frame = +1

Query: 94  LVVDNGSGMCKAGFAGDDAPRAVFPSI-----VGRPRHQGVMVGMGQKDSYVGDEA 246
           +V+DNG+G  K G+AG++ P  + P+        R R   V   +   D YVGDEA
Sbjct: 6   VVIDNGTGYTKMGYAGNEEPTYIIPTAYADNEASRRRSHDVFSDL---DFYVGDEA 58


>UniRef50_A2FH22 Cluster: Actin family protein; n=1; Trichomonas
           vaginalis G3|Rep: Actin family protein - Trichomonas
           vaginalis G3
          Length = 390

 Score = 98.7 bits (235), Expect = 1e-19
 Identities = 44/86 (51%), Positives = 59/86 (68%)
 Frame = +3

Query: 255 RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQ 434
           R  L L  P+EHGIV NW+D   +  + F  +L++  E+HP+L+TEAPLNPK NR+KM +
Sbjct: 62  RQYLDLTLPVEHGIVKNWEDEALVLDYVFKEKLKIRNEDHPLLITEAPLNPKDNRKKMCE 121

Query: 435 IMFETFNTPAMYVAIQAVLSLYASGV 512
           I FE FN P + V  QA+L LYA G+
Sbjct: 122 IFFEQFNFPRLQVCPQALLVLYAQGL 147


>UniRef50_A0CQQ2 Cluster: Chromosome undetermined scaffold_24, whole
           genome shotgun sequence; n=7; Oligohymenophorea|Rep:
           Chromosome undetermined scaffold_24, whole genome
           shotgun sequence - Paramecium tetraurelia
          Length = 869

 Score = 98.7 bits (235), Expect = 1e-19
 Identities = 39/79 (49%), Positives = 58/79 (73%)
 Frame = +3

Query: 276 YPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN 455
           YP++ GIV NWD MEK WH + ++ LR  P+E   +LTE P+NP  NRE + +I FETFN
Sbjct: 80  YPMKSGIVENWDLMEKFWHRSIFDYLRAEPDETTFILTEPPMNPPENRENIAEIFFETFN 139

Query: 456 TPAMYVAIQAVLSLYASGV 512
              +++++QAVLSL+++G+
Sbjct: 140 AKGLHISVQAVLSLFSTGL 158



 Score = 33.5 bits (73), Expect = 4.3
 Identities = 19/54 (35%), Positives = 28/54 (51%), Gaps = 4/54 (7%)
 Frame = +1

Query: 97  VVDNGSGMCKAGFAGDDAPRAVFPSIVG-RPRHQGVMVGMGQK---DSYVGDEA 246
           V+DNG+G  K G+AG+  P+   P++V      Q V +        D Y+G EA
Sbjct: 16  VIDNGTGFTKMGWAGNTEPQFDIPTVVADHQEKQKVQMSKNTNENLDYYIGYEA 69


>UniRef50_A2DBN6 Cluster: Actin family protein; n=1; Trichomonas
           vaginalis G3|Rep: Actin family protein - Trichomonas
           vaginalis G3
          Length = 373

 Score = 98.3 bits (234), Expect = 1e-19
 Identities = 46/88 (52%), Positives = 57/88 (64%)
 Frame = +3

Query: 249 EQRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKM 428
           EQ   L LK PI   +++N D++E  W H F  EL +   EHPVL+TE+P N K  REK+
Sbjct: 59  EQSKNLNLKCPISDRVISNIDEIEVFWQHIFSKELNINTSEHPVLMTESPQNTKIMREKV 118

Query: 429 TQIMFETFNTPAMYVAIQAVLSLYASGV 512
           TQIM ETF  PA Y A   VLSLYA+G+
Sbjct: 119 TQIMMETFKVPAYYTAYPGVLSLYANGM 146



 Score = 48.8 bits (111), Expect = 1e-04
 Identities = 24/61 (39%), Positives = 36/61 (59%), Gaps = 3/61 (4%)
 Frame = +1

Query: 82  EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRH-QGVMVGMGQKDSYVGDEA--QS 252
           EV+ +V+D G+   +AGF GD  P+ + P+++GR +  Q     +  KD YVG E   QS
Sbjct: 2   EVSTIVIDTGAYSTRAGFGGDSDPQCILPTVIGRLKSPQDKAAAIATKDIYVGSEVFEQS 61

Query: 253 K 255
           K
Sbjct: 62  K 62


>UniRef50_A2VD47 Cluster: Zgc:158823 protein; n=3; Eukaryota|Rep:
           Zgc:158823 protein - Danio rerio (Zebrafish)
           (Brachydanio rerio)
          Length = 334

 Score = 97.9 bits (233), Expect = 2e-19
 Identities = 42/78 (53%), Positives = 54/78 (69%)
 Frame = +3

Query: 273 KYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETF 452
           K+PI HGI+ +WD MEK      +  LR  PE+H  L+TE PLN   NRE + +IMFETF
Sbjct: 76  KWPIRHGIIEDWDFMEKFMEQVIFKYLRAEPEDHNFLMTEPPLNTPENREYLAEIMFETF 135

Query: 453 NTPAMYVAIQAVLSLYAS 506
           N P +Y+A+QAVL+L AS
Sbjct: 136 NVPGLYIAVQAVLALAAS 153



 Score = 34.7 bits (76), Expect = 1.9
 Identities = 19/61 (31%), Positives = 32/61 (52%), Gaps = 8/61 (13%)
 Frame = +1

Query: 97  VVDNGSGMCKAGFAGDDAPRAVFPSI--------VGRPRHQGVMVGMGQKDSYVGDEAQS 252
           V+D G+G  K G+AG+  P+ + P+         VG    + ++ G+   D ++GDEA  
Sbjct: 10  VIDCGTGYTKIGYAGNTEPQFIMPTCIAVRESASVGDQAQRRLVKGVDDLDFFIGDEAID 69

Query: 253 K 255
           K
Sbjct: 70  K 70



 Score = 33.1 bits (72), Expect = 5.7
 Identities = 13/22 (59%), Positives = 16/22 (72%)
 Frame = +2

Query: 506 RRTTGIVLDFGDGVFHTVPIYE 571
           R  TGIV+D GDGV H +P+ E
Sbjct: 162 RTLTGIVIDSGDGVTHAIPVAE 183


>UniRef50_UPI0000E466A7 Cluster: PREDICTED: similar to actin, alpha
           1, skeletal muscle; n=1; Strongylocentrotus
           purpuratus|Rep: PREDICTED: similar to actin, alpha 1,
           skeletal muscle - Strongylocentrotus purpuratus
          Length = 258

 Score = 96.7 bits (230), Expect = 4e-19
 Identities = 41/61 (67%), Positives = 50/61 (81%)
 Frame = +3

Query: 252 QRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 431
           +RG+L++KYPIE GIVTNW+DME IWHHTFYNELRV P+E  V  T+ P + KA+REK T
Sbjct: 20  KRGLLSIKYPIERGIVTNWEDMETIWHHTFYNELRVDPKELLVFFTDVPKSTKASREKTT 79

Query: 432 Q 434
           Q
Sbjct: 80  Q 80


>UniRef50_Q6X960 Cluster: HSD21; n=13; Theria|Rep: HSD21 - Homo
           sapiens (Human)
          Length = 416

 Score = 96.7 bits (230), Expect = 4e-19
 Identities = 49/108 (45%), Positives = 68/108 (62%), Gaps = 1/108 (0%)
 Frame = +3

Query: 264 LTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMF 443
           LTL  P+  GIV +WD  E IW H   ++LRVA  +HP+L ++ P +P  NREK+ ++ F
Sbjct: 108 LTLVQPLRSGIVVDWDAAELIWRHLLEHDLRVATHDHPLLSSDPPFSPATNREKLVEVAF 167

Query: 444 ETFNTPAMYVAIQAVLSLYASG-VPPVSCWTSATVSSTPCPFTKGYAL 584
           E+  +PAMYVA Q+VLS+YA G V  +   T   V+ T  P  +GY L
Sbjct: 168 ESLRSPAMYVASQSVLSVYAHGRVSGLVVDTGHGVTYT-VPVFQGYNL 214



 Score = 39.5 bits (88), Expect = 0.065
 Identities = 17/56 (30%), Positives = 30/56 (53%)
 Frame = +1

Query: 82  EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 249
           +  A+V+D G+G CK GFAG  +P     +I+G    +    G     +++G+ A+
Sbjct: 48  KTGAVVIDMGTGTCKVGFAGQASPTYTVATILGCQPKKPATSGQSGLQTFIGEAAR 103


>UniRef50_P32392 Cluster: Actin-related protein 3; n=27;
           Eukaryota|Rep: Actin-related protein 3 - Drosophila
           melanogaster (Fruit fly)
          Length = 418

 Score = 96.7 bits (230), Expect = 4e-19
 Identities = 42/80 (52%), Positives = 55/80 (68%)
 Frame = +3

Query: 267 TLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFE 446
           ++KYP+ HG+V +WD ME+      +  LR  PE+H  LLTE PLN   NRE   +IMFE
Sbjct: 73  SIKYPVRHGLVEDWDLMERFLEQCVFKYLRAEPEDHYFLLTEPPLNTPENREYTAEIMFE 132

Query: 447 TFNTPAMYVAIQAVLSLYAS 506
           TFN P +Y+A+QAVL+L AS
Sbjct: 133 TFNVPGLYIAVQAVLALAAS 152



 Score = 36.7 bits (81), Expect = 0.46
 Identities = 21/60 (35%), Positives = 31/60 (51%), Gaps = 8/60 (13%)
 Frame = +1

Query: 91  ALVVDNGSGMCKAGFAGDDAPRAVFPSI--------VGRPRHQGVMVGMGQKDSYVGDEA 246
           A V+D G+G  K GFAG+  P+ + PS         VG    + +  G+   D ++GDEA
Sbjct: 7   ACVIDVGTGYSKLGFAGNKEPQFIIPSAIAIKESARVGDTNTRRITKGIEDLDFFIGDEA 66



 Score = 32.7 bits (71), Expect = 7.5
 Identities = 13/22 (59%), Positives = 16/22 (72%)
 Frame = +2

Query: 506 RRTTGIVLDFGDGVFHTVPIYE 571
           R  TGIV+D GDGV H +P+ E
Sbjct: 161 RTLTGIVVDSGDGVTHVIPVAE 182


>UniRef50_UPI0000449ED3 Cluster: PREDICTED: similar to RIKEN cDNA
           4921517D21 gene; n=2; Gallus gallus|Rep: PREDICTED:
           similar to RIKEN cDNA 4921517D21 gene - Gallus gallus
          Length = 321

 Score = 96.3 bits (229), Expect = 5e-19
 Identities = 45/102 (44%), Positives = 62/102 (60%)
 Frame = +3

Query: 282 IEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTP 461
           + HG+VT+WD +E++WH  FY+EL V PEE  VL T+APL+P  NREKM +++FE F  P
Sbjct: 48  LTHGVVTDWDRLEELWHRIFYHELAVCPEELAVLATDAPLSPIINREKMAELLFEGFGVP 107

Query: 462 AMYVAIQAVLSLYASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           A+ V  + VL+ Y+ G        S   +S       GY LP
Sbjct: 108 AVLVMPRPVLATYSYGCTTGVVLGSGAGTSYVVAVQDGYVLP 149



 Score = 37.1 bits (82), Expect = 0.35
 Identities = 14/31 (45%), Positives = 23/31 (74%)
 Frame = +1

Query: 79  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPS 171
           +++ A+V+D G G  ++G AGD+ PR+V PS
Sbjct: 10  KDLCAVVIDTGMGHTRSGLAGDERPRSVAPS 40


>UniRef50_A2YQV6 Cluster: Putative uncharacterized protein; n=1;
           Oryza sativa (indica cultivar-group)|Rep: Putative
           uncharacterized protein - Oryza sativa subsp. indica
           (Rice)
          Length = 581

 Score = 95.9 bits (228), Expect = 7e-19
 Identities = 41/82 (50%), Positives = 57/82 (69%)
 Frame = +3

Query: 258 GILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQI 437
           G+ T K+PI HG V +WD ME+ W    +N LR  PEEH  LLT++P++   +RE   +I
Sbjct: 383 GLYTRKHPINHGQVDDWDTMERFWQQCIFNYLRCNPEEHYFLLTDSPVSTPESRECAGEI 442

Query: 438 MFETFNTPAMYVAIQAVLSLYA 503
           MFETFN P +Y+++Q+VLSL A
Sbjct: 443 MFETFNVPGLYISVQSVLSLSA 464


>UniRef50_A7RPC3 Cluster: Predicted protein; n=3; Eumetazoa|Rep:
           Predicted protein - Nematostella vectensis
          Length = 64

 Score = 95.9 bits (228), Expect = 7e-19
 Identities = 45/55 (81%), Positives = 47/55 (85%)
 Frame = +1

Query: 91  ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 255
           ALV+D GS M K GFAGDDAP+ VFP IVGRPRHQGVMVGMGQKDSYVG EA SK
Sbjct: 1   ALVIDVGSHMWKVGFAGDDAPKGVFPPIVGRPRHQGVMVGMGQKDSYVGWEAHSK 55


>UniRef50_A5B4L4 Cluster: Putative uncharacterized protein; n=1;
           Vitis vinifera|Rep: Putative uncharacterized protein -
           Vitis vinifera (Grape)
          Length = 571

 Score = 94.7 bits (225), Expect = 2e-18
 Identities = 42/78 (53%), Positives = 52/78 (66%)
 Frame = +3

Query: 270 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 449
           L YPI HG V NWD ME+ W    +N LR  PE+H  LLTE+PL    +RE   +IMFET
Sbjct: 143 LSYPIVHGQVDNWDAMERFWQQCIFNYLRCDPEDHYFLLTESPLTAPESREYTGEIMFET 202

Query: 450 FNTPAMYVAIQAVLSLYA 503
           FN P +Y+A+Q VL+L A
Sbjct: 203 FNVPGLYIAVQPVLALAA 220


>UniRef50_Q55DS6 Cluster: Putative uncharacterized protein; n=1;
           Dictyostelium discoideum AX4|Rep: Putative
           uncharacterized protein - Dictyostelium discoideum AX4
          Length = 392

 Score = 94.3 bits (224), Expect = 2e-18
 Identities = 38/86 (44%), Positives = 64/86 (74%)
 Frame = +3

Query: 252 QRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 431
           Q+  +++K+PIE G + NWDDMEK+ +++F+  L ++ +E+P+L+T++P N K NRE++T
Sbjct: 70  QKTNISIKHPIERGSIINWDDMEKLLNYSFHQVLNISCDEYPILITDSPFNSKMNRERLT 129

Query: 432 QIMFETFNTPAMYVAIQAVLSLYASG 509
           Q++FET+N+    V  +A LSL  SG
Sbjct: 130 QLLFETYNSKLASVTNRASLSLIGSG 155



 Score = 42.7 bits (96), Expect = 0.007
 Identities = 21/63 (33%), Positives = 40/63 (63%), Gaps = 3/63 (4%)
 Frame = +1

Query: 76  DEEVA-ALVVDNGSGMCKAGFAGDD-APRAVFPSIVGRPRHQGVMVGM-GQKDSYVGDEA 246
           +EE+  ++++D GSG  K GF+ ++  PR  FP+I+GR ++  V+ G   +K  + G E 
Sbjct: 8   NEEIRNSVIIDCGSGFTKVGFSNEELTPRNEFPTIIGRTKYYEVLYGAPNKKVIFAGHEV 67

Query: 247 QSK 255
           +++
Sbjct: 68  ETQ 70


>UniRef50_P61158 Cluster: Actin-related protein 3; n=107;
           Eukaryota|Rep: Actin-related protein 3 - Homo sapiens
           (Human)
          Length = 418

 Score = 94.3 bits (224), Expect = 2e-18
 Identities = 42/78 (53%), Positives = 53/78 (67%)
 Frame = +3

Query: 273 KYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETF 452
           K+PI HGIV +WD ME+      +  LR  PE+H  LLTE PLN   NRE   +IMFE+F
Sbjct: 75  KWPIRHGIVEDWDLMERFMEQVIFKYLRAEPEDHYFLLTEPPLNTPENREYTAEIMFESF 134

Query: 453 NTPAMYVAIQAVLSLYAS 506
           N P +Y+A+QAVL+L AS
Sbjct: 135 NVPGLYIAVQAVLALAAS 152



 Score = 40.3 bits (90), Expect = 0.037
 Identities = 24/63 (38%), Positives = 33/63 (52%), Gaps = 8/63 (12%)
 Frame = +1

Query: 91  ALVVDNGSGMCKAGFAGDDAPRAVFPSI--------VGRPRHQGVMVGMGQKDSYVGDEA 246
           A VVD G+G  K G+AG+  P+ + PS         VG    + VM G+   D ++GDEA
Sbjct: 7   ACVVDCGTGYTKLGYAGNTEPQFIIPSCIAIKESAKVGDQAQRRVMKGVDDLDFFIGDEA 66

Query: 247 QSK 255
             K
Sbjct: 67  IEK 69


>UniRef50_O96819 Cluster: Actin-related protein; n=5;
           Trypanosoma|Rep: Actin-related protein - Trypanosoma
           brucei
          Length = 433

 Score = 92.3 bits (219), Expect = 9e-18
 Identities = 42/111 (37%), Positives = 67/111 (60%)
 Frame = +3

Query: 252 QRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 431
           +RG+LT+  PIE G V +W++MEK+W H  Y+ELRV PE H  ++ ++   P + +EK  
Sbjct: 64  KRGMLTVSSPIESGRVVSWENMEKLWGHVMYSELRVRPESHCFIVPQSVNTPASQKEKTL 123

Query: 432 QIMFETFNTPAMYVAIQAVLSLYASGVPPVSCWTSATVSSTPCPFTKGYAL 584
           ++M ETF+  ++++    VLSLY+ G+       S    +   P  +GYAL
Sbjct: 124 ELMMETFHVHSLFLGASQVLSLYSYGLTTGLVIDSGKDRTMAVPVHEGYAL 174



 Score = 56.0 bits (129), Expect = 7e-07
 Identities = 27/63 (42%), Positives = 39/63 (61%), Gaps = 1/63 (1%)
 Frame = +1

Query: 70  MCDEEVAALVV-DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA 246
           +C  E A +V+ D GS   +AG+A D APR   P++VG PR++GV V  G  +  +GD A
Sbjct: 2   VCSTERAPVVILDGGSHHLRAGYASDGAPRLDIPALVGHPRNRGVAVAAGMNEYEIGDVA 61

Query: 247 QSK 255
            +K
Sbjct: 62  LAK 64


>UniRef50_A7S2B1 Cluster: Predicted protein; n=1; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 265

 Score = 91.9 bits (218), Expect = 1e-17
 Identities = 44/116 (37%), Positives = 67/116 (57%)
 Frame = +3

Query: 258 GILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQI 437
           G++ L YP+    +  W D+  +W +  Y+EL +   EHP ++TE   N   NREK+T+I
Sbjct: 60  GVMHLSYPMHADKLETWTDVVDLWEYLLYDELDIGEGEHPFIVTEIAKNHPKNREKLTEI 119

Query: 438 MFETFNTPAMYVAIQAVLSLYASGVPPVSCWTSATVSSTPCPFTKGYALPPRHSLR 605
           +FE F+ PAMY+A Q  LSLYASG+    C +S    +      +G+ L   H+L+
Sbjct: 120 LFEQFSAPAMYLADQLSLSLYASGMTTGVCLSSGFSCTQAAVIYEGHTL--NHTLQ 173



 Score = 50.4 bits (115), Expect = 3e-05
 Identities = 25/58 (43%), Positives = 37/58 (63%), Gaps = 3/58 (5%)
 Frame = +1

Query: 91  ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVG--MGQKD-SYVGDEAQSK 255
           A+V+DNG G+ K GFAGD  PR + P++VG P+   +++G  +  KD    GD A +K
Sbjct: 1   AIVLDNGCGISKIGFAGDRVPRIIQPAVVGNPQRFSMLIGDNVNVKDYKKYGDAAVAK 58


>UniRef50_Q75JT2 Cluster: Similar to Drosophila melanogaster (Fruit
           fly). RE12057p; n=4; Dictyostelium discoideum|Rep:
           Similar to Drosophila melanogaster (Fruit fly). RE12057p
           - Dictyostelium discoideum (Slime mold)
          Length = 414

 Score = 91.5 bits (217), Expect = 2e-17
 Identities = 39/64 (60%), Positives = 49/64 (76%)
 Frame = +3

Query: 318 EKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSL 497
           +K W+H F ++L V+ ++HPV LTE P NPK N EKM Q MFE +  PAMYV+IQA+LSL
Sbjct: 235 KKFWNHAFNDQLCVSSDQHPVFLTEPPFNPKVNTEKMAQYMFECYGIPAMYVSIQAILSL 294

Query: 498 YASG 509
           YASG
Sbjct: 295 YASG 298



 Score = 39.5 bits (88), Expect = 0.065
 Identities = 17/21 (80%), Positives = 18/21 (85%)
 Frame = +2

Query: 509 RTTGIVLDFGDGVFHTVPIYE 571
           RTTGIV+D G GV HTVPIYE
Sbjct: 299 RTTGIVIDSGGGVSHTVPIYE 319


>UniRef50_Q14BL3 Cluster: RIKEN cDNA 4921517D21 gene; n=7;
            Eutheria|Rep: RIKEN cDNA 4921517D21 gene - Mus musculus
            (Mouse)
          Length = 1207

 Score = 90.6 bits (215), Expect = 3e-17
 Identities = 36/76 (47%), Positives = 56/76 (73%)
 Frame = +3

Query: 282  IEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTP 461
            +  G+V++WD +E +W H FY +L+V PEE  VL+ ++P++P+ NREK+ +I+FE F+ P
Sbjct: 914  LNRGVVSDWDALEVLWQHLFYCKLKVQPEEMAVLVADSPISPRTNREKVAEILFERFHVP 973

Query: 462  AMYVAIQAVLSLYASG 509
            AM    QA+L+LYA G
Sbjct: 974  AMQTVHQALLTLYAYG 989


>UniRef50_Q55DY5 Cluster: Putative uncharacterized protein; n=1;
           Dictyostelium discoideum AX4|Rep: Putative
           uncharacterized protein - Dictyostelium discoideum AX4
          Length = 355

 Score = 90.6 bits (215), Expect = 3e-17
 Identities = 41/75 (54%), Positives = 54/75 (72%)
 Frame = +3

Query: 270 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 449
           L YPI++GIV NW+DMEK   +TFY +LRV P+ H VLLTE  +N K NR KM +IMFET
Sbjct: 59  LVYPIKNGIVCNWEDMEKFIENTFYYKLRVEPQYHSVLLTETTMNTKENRNKMAEIMFET 118

Query: 450 FNTPAMYVAIQAVLS 494
           ++ P++ +  Q  LS
Sbjct: 119 YDIPSIKIENQQKLS 133



 Score = 35.1 bits (77), Expect = 1.4
 Identities = 15/35 (42%), Positives = 20/35 (57%)
 Frame = +1

Query: 94  LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQG 198
           +++D GSG  K GF G+  P     +IVG P  QG
Sbjct: 6   IIIDFGSGWTKCGFEGEVTPSVECLTIVGHPNKQG 40


>UniRef50_Q54JL1 Cluster: Putative uncharacterized protein; n=1;
           Dictyostelium discoideum AX4|Rep: Putative
           uncharacterized protein - Dictyostelium discoideum AX4
          Length = 414

 Score = 90.6 bits (215), Expect = 3e-17
 Identities = 44/97 (45%), Positives = 65/97 (67%)
 Frame = +3

Query: 264 LTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMF 443
           L+L  P++ GIV+NW+DMEKI+    Y E +VAPEE  +LLTE PL  K +  K+ +IMF
Sbjct: 64  LSLTCPMKRGIVSNWEDMEKIYSRLLYYEFKVAPEESDILLTEPPLTSKNDHNKLIEIMF 123

Query: 444 ETFNTPAMYVAIQAVLSLYASGVPPVSCWTSATVSST 554
           ETF T ++ +  Q++LS Y+S     S  +S++ SS+
Sbjct: 124 ETFCTQSVSLLDQSMLSFYSSSSSSSSSSSSSSSSSS 160


>UniRef50_UPI0000F2DE11 Cluster: PREDICTED: similar to
           testis-specific actin-related protein 3; n=1;
           Monodelphis domestica|Rep: PREDICTED: similar to
           testis-specific actin-related protein 3 - Monodelphis
           domestica
          Length = 939

 Score = 89.8 bits (213), Expect = 5e-17
 Identities = 36/73 (49%), Positives = 55/73 (75%)
 Frame = +3

Query: 291 GIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMY 470
           G+VT+WD +E +W+H FY++L V P+E  VL+ ++P++P+ NREK+ +++FE F  PAM 
Sbjct: 167 GVVTDWDALEVLWNHIFYSKLCVEPQELAVLVADSPVSPRTNREKVVELLFENFGVPAMQ 226

Query: 471 VAIQAVLSLYASG 509
              QA+LSLYA G
Sbjct: 227 TVHQALLSLYAYG 239



 Score = 41.5 bits (93), Expect = 0.016
 Identities = 17/35 (48%), Positives = 25/35 (71%)
 Frame = +1

Query: 79  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGR 183
           + +AA+V+D G+G  K G AG+D  RA+ P+ VGR
Sbjct: 106 KNLAAVVIDTGTGYSKCGLAGEDRTRAIVPTRVGR 140


>UniRef50_UPI00005A3B5D Cluster: PREDICTED: similar to Actin-5C; n=3;
            Laurasiatheria|Rep: PREDICTED: similar to Actin-5C -
            Canis familiaris
          Length = 1248

 Score = 89.8 bits (213), Expect = 5e-17
 Identities = 38/79 (48%), Positives = 56/79 (70%), Gaps = 1/79 (1%)
 Frame = +3

Query: 276  YPI-EHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETF 452
            YP+   G+V++WD +E +W H FY  L V PEE  VL+ ++P++P+ NREK+ +I+FE F
Sbjct: 952  YPVLNRGVVSDWDALEVLWQHLFYCRLGVRPEELAVLVADSPISPRTNREKVAEILFERF 1011

Query: 453  NTPAMYVAIQAVLSLYASG 509
            + PAM    QA+L+LYA G
Sbjct: 1012 HVPAMQTVHQALLALYAYG 1030



 Score = 33.5 bits (73), Expect = 4.3
 Identities = 15/38 (39%), Positives = 24/38 (63%)
 Frame = +1

Query: 79   EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRH 192
            +++AA+V+D G+G  K G A +D   +V PS V   +H
Sbjct: 897  QDMAAVVIDTGTGFTKCGLAREDHVLSVLPSRVQLLQH 934


>UniRef50_A0E1S8 Cluster: Chromosome undetermined scaffold_73, whole
           genome shotgun sequence; n=1; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_73,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 383

 Score = 89.0 bits (211), Expect = 8e-17
 Identities = 47/108 (43%), Positives = 63/108 (58%), Gaps = 1/108 (0%)
 Frame = +3

Query: 264 LTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPE-EHPVLLTEAPLNPKANREKMTQIM 440
           L+LKYPI+ GI+ +WD +  I     +N+  +  E EHP+LLTE P+NP ANREK  QI+
Sbjct: 66  LSLKYPIQRGIINDWDGIIYINMILIWNQFGIMQESEHPILLTEVPINPNANREKTMQIL 125

Query: 441 FETFNTPAMYVAIQAVLSLYASGVPPVSCWTSATVSSTPCPFTKGYAL 584
           FETF  P + +  +AVL LYA G        S    +   P  +GY L
Sbjct: 126 FETFQAPLISLVNKAVLPLYAVGKLTGVVVDSGQDDTNIVPVYEGYYL 173



 Score = 45.6 bits (103), Expect = 0.001
 Identities = 23/54 (42%), Positives = 32/54 (59%)
 Frame = +1

Query: 94  LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 255
           +V+DNGS   KAGF G  AP    P++VGRP+ +        +D Y G+EA +K
Sbjct: 11  IVIDNGSYELKAGFQGHYAPSCRIPTVVGRPKLENSDEDF--EDQYFGEEAMAK 62


>UniRef50_Q7M3Y6 Cluster: Actin homolog fat, testicular; n=3;
           Deuterostomia|Rep: Actin homolog fat, testicular -
           Pisaster ochraceus (Sea star)
          Length = 155

 Score = 88.6 bits (210), Expect = 1e-16
 Identities = 46/65 (70%), Positives = 47/65 (72%)
 Frame = +3

Query: 393 APLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGVPPVSCWTSATVSSTPCPFTK 572
           APLNPKANREKMTQIMFETFNTPAMYV IQAVLSLYASG        S    S   P  +
Sbjct: 1   APLNPKANREKMTQIMFETFNTPAMYVGIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYE 60

Query: 573 GYALP 587
           GYALP
Sbjct: 61  GYALP 65


>UniRef50_UPI0000E23780 Cluster: PREDICTED: hypothetical protein
           isoform 2; n=2; Amniota|Rep: PREDICTED: hypothetical
           protein isoform 2 - Pan troglodytes
          Length = 179

 Score = 87.4 bits (207), Expect = 2e-16
 Identities = 42/83 (50%), Positives = 52/83 (62%)
 Frame = -2

Query: 500 VQREHGLDGDVHGGRVECFEHDXXXXXXXXXXXXXXXXEQDWVFLGGDTQLIVEGMMPNL 321
           VQ +HGLDG VHG  VE  +HD                +QD V LG  TQL+VEG++P+L
Sbjct: 31  VQGQHGLDGHVHGWGVEGLKHDLGHLLVVGLGVQGCLGQQDGVLLGSHTQLVVEGVVPDL 90

Query: 320 LHVIPVSDDSVFDGVFEGQDTSL 252
           LHV+PV DD+V  GV +GQD SL
Sbjct: 91  LHVVPVGDDAVLHGVLQGQDASL 113



 Score = 55.6 bits (128), Expect = 9e-07
 Identities = 30/73 (41%), Positives = 40/73 (54%)
 Frame = -1

Query: 270 GSGYLFALCLISYIRVLLSHTDHHALMAGPSHDRGEHGARSIISCETGLAHTGAIVYYQR 91
           G     AL LI++I + L H  HHAL+ G  HD  E     II+C+ GLAH  A+V    
Sbjct: 108 GQDASLALGLIAHIGLHLMHAPHHALVPGAPHDGREDSPGGIITCKAGLAHARAVVNDGH 167

Query: 90  GNFFVAHLELVKL 52
           G   + H EL++L
Sbjct: 168 GGIII-HGELIQL 179


>UniRef50_Q8LKR2 Cluster: Actin-related protein 4; n=7; core
           eudicotyledons|Rep: Actin-related protein 4 -
           Arabidopsis thaliana (Mouse-ear cress)
          Length = 442

 Score = 87.0 bits (206), Expect = 3e-16
 Identities = 41/102 (40%), Positives = 60/102 (58%)
 Frame = +3

Query: 279 PIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNT 458
           PI+ GIV++WD ++ IW H F + L + P EHP+LL E PLN +  REK  ++MFE +  
Sbjct: 95  PIKDGIVSDWDLVDNIWEHAFKSCLMIDPTEHPMLLAEPPLNTQQQREKAAELMFEKYKV 154

Query: 459 PAMYVAIQAVLSLYASGVPPVSCWTSATVSSTPCPFTKGYAL 584
           PA+++A   VL+ +A+G            S+T  P   GY L
Sbjct: 155 PALFMAKNPVLTSFATGRATSLVVDCGGGSTTISPVHDGYVL 196



 Score = 56.8 bits (131), Expect = 4e-07
 Identities = 23/34 (67%), Positives = 31/34 (91%)
 Frame = +1

Query: 79  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVG 180
           +EV+A+VVD GS  CKAG+AG+DAP+AVFPS++G
Sbjct: 6   DEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSVIG 39


>UniRef50_Q4DMP2 Cluster: Actin-related protein 2, putative; n=4;
           Trypanosoma|Rep: Actin-related protein 2, putative -
           Trypanosoma cruzi
          Length = 403

 Score = 85.0 bits (201), Expect = 1e-15
 Identities = 42/111 (37%), Positives = 65/111 (58%)
 Frame = +3

Query: 255 RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQ 434
           R +L + YPI +GI+ N D+M  +W +TF   L++ P EH +LL+E PL    +R  + +
Sbjct: 77  RHLLDMTYPIRNGIIQNMDEMCHLWDYTFGEMLQINPSEHRLLLSEVPLFSSKHRCHLYE 136

Query: 435 IMFETFNTPAMYVAIQAVLSLYASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           +MFE +N  A+  A+Q  LSL+++G+       S    S   P  +GYALP
Sbjct: 137 VMFEKYNFMAIQSAVQGTLSLFSNGLQTGVAVESGEGISHCTPIFEGYALP 187



 Score = 41.5 bits (93), Expect = 0.016
 Identities = 18/35 (51%), Positives = 24/35 (68%)
 Frame = +1

Query: 82  EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRP 186
           E   +V+DNGSG  K G+AG + P AVF + +GRP
Sbjct: 4   EKRPVVLDNGSGFIKCGYAGANFPTAVFQTALGRP 38


>UniRef50_O96019 Cluster: Actin-like protein 6A; n=63;
           Eumetazoa|Rep: Actin-like protein 6A - Homo sapiens
           (Human)
          Length = 429

 Score = 83.8 bits (198), Expect = 3e-15
 Identities = 38/102 (37%), Positives = 60/102 (58%)
 Frame = +3

Query: 279 PIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNT 458
           P+++G+V +WD  + I  HT+   ++     HPVL++EAP N +A REK+T++MFE +N 
Sbjct: 87  PLKNGMVEDWDSFQAILDHTYKMHVKSEASLHPVLMSEAPWNTRAKREKLTELMFEHYNI 146

Query: 459 PAMYVAIQAVLSLYASGVPPVSCWTSATVSSTPCPFTKGYAL 584
           PA ++   AVL+ +A+G        S    +T  P   GY L
Sbjct: 147 PAFFLCKTAVLTAFANGRSTGLILDSGATHTTAIPVHDGYVL 188



 Score = 40.7 bits (91), Expect = 0.028
 Identities = 17/34 (50%), Positives = 24/34 (70%)
 Frame = +1

Query: 79  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVG 180
           +EV ALV D GS   +AG+AG+D P+  FP+ +G
Sbjct: 9   DEVGALVFDIGSYTVRAGYAGEDCPKVDFPTAIG 42


>UniRef50_UPI0000E47BC7 Cluster: PREDICTED: similar to ubiquitin/actin
            fusion protein; n=1; Strongylocentrotus purpuratus|Rep:
            PREDICTED: similar to ubiquitin/actin fusion protein -
            Strongylocentrotus purpuratus
          Length = 1608

 Score = 83.4 bits (197), Expect = 4e-15
 Identities = 36/80 (45%), Positives = 53/80 (66%)
 Frame = +3

Query: 270  LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 449
            L+Y    G+V NW ++E IW H   +EL V  E+HP+LLTE    PK  RE++ +++FET
Sbjct: 1303 LRYLPIGGVVDNWAELEHIWDHVVSHELNVKWEDHPILLTELASAPKRQRERILEVLFET 1362

Query: 450  FNTPAMYVAIQAVLSLYASG 509
            + TPA +V  Q  L+L+A+G
Sbjct: 1363 YKTPACFVVNQGALALHANG 1382



 Score = 43.6 bits (98), Expect = 0.004
 Identities = 21/54 (38%), Positives = 32/54 (59%)
 Frame = +1

Query: 94   LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 255
            +++DNGS M +AG A   AP    P++VGR + + +     +KD YVG+E   K
Sbjct: 1236 IILDNGSSMLRAGLADGVAPSVTMPTVVGRLK-KDIESYRNRKDVYVGNELTKK 1288


>UniRef50_A3BPG0 Cluster: Putative uncharacterized protein; n=3;
           Oryza sativa|Rep: Putative uncharacterized protein -
           Oryza sativa subsp. japonica (Rice)
          Length = 467

 Score = 83.0 bits (196), Expect = 5e-15
 Identities = 34/77 (44%), Positives = 51/77 (66%)
 Frame = +3

Query: 279 PIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNT 458
           P++ G VT+WD ++ IW+H F   L + PEEHP+L+ E   N    REK  ++MFE +  
Sbjct: 122 PMKDGTVTDWDIVDNIWNHAFRQRLLINPEEHPMLIAEPSTNTGQQREKAAELMFEKYKV 181

Query: 459 PAMYVAIQAVLSLYASG 509
           PA+++A  AVL+ +ASG
Sbjct: 182 PALFLAKNAVLTSFASG 198



 Score = 52.0 bits (119), Expect = 1e-05
 Identities = 21/32 (65%), Positives = 28/32 (87%)
 Frame = +1

Query: 79  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSI 174
           +EV+A+V+D GS  CKAG+AGDD P+AVFPS+
Sbjct: 5   DEVSAIVIDVGSYSCKAGYAGDDTPKAVFPSL 36


>UniRef50_UPI0000F2D272 Cluster: PREDICTED: similar to actin; n=1;
           Monodelphis domestica|Rep: PREDICTED: similar to actin -
           Monodelphis domestica
          Length = 790

 Score = 81.0 bits (191), Expect = 2e-14
 Identities = 36/80 (45%), Positives = 55/80 (68%)
 Frame = +3

Query: 273 KYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETF 452
           ++ I+ G V NWD ME IW+++F + L +  + HPVL+TE P N +  R+K  +IM ETF
Sbjct: 141 QFAIDRGRVLNWDAMEDIWYYSF-DYLGIKTKNHPVLITEFPRNDENYRQKTLEIMMETF 199

Query: 453 NTPAMYVAIQAVLSLYASGV 512
           N P++++  QA LSL+ SG+
Sbjct: 200 NVPSLHIGNQAELSLFGSGL 219



 Score = 48.0 bits (109), Expect = 2e-04
 Identities = 22/69 (31%), Positives = 39/69 (56%)
 Frame = +3

Query: 264 LTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMF 443
           L  ++ I  G +TNW+ ME IW + F  EL     +HP+L+T  P+N +   + +T++  
Sbjct: 489 LRTEFVINRGTITNWEAMESIWRYIF-GELNSGSMDHPLLITGLPMNDEYCLQLVTELF- 546

Query: 444 ETFNTPAMY 470
             FN+  ++
Sbjct: 547 -AFNSSFLF 554



 Score = 39.1 bits (87), Expect = 0.086
 Identities = 17/33 (51%), Positives = 22/33 (66%)
 Frame = +1

Query: 82  EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVG 180
           E + LVVD GS  CKAG+ G+  P  + PS+VG
Sbjct: 423 ERSCLVVDIGSACCKAGWCGEKFPPIIVPSVVG 455



 Score = 35.9 bits (79), Expect = 0.80
 Identities = 15/33 (45%), Positives = 22/33 (66%)
 Frame = +1

Query: 82  EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVG 180
           E +++V+D GS  CKAG A ++ P    PS+VG
Sbjct: 68  ESSSVVIDIGSAWCKAGLAMENYPTLAVPSVVG 100


>UniRef50_Q9N4N4 Cluster: Putative uncharacterized protein; n=2;
           Caenorhabditis|Rep: Putative uncharacterized protein -
           Caenorhabditis elegans
          Length = 436

 Score = 81.0 bits (191), Expect = 2e-14
 Identities = 39/101 (38%), Positives = 58/101 (57%)
 Frame = +3

Query: 282 IEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTP 461
           ++ G++ +W+  EKI  H++ N L   P EHPVL +E+  N +A REK+T+IMFE F  P
Sbjct: 94  MKEGLIEDWELFEKIVEHSYENILYSNPSEHPVLFSESSWNDRARREKLTEIMFEKFQVP 153

Query: 462 AMYVAIQAVLSLYASGVPPVSCWTSATVSSTPCPFTKGYAL 584
           A Y++   VLS +A G        S    ++  P   GYA+
Sbjct: 154 AYYLSKNVVLSCFAQGRTHGLMVDSGATQTSVVPVFDGYAV 194



 Score = 33.5 bits (73), Expect = 4.3
 Identities = 14/33 (42%), Positives = 21/33 (63%)
 Frame = +1

Query: 79  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIV 177
           +EV+ LV D GS   + GFAG++ P+   PS +
Sbjct: 9   DEVSGLVFDAGSQSFRVGFAGEEYPKGDIPSYI 41


>UniRef50_Q8IS27 Cluster: Actin-related protein 2; n=5;
           Oligohymenophorea|Rep: Actin-related protein 2 -
           Tetrahymena thermophila
          Length = 393

 Score = 80.6 bits (190), Expect = 3e-14
 Identities = 41/111 (36%), Positives = 61/111 (54%)
 Frame = +3

Query: 255 RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQ 434
           + +L L  P+E G V NW DME +W ++F  +L    + + VL+TE  LNP  NR+K  +
Sbjct: 63  QAMLELTKPVEEGTVKNWQDMELLWDYSF-KKLGAETKGNTVLMTEPVLNPAQNRKKTAE 121

Query: 435 IMFETFNTPAMYVAIQAVLSLYASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           ++FE FN   M + IQA+LSLY  G+       S    +   P  + + LP
Sbjct: 122 VLFEQFNFGRMQIGIQALLSLYCEGLTTGMLLDSGDGVTHCIPVYENFILP 172



 Score = 39.5 bits (88), Expect = 0.065
 Identities = 19/53 (35%), Positives = 32/53 (60%), Gaps = 2/53 (3%)
 Frame = +1

Query: 94  LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRP--RHQGVMVGMGQKDSYVGDEA 246
           +V D+G+G  K G+AGD+ P+   P+++GRP  R    +  +  K+  +G EA
Sbjct: 7   IVCDSGTGYIKIGYAGDNFPKYSIPAMIGRPMLRFNQKIDDVELKEIMIGGEA 59


>UniRef50_Q6BG23 Cluster: Actin, putative; n=1; Paramecium
           tetraurelia|Rep: Actin, putative - Paramecium
           tetraurelia
          Length = 328

 Score = 79.8 bits (188), Expect = 5e-14
 Identities = 39/105 (37%), Positives = 58/105 (55%)
 Frame = +3

Query: 270 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 449
           +KYPI +  + ++D ME +WH  F+  L   PE+  +L+T      K  +EK TQIMFET
Sbjct: 21  IKYPILNSKIVDFDTMETVWHKAFFEYLMTNPEDSSILITSQLNTSKNEKEKTTQIMFET 80

Query: 450 FNTPAMYVAIQAVLSLYASGVPPVSCWTSATVSSTPCPFTKGYAL 584
           FN     + IQ++LSL++SG        S   ++   P  +GY L
Sbjct: 81  FNISKFIIQIQSILSLFSSGKTTGFVVDSGNDTTYFVPIYEGYKL 125


>UniRef50_Q4QF44 Cluster: Actin-related protein 3, putative; n=3;
           Leishmania|Rep: Actin-related protein 3, putative -
           Leishmania major
          Length = 405

 Score = 79.0 bits (186), Expect = 9e-14
 Identities = 42/104 (40%), Positives = 54/104 (51%), Gaps = 2/104 (1%)
 Frame = +3

Query: 279 PIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNT 458
           P+EHG+V NWD ME+ W H F   L V P++  VLLTEA + P   RE   +IMFE+F  
Sbjct: 68  PLEHGLVVNWDVMEEYWCHLFNRYLCVEPQDVGVLLTEAAVTPYEQREMTAEIMFESFGV 127

Query: 459 PAMYVAIQA--VLSLYASGVPPVSCWTSATVSSTPCPFTKGYAL 584
           P + +  QA  VLS    G        S    +   P   GYA+
Sbjct: 128 PRLCIGSQALFVLSSVGDGCDTAVVVESGAGVTQVVPIVAGYAV 171


>UniRef50_UPI000049A548 Cluster: actin; n=1; Entamoeba histolytica
           HM-1:IMSS|Rep: actin - Entamoeba histolytica HM-1:IMSS
          Length = 365

 Score = 78.6 bits (185), Expect = 1e-13
 Identities = 37/82 (45%), Positives = 53/82 (64%)
 Frame = +3

Query: 264 LTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMF 443
           L L+ PI+ GI+ +W+D+E IW   F  EL+V   +  V+LT+A L P  ++EKM QIMF
Sbjct: 55  LNLQQPIQRGIINDWNDIEDIWDFAF-EELQVESSDQVVMLTQAALTPPIHKEKMAQIMF 113

Query: 444 ETFNTPAMYVAIQAVLSLYASG 509
           E F    + V +Q++L LY SG
Sbjct: 114 EGFGMKGLDVMMQSLLELYFSG 135



 Score = 42.3 bits (95), Expect = 0.009
 Identities = 15/41 (36%), Positives = 27/41 (65%)
 Frame = +1

Query: 94  LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMG 216
           +++DNGSG+ KAG + ++ P+ VFP +VG  +    +  +G
Sbjct: 6   IIIDNGSGLIKAGESSEELPKIVFPCVVGHSKETNKLENIG 46


>UniRef50_Q5CSX9 Cluster: Actin; n=2; Cryptosporidium|Rep: Actin -
           Cryptosporidium parvum Iowa II
          Length = 405

 Score = 77.4 bits (182), Expect = 3e-13
 Identities = 37/110 (33%), Positives = 66/110 (60%), Gaps = 1/110 (0%)
 Frame = +3

Query: 252 QRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 431
           QR  L+L +PI+HG + +W   E++ ++ FY  L + P +  V++T+ PL    + EK+T
Sbjct: 75  QRKKLSLTFPIDHGHIDDWTKFEELLNYLFYRGLDIDPIDSSVIITKPPLCSNRHEEKIT 134

Query: 432 QIMFETFNTPAMYVAIQAVLSLYASG-VPPVSCWTSATVSSTPCPFTKGY 578
           ++MFE F T ++ +A+Q +++LY++G    V+C     V+    P   GY
Sbjct: 135 ELMFEMFQTQSLNIALQGLMALYSAGRTTGVACDIGEGVTQV-VPVYDGY 183



 Score = 40.7 bits (91), Expect = 0.028
 Identities = 20/51 (39%), Positives = 29/51 (56%)
 Frame = +1

Query: 94  LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA 246
           +V+D GS   KAG   D +P  +FPS+VG+ R + V         +VG+EA
Sbjct: 22  IVIDCGSAYMKAGTDSDKSPTCIFPSMVGQYRSRYVPEDEDNNPIFVGEEA 72


>UniRef50_A2DNQ0 Cluster: Actin family protein; n=1; Trichomonas
           vaginalis G3|Rep: Actin family protein - Trichomonas
           vaginalis G3
          Length = 358

 Score = 77.4 bits (182), Expect = 3e-13
 Identities = 31/81 (38%), Positives = 53/81 (65%)
 Frame = +3

Query: 267 TLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFE 446
           T + PIE+ ++TN+D+M++IW   F  +L++ PE+HP L+ ++ LN   NR++  QI  E
Sbjct: 56  TFRSPIENRVITNFDNMKRIWQELFTEQLQIQPEQHPFLVADSALNSLENRQQTLQIFME 115

Query: 447 TFNTPAMYVAIQAVLSLYASG 509
            +N P+   A  + L+LY +G
Sbjct: 116 EYNVPSFCPAFASSLALYNAG 136



 Score = 33.5 bits (73), Expect = 4.3
 Identities = 14/26 (53%), Positives = 17/26 (65%)
 Frame = +1

Query: 94  LVVDNGSGMCKAGFAGDDAPRAVFPS 171
           +V+D G  + KAGF GD  P  VFPS
Sbjct: 6   IVLDCGGSIIKAGFGGDSEPGIVFPS 31


>UniRef50_Q9H568 Cluster: Actin-like protein 8; n=10; Eutheria|Rep:
           Actin-like protein 8 - Homo sapiens (Human)
          Length = 366

 Score = 76.2 bits (179), Expect = 6e-13
 Identities = 40/107 (37%), Positives = 59/107 (55%)
 Frame = +3

Query: 267 TLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFE 446
           T  YPIE G + NW+ ++ +W     N  R   E  PV++TE PL   A+R+KM +I+FE
Sbjct: 62  TFSYPIERGRILNWEGVQYLWSFVLENHRR-EQEVPPVIITETPLREPADRKKMLEILFE 120

Query: 447 TFNTPAMYVAIQAVLSLYASGVPPVSCWTSATVSSTPCPFTKGYALP 587
             + P++ +A Q  +SLYASG+       S    +   PF +G  LP
Sbjct: 121 LLHVPSVLLADQLQMSLYASGLLTGVVVDSGYGLTRVQPFHQGRPLP 167



 Score = 36.7 bits (81), Expect = 0.46
 Identities = 15/28 (53%), Positives = 22/28 (78%)
 Frame = +1

Query: 94  LVVDNGSGMCKAGFAGDDAPRAVFPSIV 177
           +++D+GSG  KAG AG + P+ VFP+IV
Sbjct: 6   VIIDHGSGFLKAGTAGWNEPQMVFPNIV 33


>UniRef50_UPI00015B6274 Cluster: PREDICTED: similar to putative mRNA
           splicing factor; n=1; Nasonia vitripennis|Rep:
           PREDICTED: similar to putative mRNA splicing factor -
           Nasonia vitripennis
          Length = 515

 Score = 74.1 bits (174), Expect = 2e-12
 Identities = 37/83 (44%), Positives = 50/83 (60%)
 Frame = -2

Query: 500 VQREHGLDGDVHGGRVECFEHDXXXXXXXXXXXXXXXXEQDWVFLGGDTQLIVEGMMPNL 321
           ++R+  L+  VH  RVE  EHD                E++ +FL GD QL+VEG+MP+L
Sbjct: 357 IERQDSLNSYVHSRRVERLEHDLRHLLSVGLRVERSLGEENGMFLWGDAQLVVEGVMPDL 416

Query: 320 LHVIPVSDDSVFDGVFEGQDTSL 252
           LHVIPV D SV D +F  +DT+L
Sbjct: 417 LHVIPVGDYSVLDRIFNREDTAL 439



 Score = 51.6 bits (118), Expect = 2e-05
 Identities = 28/70 (40%), Positives = 43/70 (61%), Gaps = 10/70 (14%)
 Frame = -1

Query: 249 LCLISYIRVLLSHTDHHAL----------MAGPSHDRGEHGARSIISCETGLAHTGAIVY 100
           L L++Y+ VLL+H DH AL          +AGP+ D  + G+R +++ ET LAH+ +IV 
Sbjct: 441 LGLVAYVGVLLAHADHDALWIKSMVDTHLIAGPADDGWKDGSRRVVAGETSLAHSRSIVN 500

Query: 99  YQRGNFFVAH 70
           ++ G   VAH
Sbjct: 501 HESGYVVVAH 510


>UniRef50_UPI0000EC9F4D Cluster: HSD21.; n=2; Gallus gallus|Rep:
           HSD21. - Gallus gallus
          Length = 373

 Score = 72.9 bits (171), Expect = 6e-12
 Identities = 31/76 (40%), Positives = 48/76 (63%)
 Frame = +3

Query: 282 IEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTP 461
           + +G + NW+  E + ++   +ELRV PE+H +LLTE   +P ++RE M ++ FE   TP
Sbjct: 73  MHNGFIINWEAAENLCYYLLKHELRVNPEDHALLLTEPLFSPTSSRENMAEMAFEVLGTP 132

Query: 462 AMYVAIQAVLSLYASG 509
            ++VA Q VLS Y  G
Sbjct: 133 GLFVAPQPVLSAYTHG 148



 Score = 32.3 bits (70), Expect = 9.9
 Identities = 15/41 (36%), Positives = 25/41 (60%), Gaps = 1/41 (2%)
 Frame = +1

Query: 94  LVVDNGSGMCKAGFAGDDAPRAVFPSIVG-RPRHQGVMVGM 213
           +V+D G+  C+AGF+G  +P A   ++VG R   +G   G+
Sbjct: 15  IVIDMGTRSCRAGFSGHYSPSAEVSTLVGHRMGSEGASAGV 55


>UniRef50_Q5KLG9 Cluster: 53 kDa brg1-associated factor b
           (Actin-related protein baf53b), putative; n=1;
           Filobasidiella neoformans|Rep: 53 kDa brg1-associated
           factor b (Actin-related protein baf53b), putative -
           Cryptococcus neoformans (Filobasidiella neoformans)
          Length = 476

 Score = 72.9 bits (171), Expect = 6e-12
 Identities = 43/138 (31%), Positives = 64/138 (46%)
 Frame = +3

Query: 171 DRGKAPPSGRDGRYGTEGLLCRR*GTEQRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNE 350
           ++ K   SGR    G +G+   R G E    +        G+V + +    + HH  +  
Sbjct: 79  EQSKKKGSGRKYYVGEDGVSVWRPGMEVGNFML------DGVVNDPEPASALLHHILHER 132

Query: 351 LRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGVPPVSCW 530
           L V PEEHP+++TE   N    R+ MT++ FE    PA+Y     VLS +A+G P     
Sbjct: 133 LGVNPEEHPIMITEPAWNTPKARQVMTEMAFEGEKMPALYFGSSGVLSAFAAGKPTALVL 192

Query: 531 TSATVSSTPCPFTKGYAL 584
                +S+  P   GYAL
Sbjct: 193 DVGYATSSAVPIVDGYAL 210



 Score = 42.7 bits (96), Expect = 0.007
 Identities = 19/34 (55%), Positives = 25/34 (73%)
 Frame = +1

Query: 79  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVG 180
           +EV+ALV+D GS   +AG+AG+D PR V PS  G
Sbjct: 6   DEVSALVLDFGSYTTRAGYAGEDCPRVVCPSFYG 39


>UniRef50_Q19R57 Cluster: Actin-like protein 1; n=2; Trypanosoma
           cruzi|Rep: Actin-like protein 1 - Trypanosoma cruzi
           strain CL Brener
          Length = 390

 Score = 72.1 bits (169), Expect = 1e-11
 Identities = 32/81 (39%), Positives = 50/81 (61%)
 Frame = +3

Query: 267 TLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFE 446
           TL +PI HGIV +W  ME++ HHTF  E  +  EE  ++ TE    PK N E++ +++FE
Sbjct: 68  TLHHPIRHGIVKDWPRMEQVIHHTFV-EFGMNSEETSIVCTEPLFTPKRNSEQLAEVLFE 126

Query: 447 TFNTPAMYVAIQAVLSLYASG 509
            F  P++ +    + +LY+SG
Sbjct: 127 AFGVPSIALIPSGMCALYSSG 147



 Score = 34.3 bits (75), Expect = 2.4
 Identities = 13/21 (61%), Positives = 16/21 (76%)
 Frame = +2

Query: 509 RTTGIVLDFGDGVFHTVPIYE 571
           RTTG+VLD GDGV    P+Y+
Sbjct: 148 RTTGVVLDSGDGVTQVTPVYD 168



 Score = 33.9 bits (74), Expect = 3.2
 Identities = 13/31 (41%), Positives = 20/31 (64%)
 Frame = +1

Query: 94  LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRP 186
           ++VD GS + KAG   +  P  +FP++VG P
Sbjct: 2   IIVDFGSSLVKAGTVTESLPSLIFPAVVGVP 32


>UniRef50_UPI00006C1719 Cluster: PREDICTED: similar to actin, alpha
           2, smooth muscle, aorta; n=3; Homo/Pan/Gorilla
           group|Rep: PREDICTED: similar to actin, alpha 2, smooth
           muscle, aorta - Homo sapiens
          Length = 183

 Score = 71.7 bits (168), Expect = 1e-11
 Identities = 30/36 (83%), Positives = 33/36 (91%)
 Frame = +3

Query: 258 GILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAP 365
           GILTLKYPIE G+VTN DDMEKIWHHTFYN+LR+ P
Sbjct: 17  GILTLKYPIEQGMVTNRDDMEKIWHHTFYNKLRLHP 52



 Score = 35.1 bits (77), Expect = 1.4
 Identities = 15/15 (100%), Positives = 15/15 (100%)
 Frame = +1

Query: 211 MGQKDSYVGDEAQSK 255
           MGQKDSYVGDEAQSK
Sbjct: 1   MGQKDSYVGDEAQSK 15


>UniRef50_Q6FRF2 Cluster: Similar to sp|P38696 Saccharomyces
           cerevisiae YHR129c ACT5; n=1; Candida glabrata|Rep:
           Similar to sp|P38696 Saccharomyces cerevisiae YHR129c
           ACT5 - Candida glabrata (Yeast) (Torulopsis glabrata)
          Length = 387

 Score = 71.7 bits (168), Expect = 1e-11
 Identities = 31/88 (35%), Positives = 51/88 (57%), Gaps = 1/88 (1%)
 Frame = +3

Query: 249 EQRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAP-EEHPVLLTEAPLNPKANREK 425
           E+R  L L+ P     + +WD +E +W +   N+L +   +EHPV+LT +    K   EK
Sbjct: 65  ERRATLHLESPYSTNAIMSWDRLEDLWDYVLLNKLEIEQLQEHPVVLTNSMSTSKKEEEK 124

Query: 426 MTQIMFETFNTPAMYVAIQAVLSLYASG 509
           M +++FE F+ PA+Y +   ++SLY  G
Sbjct: 125 MCEVLFEKFSIPAIYCSRDPIMSLYGLG 152



 Score = 45.6 bits (103), Expect = 0.001
 Identities = 19/54 (35%), Positives = 33/54 (61%)
 Frame = +1

Query: 94  LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 255
           +++DNGS + KAGFAG   P  +  + +G P  +  MV +  K++Y+G+ A  +
Sbjct: 13  VILDNGSSVIKAGFAGSQQPDVLEYAWIGNPLAERSMVTVSNKETYIGNSAYER 66


>UniRef50_Q9LZY1 Cluster: Actin-like protein; n=4; core
           eudicotyledons|Rep: Actin-like protein - Arabidopsis
           thaliana (Mouse-ear cress)
          Length = 368

 Score = 69.7 bits (163), Expect = 5e-11
 Identities = 35/78 (44%), Positives = 46/78 (58%), Gaps = 1/78 (1%)
 Frame = +3

Query: 279 PIEHGIVTNWDDMEKIWHHTFYNELRVAP-EEHPVLLTEAPLNPKANREKMTQIMFETFN 455
           PIE G++ +WD ME +  +  Y  L      E  +L T+    PKA RE++ Q+MFETFN
Sbjct: 57  PIERGLIRDWDAMEDLLRYVVYTGLGWEEGNEGNILFTDPLCTPKAIREQLVQLMFETFN 116

Query: 456 TPAMYVAIQAVLSLYASG 509
               Y + QAVLSLYA G
Sbjct: 117 VSGFYASEQAVLSLYAVG 134


>UniRef50_Q9P7X7 Cluster: Actin-related protein 4; n=1;
           Schizosaccharomyces pombe|Rep: Actin-related protein 4 -
           Schizosaccharomyces pombe (Fission yeast)
          Length = 433

 Score = 69.3 bits (162), Expect = 7e-11
 Identities = 32/82 (39%), Positives = 46/82 (56%)
 Frame = +3

Query: 264 LTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMF 443
           + +K  I +G V NWD    +W +    +L+  P EHP+L+TE   NP  NR K  + MF
Sbjct: 63  MEIKNAIRNGWVENWDVTVDLWRYGLEQQLKTNPLEHPILITEPFDNPPENRVKTLETMF 122

Query: 444 ETFNTPAMYVAIQAVLSLYASG 509
           E+   PA Y+A Q   + +ASG
Sbjct: 123 ESLRCPATYLAKQETCAAFASG 144



 Score = 40.3 bits (90), Expect = 0.037
 Identities = 16/34 (47%), Positives = 24/34 (70%)
 Frame = +1

Query: 79  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVG 180
           +EV+A+V+D GS   + GF+G+D P+ V PS  G
Sbjct: 9   DEVSAIVIDPGSKWTRIGFSGEDIPKCVLPSYCG 42


>UniRef50_A4RW28 Cluster: Predicted protein; n=2; Ostreococcus|Rep:
           Predicted protein - Ostreococcus lucimarinus CCE9901
          Length = 425

 Score = 68.1 bits (159), Expect = 2e-10
 Identities = 31/75 (41%), Positives = 46/75 (61%)
 Frame = +3

Query: 285 EHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPA 464
           E+G++ +W+ +E IW H     L +  +EHPVLL+E   N  A R KM ++MFE    PA
Sbjct: 80  ENGMLEDWEAVEAIWEHALKKRLALQTDEHPVLLSEPVHNSDAVRAKMVELMFEKHAPPA 139

Query: 465 MYVAIQAVLSLYASG 509
           +++A   VLS +A G
Sbjct: 140 LFLAKSPVLSSFAVG 154



 Score = 44.4 bits (100), Expect = 0.002
 Identities = 19/34 (55%), Positives = 26/34 (76%)
 Frame = +1

Query: 79  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVG 180
           +EV+A+V+D G+   KAG+AG D P+ VFPS VG
Sbjct: 5   DEVSAVVIDLGTHSVKAGYAGQDTPQHVFPSAVG 38


>UniRef50_A2ECQ8 Cluster: Actin family protein; n=1; Trichomonas
           vaginalis G3|Rep: Actin family protein - Trichomonas
           vaginalis G3
          Length = 371

 Score = 67.3 bits (157), Expect = 3e-10
 Identities = 35/112 (31%), Positives = 56/112 (50%)
 Frame = +3

Query: 252 QRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 431
           +  +L L  PIE+G+V NW+   ++W   F N+     E+  +L  E P   + N+ KM 
Sbjct: 60  KENLLNLVNPIENGVVQNWEFQTQLWDELFANQFHCPLEDVCILTGEKPACTQQNKAKMA 119

Query: 432 QIMFETFNTPAMYVAIQAVLSLYASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           QI+FE FN        Q+VLSL++ G      + +     +  P  +GY +P
Sbjct: 120 QILFEKFNCGGFSSIQQSVLSLFSIGRRTGLVFDNGEGLGSIVPVYEGYTIP 171



 Score = 52.8 bits (121), Expect = 7e-06
 Identities = 23/58 (39%), Positives = 36/58 (62%)
 Frame = +1

Query: 82  EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 255
           ++  +V+DNG+   KAGFAG   P  + P++VG  +    MVG+  K  +VG+EA +K
Sbjct: 3   DMKTIVIDNGTFSVKAGFAGTKKPHFIIPTVVGTAKENADMVGIKNKAYFVGNEALAK 60


>UniRef50_Q8IIQ4 Cluster: Actin, putative; n=7; Apicomplexa|Rep:
           Actin, putative - Plasmodium falciparum (isolate 3D7)
          Length = 392

 Score = 66.9 bits (156), Expect = 4e-10
 Identities = 31/83 (37%), Positives = 54/83 (65%)
 Frame = +3

Query: 264 LTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMF 443
           L +  PI+HG +++WD  +K+W +T  N +  +     +LLTE PL   ++R+KM +I F
Sbjct: 57  LNIYRPIDHGHISDWDKAQKVWDYTL-NCVDPSKSIKDILLTEPPLCSISHRKKMGEIFF 115

Query: 444 ETFNTPAMYVAIQAVLSLYASGV 512
           E F+T  + +++  ++SLYASG+
Sbjct: 116 EYFDTLNLNLSVSGLMSLYASGL 138



 Score = 41.1 bits (92), Expect = 0.021
 Identities = 23/55 (41%), Positives = 29/55 (52%)
 Frame = +1

Query: 82  EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA 246
           E   +V+DNGSG  KAG    + P  VFP+IVG  ++         K  Y GDEA
Sbjct: 2   ENKTIVIDNGSGYIKAGINSSEEPTIVFPTIVGIEKNDET------KRIYTGDEA 50


>UniRef50_Q4N7N1 Cluster: Actin, putative; n=2; Theileria|Rep:
           Actin, putative - Theileria parva
          Length = 383

 Score = 64.9 bits (151), Expect = 2e-09
 Identities = 30/82 (36%), Positives = 50/82 (60%)
 Frame = +3

Query: 264 LTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMF 443
           ++L + I+HG ++++D ME +W + F   L V  +  PVLLTEAP     +R K ++I F
Sbjct: 62  MSLDHLIDHGHISDFDKMEGLWQYCF-TRLEVHSDCRPVLLTEAPFTSPKHRIKSSEIFF 120

Query: 444 ETFNTPAMYVAIQAVLSLYASG 509
           E FN   + +++  +LS+Y  G
Sbjct: 121 ERFNVDDLNISVAGLLSMYGLG 142



 Score = 35.5 bits (78), Expect = 1.1
 Identities = 17/40 (42%), Positives = 24/40 (60%)
 Frame = +1

Query: 70  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPR 189
           M DE+   +V+DNGS   K G +G  +P  +  S+VG PR
Sbjct: 1   MADEQ--CVVIDNGSFSLKIGLSGSYSPSFIVHSVVGNPR 38


>UniRef50_Q22WQ4 Cluster: Actin family protein; n=1; Tetrahymena
           thermophila SB210|Rep: Actin family protein -
           Tetrahymena thermophila SB210
          Length = 444

 Score = 64.9 bits (151), Expect = 2e-09
 Identities = 31/99 (31%), Positives = 53/99 (53%)
 Frame = +3

Query: 288 HGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAM 467
           +G V +WD  EK+    + N++RV P E+ +L++E+ L+ +  REK+ Q+ FE+   P  
Sbjct: 101 NGEVKDWDAFEKLLLDVYENQIRVQPSEYCLLISESSLHNQRQREKICQLAFESLKVPNF 160

Query: 468 YVAIQAVLSLYASGVPPVSCWTSATVSSTPCPFTKGYAL 584
           ++    VLS ++SG        +   S+   P   GY L
Sbjct: 161 FIVKSGVLSCFSSGRSTALVLDTGAYSTYAVPVHDGYVL 199



 Score = 43.2 bits (97), Expect = 0.005
 Identities = 19/37 (51%), Positives = 26/37 (70%)
 Frame = +1

Query: 70  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVG 180
           M  E++ A+VVD GS   +AG++G+D PR V PS VG
Sbjct: 1   MFTEDITAIVVDPGSLSIRAGYSGEDTPRLVMPSQVG 37


>UniRef50_Q9Y7X8 Cluster: Actin-like protein Arp5; n=1;
           Schizosaccharomyces pombe|Rep: Actin-like protein Arp5 -
           Schizosaccharomyces pombe (Fission yeast)
          Length = 721

 Score = 64.5 bits (150), Expect = 2e-09
 Identities = 29/82 (35%), Positives = 47/82 (57%)
 Frame = +3

Query: 279 PIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNT 458
           P E  +++NWD ME++  +TF  +L +   EHP+ +TE   NP   R  MT+++FE +N 
Sbjct: 86  PFERNVISNWDLMEQVLDYTFL-KLGIDRMEHPICMTEPLANPTYVRSTMTELLFELYNA 144

Query: 459 PAMYVAIQAVLSLYASGVPPVS 524
           P++   I  + S Y +  P  S
Sbjct: 145 PSVAYGIDGLFSFYHNTKPSSS 166



 Score = 35.9 bits (79), Expect = 0.80
 Identities = 15/32 (46%), Positives = 22/32 (68%)
 Frame = +1

Query: 94  LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPR 189
           LV+DNGS   +AG+ G+  P+ VF ++V R R
Sbjct: 27  LVIDNGSWQLRAGWGGEKDPKLVFDNLVSRYR 58


>UniRef50_UPI0000F2D271 Cluster: PREDICTED: similar to actin-like 8;
           n=1; Monodelphis domestica|Rep: PREDICTED: similar to
           actin-like 8 - Monodelphis domestica
          Length = 370

 Score = 64.1 bits (149), Expect = 3e-09
 Identities = 30/83 (36%), Positives = 49/83 (59%)
 Frame = +3

Query: 264 LTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMF 443
           L  ++PI  G V NW+ ME +  + F   L +  E+H +L+T    +  ++R K+ ++M 
Sbjct: 63  LPTEFPIVRGQVKNWEAMETVLTYAF-ESLGIKTEDHAILVTGFLSHRASHRMKLLEVMM 121

Query: 444 ETFNTPAMYVAIQAVLSLYASGV 512
           ETFN P++Y+   A L LY SG+
Sbjct: 122 ETFNVPSLYIGELAELCLYGSGI 144


>UniRef50_A7QZ13 Cluster: Chromosome undetermined scaffold_261,
           whole genome shotgun sequence; n=1; Vitis vinifera|Rep:
           Chromosome undetermined scaffold_261, whole genome
           shotgun sequence - Vitis vinifera (Grape)
          Length = 232

 Score = 64.1 bits (149), Expect = 3e-09
 Identities = 32/79 (40%), Positives = 46/79 (58%), Gaps = 2/79 (2%)
 Frame = +3

Query: 279 PIEHGIVTNWDDMEKIWHHTFYNELR--VAPEEHPVLLTEAPLNPKANREKMTQIMFETF 452
           P+  G++ +WD ME + +H  Y  LR  +  E H +L T+    PKA RE++ Q+MFE F
Sbjct: 99  PVVRGLIRDWDTMEDLLNHVLYTGLRWEMGNEGH-ILFTDPLSTPKAFREQLVQLMFEIF 157

Query: 453 NTPAMYVAIQAVLSLYASG 509
           N    Y + Q VLSL+  G
Sbjct: 158 NISDFYASEQVVLSLHVVG 176


>UniRef50_UPI0000E46266 Cluster: PREDICTED: similar to actin; n=1;
           Strongylocentrotus purpuratus|Rep: PREDICTED: similar to
           actin - Strongylocentrotus purpuratus
          Length = 341

 Score = 63.7 bits (148), Expect = 3e-09
 Identities = 29/97 (29%), Positives = 54/97 (55%)
 Frame = +3

Query: 297 VTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVA 476
           VT+WD  E+I  H  + + ++   +HP++L E P   ++ R+KM ++ FE  + P  Y+A
Sbjct: 61  VTDWDSFEQIIQHAIWTKSKIKSSDHPLVLIEKPGLERSCRQKMVELAFEGLDVPEFYLA 120

Query: 477 IQAVLSLYASGVPPVSCWTSATVSSTPCPFTKGYALP 587
            + V++LY+ G+      +S+ +SS       G+  P
Sbjct: 121 SEPVVALYSVGLSSGIVLSSSYMSSNVSTIHDGHRPP 157


>UniRef50_Q9SRK2 Cluster: Putative actin; n=1; Arabidopsis
           thaliana|Rep: Putative actin - Arabidopsis thaliana
           (Mouse-ear cress)
          Length = 378

 Score = 63.7 bits (148), Expect = 3e-09
 Identities = 35/112 (31%), Positives = 61/112 (54%), Gaps = 2/112 (1%)
 Frame = +3

Query: 270 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 449
           ++ PI+ G + N D   +IW H F + L +AP    +LLTEAPL+  + +    +++FE 
Sbjct: 61  VRRPIDRGYLINSDLQREIWSHLFTSLLHIAPSSSSLLLTEAPLSIPSVQRTTDELVFED 120

Query: 450 FNTPAMYVA-IQAVLSLYASGVPPVSCWTSATVS-STPCPFTKGYALPPRHS 599
           F   ++Y+A  Q+++ LY +   P S  +    S    C F+  +A+P  H+
Sbjct: 121 FGFSSLYIAHPQSLVHLYEASRQPDSILSKTQCSLVVDCGFSFTHAVPVLHN 172



 Score = 32.7 bits (71), Expect = 7.5
 Identities = 13/31 (41%), Positives = 20/31 (64%)
 Frame = +1

Query: 94  LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRP 186
           +V+DNG G+ KAG  G+  P  V P+ + +P
Sbjct: 5   VVLDNGGGLIKAGQGGERDPTTVIPNCLYKP 35


>UniRef50_Q8LKR0 Cluster: Actin-related protein 6; n=26;
           Magnoliophyta|Rep: Actin-related protein 6 - Arabidopsis
           thaliana (Mouse-ear cress)
          Length = 422

 Score = 63.7 bits (148), Expect = 3e-09
 Identities = 35/112 (31%), Positives = 61/112 (54%), Gaps = 2/112 (1%)
 Frame = +3

Query: 270 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 449
           ++ PI+ G + N D   +IW H F + L +AP    +LLTEAPL+  + +    +++FE 
Sbjct: 62  VRRPIDRGYLINSDLQREIWSHLFTSLLHIAPSSSSLLLTEAPLSIPSVQRTTDELVFED 121

Query: 450 FNTPAMYVA-IQAVLSLYASGVPPVSCWTSATVS-STPCPFTKGYALPPRHS 599
           F   ++Y+A  Q+++ LY +   P S  +    S    C F+  +A+P  H+
Sbjct: 122 FGFSSLYIAHPQSLVHLYEASRQPDSILSKTQCSLVVDCGFSFTHAVPVLHN 173


>UniRef50_Q19R56 Cluster: Actin-like protein 3; n=4; Trypanosoma
           cruzi|Rep: Actin-like protein 3 - Trypanosoma cruzi
           strain CL Brener
          Length = 426

 Score = 63.7 bits (148), Expect = 3e-09
 Identities = 33/87 (37%), Positives = 48/87 (55%)
 Frame = +3

Query: 249 EQRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKM 428
           E+RG+L L YPI+HGI+ NWD  + +       +L  +  E  V   E P + +  R ++
Sbjct: 57  ERRGLLHLTYPIQHGIIVNWDVWQLLLQQ-IEQQLDASLAEKSVFWVEHPFSSRPQRARV 115

Query: 429 TQIMFETFNTPAMYVAIQAVLSLYASG 509
            QI+FE      M V I  +LSLYA+G
Sbjct: 116 AQILFEEKGIFGMCVGIAPLLSLYATG 142


>UniRef50_Q6C061 Cluster: Actin-related protein 4; n=1; Yarrowia
           lipolytica|Rep: Actin-related protein 4 - Yarrowia
           lipolytica (Candida lipolytica)
          Length = 432

 Score = 63.7 bits (148), Expect = 3e-09
 Identities = 29/78 (37%), Positives = 46/78 (58%)
 Frame = +3

Query: 276 YPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN 455
           +P+  GIV +WD ++ IW ++    L    + HP++LTE   N +AN+ K  +I FE+  
Sbjct: 87  HPLTDGIVADWDAVQNIWEYSLAR-LNADTKTHPLMLTEPCWNTQANKLKALEIAFESLE 145

Query: 456 TPAMYVAIQAVLSLYASG 509
            PA Y+   AV S +A+G
Sbjct: 146 VPASYLVKDAVASAFAAG 163



 Score = 37.1 bits (82), Expect = 0.35
 Identities = 15/34 (44%), Positives = 22/34 (64%)
 Frame = +1

Query: 79  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVG 180
           +EVA LV+D GS   + G+AG+D P+ V  +  G
Sbjct: 14  DEVATLVIDTGSSYTRVGYAGEDTPKLVVSTECG 47


>UniRef50_Q4Q187 Cluster: Actin-like protein, putative; n=3;
           Leishmania|Rep: Actin-like protein, putative -
           Leishmania major
          Length = 407

 Score = 62.9 bits (146), Expect = 6e-09
 Identities = 34/116 (29%), Positives = 57/116 (49%)
 Frame = +3

Query: 258 GILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQI 437
           G+L+L YP+  G V ++D +EK+  +    E RV P+  P L        + +RE++ ++
Sbjct: 68  GLLSLTYPVRAGHVCDYDALEKLLFYALVEEARVTPDTSPFLFLVPADQTRLDRERLCEL 127

Query: 438 MFETFNTPAMYVAIQAVLSLYASGVPPVSCWTSATVSSTPCPFTKGYALPPRHSLR 605
           +FE+FN P   +      +LY+SG        S    +      +GY L   HS+R
Sbjct: 128 LFESFNIPLAGLLTNTAATLYSSGRTRGLALDSGAGRTCVAAVEEGYTL--AHSVR 181



 Score = 34.3 bits (75), Expect = 2.4
 Identities = 14/34 (41%), Positives = 23/34 (67%)
 Frame = +1

Query: 85  VAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRP 186
           + ++VVD G+   + GF+G++APR +  S VG P
Sbjct: 8   IQSVVVDVGTRNTRVGFSGEEAPRTMLRSCVGLP 41


>UniRef50_UPI0000D56C2F Cluster: PREDICTED: similar to Actin-57B;
           n=1; Tribolium castaneum|Rep: PREDICTED: similar to
           Actin-57B - Tribolium castaneum
          Length = 291

 Score = 62.5 bits (145), Expect = 8e-09
 Identities = 37/83 (44%), Positives = 48/83 (57%), Gaps = 2/83 (2%)
 Frame = +3

Query: 342 YNELRVAPEEHPVLLTEAPLNP--KANREKMTQIMFETFNTPAMYVAIQAVLSLYASGVP 515
           Y +L+VAPE HPVLLT+ P  P  KA  EK+ QIMFE F  PA+++   +VLSLY+ G  
Sbjct: 14  YKQLKVAPENHPVLLTK-PYFPISKATTEKIAQIMFEDFKIPALHLIYPSVLSLYSYGSL 72

Query: 516 PVSCWTSATVSSTPCPFTKGYAL 584
                 S    S   P  +G+ L
Sbjct: 73  TGLVVQSGNFESQFYPIYEGHIL 95


>UniRef50_Q4P2E8 Cluster: Actin-related protein 4; n=1; Ustilago
           maydis|Rep: Actin-related protein 4 - Ustilago maydis
           (Smut fungus)
          Length = 534

 Score = 60.5 bits (140), Expect = 3e-08
 Identities = 28/72 (38%), Positives = 44/72 (61%)
 Frame = +3

Query: 369 EHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGVPPVSCWTSATVS 548
           EHP+LLTE   N + +REK+T++ FET  +PA Y+A ++VLS +A+G P        + +
Sbjct: 181 EHPLLLTEPAWNSRESREKLTELAFETLGSPAFYLANRSVLSSFAAGKPSSLVIDVGSTN 240

Query: 549 STPCPFTKGYAL 584
            +  P   G+ L
Sbjct: 241 VSTIPIVDGFIL 252



 Score = 41.1 bits (92), Expect = 0.021
 Identities = 17/34 (50%), Positives = 23/34 (67%)
 Frame = +1

Query: 79  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVG 180
           +E+ ALV+D G    + G+AG+DAPR V PS  G
Sbjct: 8   DEINALVIDAGHSSSRVGWAGEDAPRVVLPSYYG 41


>UniRef50_A5K109 Cluster: Actin, putative; n=4; Plasmodium|Rep:
           Actin, putative - Plasmodium vivax
          Length = 493

 Score = 59.3 bits (137), Expect = 8e-08
 Identities = 34/87 (39%), Positives = 50/87 (57%)
 Frame = +3

Query: 351 LRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGVPPVSCW 530
           L +  EEHP+LL+E  ++    R +MT+I+FETFN PA+Y A +A L+ ++ G       
Sbjct: 134 LNLKIEEHPILLSEENIHNHRVRAEMTEILFETFNIPAVYFAKKAKLTAFSLGRSNALVI 193

Query: 531 TSATVSSTPCPFTKGYALPPRHSLRFG 611
                S    P  +GY L  R+SL+FG
Sbjct: 194 DIGGSSLNVTPVYEGYVL-QRNSLQFG 219


>UniRef50_Q4P303 Cluster: Putative uncharacterized protein; n=1;
           Ustilago maydis|Rep: Putative uncharacterized protein -
           Ustilago maydis (Smut fungus)
          Length = 1173

 Score = 58.4 bits (135), Expect = 1e-07
 Identities = 30/97 (30%), Positives = 52/97 (53%), Gaps = 1/97 (1%)
 Frame = +3

Query: 267 TLKYPIEHGIVTNWDDMEKIWHHTFYN-ELRVAPEEHPVLLTEAPLNPKANREKMTQIMF 443
           +++ P +  +VT+WD ME +  +TF N  +     +HP+ +TE   NP  +R  M ++MF
Sbjct: 488 SIRSPFDTDVVTSWDAMEIVLDYTFSNLGIDTDRVQHPICMTETLCNPAYSRGIMNELMF 547

Query: 444 ETFNTPAMYVAIQAVLSLYASGVPPVSCWTSATVSST 554
           E +  P++   I  + S Y + V   +   S+  SST
Sbjct: 548 EAYQVPSVNYGIDCLFSAYQNEVGQDALVVSSGRSST 584


>UniRef50_A2DEE0 Cluster: Actin family protein; n=1; Trichomonas
           vaginalis G3|Rep: Actin family protein - Trichomonas
           vaginalis G3
          Length = 378

 Score = 57.6 bits (133), Expect = 2e-07
 Identities = 24/81 (29%), Positives = 52/81 (64%), Gaps = 1/81 (1%)
 Frame = +3

Query: 267 TLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLN-PKANREKMTQIMF 443
           +L  P ++G +TN DD+E+++H+ F  E+ + PE+  V+++  PLN P++ R  + +I+F
Sbjct: 73  SLYNPFKNGYITNPDDIERLFHYIFEKEIHINPEKKSVIIS-TPLNGPQSQRNIIAEILF 131

Query: 444 ETFNTPAMYVAIQAVLSLYAS 506
           E +   +++++    L +Y +
Sbjct: 132 EKYKIGSLHISTPNTLGMYTT 152



 Score = 32.3 bits (70), Expect = 9.9
 Identities = 20/59 (33%), Positives = 29/59 (49%), Gaps = 1/59 (1%)
 Frame = +1

Query: 82  EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQK-DSYVGDEAQSK 255
           ++  +V+D GS   K G +GDD PR    S+ G  +   +    G   D +VG EA  K
Sbjct: 13  QMKVVVIDLGSDRIKVGISGDDIPRHFVKSVFGTLKTFDI---KGHNIDFFVGQEAIEK 68


>UniRef50_UPI0000499930 Cluster: actin; n=1; Entamoeba histolytica
           HM-1:IMSS|Rep: actin - Entamoeba histolytica HM-1:IMSS
          Length = 372

 Score = 56.8 bits (131), Expect = 4e-07
 Identities = 31/86 (36%), Positives = 51/86 (59%)
 Frame = +3

Query: 249 EQRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKM 428
           EQ+    +K PI++G + +      ++ +   +E +   +  P+L TE  LNPK  REK 
Sbjct: 53  EQKREFQIKSPIKNGTIEDISMASALFKNAL-DECQGYGK--PILFTEPALNPKQIREKT 109

Query: 429 TQIMFETFNTPAMYVAIQAVLSLYAS 506
            Q++FE F  P++Y +IQ +LSL+AS
Sbjct: 110 IQLLFERFKVPSVYFSIQPILSLFAS 135



 Score = 39.9 bits (89), Expect = 0.049
 Identities = 20/48 (41%), Positives = 28/48 (58%)
 Frame = +1

Query: 94  LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVG 237
           +V+D GS  C+ G AG+  P  +FPS VG PR +  +    + D YVG
Sbjct: 5   IVLDFGSQTCRVGNAGESMPTNIFPSYVGIPREKSQL----KPDFYVG 48


>UniRef50_Q9VEC3 Cluster: Actin-related protein 5; n=1; Drosophila
           melanogaster|Rep: Actin-related protein 5 - Drosophila
           melanogaster (Fruit fly)
          Length = 648

 Score = 56.8 bits (131), Expect = 4e-07
 Identities = 26/77 (33%), Positives = 45/77 (58%), Gaps = 2/77 (2%)
 Frame = +3

Query: 270 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPE--EHPVLLTEAPLNPKANREKMTQIMF 443
           LK P E  ++TNW+  E+I+ + F        +  +HP++LTEA  NP   R++M +++F
Sbjct: 79  LKSPFERNVITNWNHQEQIFDYIFTKMGFDGQDKIDHPIILTEALANPNFCRQQMNELLF 138

Query: 444 ETFNTPAMYVAIQAVLS 494
           E +  P++   I A+ S
Sbjct: 139 ECYGIPSVSYGIDALYS 155


>UniRef50_UPI0000DD7E8B Cluster: PREDICTED: similar to ARP3
           actin-related protein 3 homolog B; n=1; Homo
           sapiens|Rep: PREDICTED: similar to ARP3 actin-related
           protein 3 homolog B - Homo sapiens
          Length = 406

 Score = 56.4 bits (130), Expect = 5e-07
 Identities = 25/42 (59%), Positives = 32/42 (76%)
 Frame = +3

Query: 381 LLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYAS 506
           L TE PLN   NRE + +IMFE+FN P +Y+A+QAVL+L AS
Sbjct: 257 LQTEPPLNTPENREYLAEIMFESFNVPGLYIAVQAVLALAAS 298



 Score = 33.1 bits (72), Expect = 5.7
 Identities = 13/22 (59%), Positives = 16/22 (72%)
 Frame = +2

Query: 506 RRTTGIVLDFGDGVFHTVPIYE 571
           R  TGIV+D GDGV H +P+ E
Sbjct: 307 RTLTGIVIDSGDGVTHVIPVAE 328


>UniRef50_Q5CKL2 Cluster: BRG1/brm-associated factor 53A; n=2;
           Cryptosporidium|Rep: BRG1/brm-associated factor 53A -
           Cryptosporidium hominis
          Length = 423

 Score = 56.4 bits (130), Expect = 5e-07
 Identities = 36/106 (33%), Positives = 54/106 (50%), Gaps = 1/106 (0%)
 Frame = +3

Query: 270 LKYPIEHGIVTNWDDMEKIWHHTFYN-ELRVAPEEHPVLLTEAPLNPKANREKMTQIMFE 446
           LKY ++  ++ N D  E+I   T     L     EHP+LLTE   + +  REK  +IMFE
Sbjct: 70  LKY-VDGDLILNGDVFEEIIRTTSGKIGLSTDLREHPILLTEPSKHNRQIREKEVEIMFE 128

Query: 447 TFNTPAMYVAIQAVLSLYASGVPPVSCWTSATVSSTPCPFTKGYAL 584
            F+ PA+Y A +A+LS ++ G            +++  P   GY L
Sbjct: 129 KFDVPAVYTAKKAILSAFSVGRSSGLVVDIGATATSIVPILDGYTL 174



 Score = 45.2 bits (102), Expect = 0.001
 Identities = 18/34 (52%), Positives = 26/34 (76%)
 Frame = +1

Query: 79  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVG 180
           ++V A++VD GS M K G+ G+D PR V+PS+VG
Sbjct: 11  DDVGAIIVDVGSYMTKIGYGGEDCPRQVWPSVVG 44


>UniRef50_Q5C683 Cluster: SJCHGC08418 protein; n=1; Schistosoma
           japonicum|Rep: SJCHGC08418 protein - Schistosoma
           japonicum (Blood fluke)
          Length = 106

 Score = 56.0 bits (129), Expect = 7e-07
 Identities = 24/49 (48%), Positives = 33/49 (67%)
 Frame = +3

Query: 255 RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPL 401
           R  L L  PI +GIVT+ D +  +W++ F  ELR +PE HPVL++E PL
Sbjct: 58  RNELILNCPIANGIVTDIDGLSLVWYYMFMKELRTSPENHPVLISEYPL 106



 Score = 47.2 bits (107), Expect = 3e-04
 Identities = 18/32 (56%), Positives = 25/32 (78%)
 Frame = +1

Query: 94  LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPR 189
           +VVDNG+G  KAG+AGD  PR + P ++GRP+
Sbjct: 9   IVVDNGAGHLKAGYAGDGGPRILVPMLIGRPK 40


>UniRef50_Q293V2 Cluster: Actin-related protein 5; n=2; Drosophila
           pseudoobscura|Rep: Actin-related protein 5 - Drosophila
           pseudoobscura (Fruit fly)
          Length = 651

 Score = 56.0 bits (129), Expect = 7e-07
 Identities = 28/78 (35%), Positives = 47/78 (60%), Gaps = 3/78 (3%)
 Frame = +3

Query: 270 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEE---HPVLLTEAPLNPKANREKMTQIM 440
           LK P E  I+TNW+  E+I+ + F  ++    E+   +P++LTEA  NP   R+ M++++
Sbjct: 82  LKSPFERNIITNWNHQEQIFDYIF-TKMGFEGEQSIANPIVLTEALANPNFCRQNMSELL 140

Query: 441 FETFNTPAMYVAIQAVLS 494
           FE +  PA+   I A+ S
Sbjct: 141 FECYGIPAVSYGIDALYS 158


>UniRef50_Q0V0G6 Cluster: Putative uncharacterized protein; n=1;
           Phaeosphaeria nodorum|Rep: Putative uncharacterized
           protein - Phaeosphaeria nodorum (Septoria nodorum)
          Length = 443

 Score = 55.2 bits (127), Expect = 1e-06
 Identities = 30/96 (31%), Positives = 45/96 (46%), Gaps = 5/96 (5%)
 Frame = +3

Query: 243 GTEQRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNE-----LRVAPEEHPVLLTEAPLNP 407
           G +  G L  + P+E G + NW+  + IW H F         R  P+E  +LLTE P  P
Sbjct: 68  GCKDFGELAFRRPVEKGFIVNWEAEKAIWEHEFMEAAVVEGFRCDPKETNLLLTEKPNCP 127

Query: 408 KANREKMTQIMFETFNTPAMYVAIQAVLSLYASGVP 515
           K  ++   +I+FE F   + Y  +   L+ Y    P
Sbjct: 128 KELQKNCDEIVFEQFEFASYYRCVGPRLNAYHPASP 163


>UniRef50_Q6C0A9 Cluster: Yarrowia lipolytica chromosome F of strain
           CLIB122 of Yarrowia lipolytica; n=1; Yarrowia
           lipolytica|Rep: Yarrowia lipolytica chromosome F of
           strain CLIB122 of Yarrowia lipolytica - Yarrowia
           lipolytica (Candida lipolytica)
          Length = 427

 Score = 54.8 bits (126), Expect = 2e-06
 Identities = 23/80 (28%), Positives = 45/80 (56%), Gaps = 1/80 (1%)
 Frame = +3

Query: 279 PIEHGIVTNWDDMEKIWHHTFYNELRVAP-EEHPVLLTEAPLNPKANREKMTQIMFETFN 455
           P++ G + +WD + K+W +    +L+V    E+P+++TE   N  A R K+ ++ F+ F 
Sbjct: 81  PVQDGCIQDWDGVAKLWEYAIKEKLKVDDLSEYPLVITEQMWNSSARRAKIAEMCFDKFR 140

Query: 456 TPAMYVAIQAVLSLYASGVP 515
           +PA+      + + YA+  P
Sbjct: 141 SPAISFVKNPLCTAYAAVRP 160



 Score = 38.3 bits (85), Expect = 0.15
 Identities = 14/35 (40%), Positives = 24/35 (68%)
 Frame = +1

Query: 79  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGR 183
           +EV ++V++ GS   + GF+GDD P+ V P+  G+
Sbjct: 18  DEVTSIVIECGSSYTRVGFSGDDLPKVVIPTKYGK 52


>UniRef50_Q54KZ7 Cluster: Putative uncharacterized protein; n=1;
           Dictyostelium discoideum AX4|Rep: Putative
           uncharacterized protein - Dictyostelium discoideum AX4
          Length = 490

 Score = 54.4 bits (125), Expect = 2e-06
 Identities = 22/74 (29%), Positives = 47/74 (63%), Gaps = 1/74 (1%)
 Frame = +3

Query: 279 PIEHGIVTNWDDMEKIWHHTFY-NELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN 455
           P+E G +TNW   ++IW + F  +++++ P+++ +LLTEAP +    R+ M ++++E + 
Sbjct: 87  PMEKGYITNWGLEKEIWDYAFKRDDMKIKPQDYNLLLTEAPNSLDDLRKTMYEVVYEQYK 146

Query: 456 TPAMYVAIQAVLSL 497
             ++Y+   + L L
Sbjct: 147 FKSLYLTTSSTLGL 160


>UniRef50_Q383R8 Cluster: Actin-like protein, putative; n=4;
           Trypanosoma|Rep: Actin-like protein, putative -
           Trypanosoma brucei
          Length = 394

 Score = 54.4 bits (125), Expect = 2e-06
 Identities = 22/86 (25%), Positives = 48/86 (55%)
 Frame = +3

Query: 252 QRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 431
           Q G+L L YP+ +  +T+  ++E      FY+ L + P    +L  E+    + +RE++ 
Sbjct: 63  QEGMLNLSYPVRNRRITSMPEVEHFLQDVFYSRLPLVPSNTMMLWVESVRTSREDRERLC 122

Query: 432 QIMFETFNTPAMYVAIQAVLSLYASG 509
           ++MFE+F  P + +   +  +++++G
Sbjct: 123 EMMFESFGLPQLGLVAASATTVFSTG 148



 Score = 48.0 bits (109), Expect = 2e-04
 Identities = 22/58 (37%), Positives = 35/58 (60%), Gaps = 2/58 (3%)
 Frame = +1

Query: 79  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQ--KDSYVGDEA 246
           ++   +V D GS   + GFAG++APR +  ++VG PR +G++  + Q   D Y GD A
Sbjct: 3   QQQPVVVFDMGSNKTRVGFAGEEAPRVISSTVVGVPRQRGLVGSLMQHYSDDYAGDAA 60


>UniRef50_UPI0000E80C06 Cluster: PREDICTED: hypothetical protein;
           n=1; Gallus gallus|Rep: PREDICTED: hypothetical protein
           - Gallus gallus
          Length = 65

 Score = 54.0 bits (124), Expect = 3e-06
 Identities = 29/64 (45%), Positives = 34/64 (53%)
 Frame = +2

Query: 80  KKLPRW**TMAPVCARPVSQEMMLLAPCSPRSWEGPAIRA*WSVWDRRTLM*EMRHRAKR 259
           +KL  W  TMA VCAR     MM    CS   W+ P I+  W VW RRT M EM+ RA+ 
Sbjct: 2   RKLLPWWWTMALVCARQALLGMMPPGLCSLPLWDAPGIKVSWWVWGRRTAMWEMKPRARG 61

Query: 260 YPDP 271
              P
Sbjct: 62  ESSP 65


>UniRef50_UPI0000E4A0BF Cluster: PREDICTED: similar to Actin-related
           protein 5; n=2; Strongylocentrotus purpuratus|Rep:
           PREDICTED: similar to Actin-related protein 5 -
           Strongylocentrotus purpuratus
          Length = 602

 Score = 53.6 bits (123), Expect = 4e-06
 Identities = 26/80 (32%), Positives = 45/80 (56%), Gaps = 3/80 (3%)
 Frame = +3

Query: 270 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPE---EHPVLLTEAPLNPKANREKMTQIM 440
           LK   +  +VT++D  E+I  H F   L +  E   +HP+++TE P NP   R+ M++++
Sbjct: 147 LKTQFDRDVVTHYDAQEQILDHAF-QRLGIDSEGAVKHPIVMTETPCNPNLCRQTMSELL 205

Query: 441 FETFNTPAMYVAIQAVLSLY 500
           FE +  P +   I ++ S Y
Sbjct: 206 FECYQIPNLAYGIDSLFSHY 225



 Score = 33.1 bits (72), Expect = 5.7
 Identities = 12/32 (37%), Positives = 20/32 (62%)
 Frame = +1

Query: 94  LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPR 189
           +++DNGS   + G+A +  PR  F +I+ R R
Sbjct: 93  IIIDNGSCFSRVGWASEGTPRLTFRNIIARQR 124


>UniRef50_Q5C3R3 Cluster: SJCHGC08022 protein; n=1; Schistosoma
           japonicum|Rep: SJCHGC08022 protein - Schistosoma
           japonicum (Blood fluke)
          Length = 209

 Score = 53.6 bits (123), Expect = 4e-06
 Identities = 28/79 (35%), Positives = 45/79 (56%), Gaps = 1/79 (1%)
 Frame = +3

Query: 267 TLKYPIEHGIVTNWDDMEKIWHHTFYNELRVA-PEEHPVLLTEAPLNPKANREKMTQIMF 443
           +LK P    +V N D  E++  H F ++L V  P  +PV++ EA  NP   R ++T+++F
Sbjct: 90  SLKSPFIDNLVINLDVQEQVISHIF-DKLNVQKPLSNPVVINEALCNPGVCRSQLTELLF 148

Query: 444 ETFNTPAMYVAIQAVLSLY 500
           E+FNTP +   +    S Y
Sbjct: 149 ESFNTPKLMYYVDCFASYY 167



 Score = 44.0 bits (99), Expect = 0.003
 Identities = 19/45 (42%), Positives = 31/45 (68%), Gaps = 1/45 (2%)
 Frame = +1

Query: 94  LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPR-HQGVMVGMGQKD 225
           +V+DNG+  C+AG++  + P   FP++V RPR  +GV+VG   +D
Sbjct: 39  IVIDNGNFECRAGYSNFEKPHMTFPNVVYRPRMSKGVLVGNDIQD 83


>UniRef50_Q4QF49 Cluster: Actin-like protein, putative; n=2;
           Leishmania|Rep: Actin-like protein, putative -
           Leishmania major
          Length = 440

 Score = 53.2 bits (122), Expect = 5e-06
 Identities = 26/78 (33%), Positives = 44/78 (56%), Gaps = 1/78 (1%)
 Frame = +3

Query: 282 IEHGIVTNWDDMEKIWHHTF-YNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNT 458
           +E+G++ +W+  E++        +L       P+L+TE  L P   R+K+ +++FET   
Sbjct: 82  LENGVIVDWEGYEELLSRVARILDLENVENSTPLLVTEKALVPTHQRQKIAEVLFETHRV 141

Query: 459 PAMYVAIQAVLSLYASGV 512
            A   A+  VLSLYASG+
Sbjct: 142 VATSFALSPVLSLYASGL 159


>UniRef50_Q09849 Cluster: Uncharacterized protein C23D3.09; n=1;
           Schizosaccharomyces pombe|Rep: Uncharacterized protein
           C23D3.09 - Schizosaccharomyces pombe (Fission yeast)
          Length = 430

 Score = 53.2 bits (122), Expect = 5e-06
 Identities = 22/73 (30%), Positives = 42/73 (57%)
 Frame = +3

Query: 288 HGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAM 467
           +GI+ +W+     W      +L+V P E+ +++TE   NP++ R+++ +  FE  + PA 
Sbjct: 74  NGIIQDWESTLYTWERGLKEKLQVNPTEYAMMITEPSWNPQSVRQQIMEAAFEQLHVPAF 133

Query: 468 YVAIQAVLSLYAS 506
           Y+  QAV   +A+
Sbjct: 134 YLTKQAVCVAFAN 146



 Score = 38.7 bits (86), Expect = 0.11
 Identities = 20/57 (35%), Positives = 33/57 (57%)
 Frame = +1

Query: 79  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 249
           EE+ +LV+D GS   + G+AG+++P  + PS      + GV   +  ++ YV DE Q
Sbjct: 8   EEIPSLVIDPGSCWTRFGYAGEESPMTILPS------YYGVRSDVTGRNKYVVDELQ 58


>UniRef50_P53946 Cluster: Actin-related protein 5; n=7;
           Saccharomycetales|Rep: Actin-related protein 5 -
           Saccharomyces cerevisiae (Baker's yeast)
          Length = 755

 Score = 53.2 bits (122), Expect = 5e-06
 Identities = 28/77 (36%), Positives = 44/77 (57%), Gaps = 3/77 (3%)
 Frame = +3

Query: 279 PIEHGIVTNWDDMEKIWHHTFYNELRVAPEE---HPVLLTEAPLNPKANREKMTQIMFET 449
           P +   VTNW+  E+I  +TF++ L V P+    +P+LLTE     ++ R    QI+FET
Sbjct: 99  PFDGPFVTNWNLTEEILDYTFHH-LGVVPDNGIPNPILLTERLATVQSQRTNWYQILFET 157

Query: 450 FNTPAMYVAIQAVLSLY 500
           +N P +   I ++ S Y
Sbjct: 158 YNVPGVTFGIDSLFSFY 174


>UniRef50_UPI0000498A93 Cluster: actin; n=1; Entamoeba histolytica
           HM-1:IMSS|Rep: actin - Entamoeba histolytica HM-1:IMSS
          Length = 360

 Score = 52.0 bits (119), Expect = 1e-05
 Identities = 21/65 (32%), Positives = 36/65 (55%)
 Frame = +3

Query: 276 YPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN 455
           YPI  G++++ DD+E I    F   + V     P+++TE  L P   +++  ++ FE F 
Sbjct: 57  YPINRGMISDCDDIEGILRFVFDENMGVDASTRPIIVTEEALCPNLRKQEYGELFFEKFE 116

Query: 456 TPAMY 470
           TP +Y
Sbjct: 117 TPGLY 121


>UniRef50_Q8ILM5 Cluster: Actin, putative; n=1; Plasmodium
           falciparum 3D7|Rep: Actin, putative - Plasmodium
           falciparum (isolate 3D7)
          Length = 522

 Score = 52.0 bits (119), Expect = 1e-05
 Identities = 23/48 (47%), Positives = 35/48 (72%)
 Frame = +3

Query: 366 EEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASG 509
           EEHP+LLTE  ++    RE+MT+I+FE +N PA+Y A +A L+ ++ G
Sbjct: 146 EEHPILLTEFNMHNHKIREQMTEILFEKYNIPALYFAKKAKLTSFSLG 193



 Score = 32.3 bits (70), Expect = 9.9
 Identities = 15/34 (44%), Positives = 20/34 (58%)
 Frame = +1

Query: 79  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVG 180
           E++++LVVD G   CK G   +D PR    SI G
Sbjct: 16  EDISSLVVDLGFYSCKIGHNQEDTPRIFLNSICG 49


>UniRef50_UPI00004987CF Cluster: actin; n=2; Entamoeba histolytica
           HM-1:IMSS|Rep: actin - Entamoeba histolytica HM-1:IMSS
          Length = 876

 Score = 51.6 bits (118), Expect = 2e-05
 Identities = 26/81 (32%), Positives = 44/81 (54%), Gaps = 1/81 (1%)
 Frame = +3

Query: 270 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVA-PEEHPVLLTEAPLNPKANREKMTQIMFE 446
           L +P++    T+WD +  I  + + NEL    P  HPV++TE P   +   +K+  +MF 
Sbjct: 573 LVWPLDPRKDTDWDGLLAIIQNIYENELDGCDPASHPVVMTELPNMNEVATDKIKSMMFN 632

Query: 447 TFNTPAMYVAIQAVLSLYASG 509
             N P + +   A+++LYA G
Sbjct: 633 DLNVPFLKIVNPALMALYAEG 653


>UniRef50_Q00UL2 Cluster: Alpha amylase 1; n=3; Ostreococcus|Rep:
           Alpha amylase 1 - Ostreococcus tauri
          Length = 913

 Score = 51.6 bits (118), Expect = 2e-05
 Identities = 25/33 (75%), Positives = 28/33 (84%)
 Frame = -2

Query: 173 IEGNTARGASSPAKPALHIPEPLSTTNAATSSS 75
           ++GNTA GASSPAKPAL IPEPLS T+A TS S
Sbjct: 1   MDGNTAFGASSPAKPALTIPEPLSHTSAETSPS 33


>UniRef50_A2EUM6 Cluster: Actin family protein; n=1; Trichomonas
           vaginalis G3|Rep: Actin family protein - Trichomonas
           vaginalis G3
          Length = 360

 Score = 50.8 bits (116), Expect = 3e-05
 Identities = 25/53 (47%), Positives = 33/53 (62%)
 Frame = +1

Query: 94  LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQS 252
           LV+D GSG  KAGFAG+D+P  VFP++VG  RH   +      D  +G+ A S
Sbjct: 8   LVLDFGSGFVKAGFAGNDSPSLVFPTVVGNLRH-AKLGPSNSNDPLIGESALS 59



 Score = 34.7 bits (76), Expect = 1.9
 Identities = 21/82 (25%), Positives = 40/82 (48%)
 Frame = +3

Query: 264 LTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMF 443
           +T+K PI    + + +D   I ++ F   L +  E + +L++          E +T+   
Sbjct: 63  VTVKRPIVRSEIQSPEDFYSIVNYIFQT-LEIKGENNHILISRPSGASTQQLELITEYFI 121

Query: 444 ETFNTPAMYVAIQAVLSLYASG 509
           ETF+ P++     A LSL ++G
Sbjct: 122 ETFHVPSIAFISSAALSLLSTG 143


>UniRef50_P80428 Cluster: Actin-related protein 4; n=4;
           Saccharomycetales|Rep: Actin-related protein 4 -
           Saccharomyces cerevisiae (Baker's yeast)
          Length = 489

 Score = 50.8 bits (116), Expect = 3e-05
 Identities = 28/83 (33%), Positives = 42/83 (50%), Gaps = 1/83 (1%)
 Frame = +3

Query: 270 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEH-PVLLTEAPLNPKANREKMTQIMFE 446
           LK  IE+G+V +WD  ++ W     NEL +      P LLTE   N   NR+K  +++ E
Sbjct: 71  LKPIIENGLVIDWDTAQEQWQWALQNELYLNSNSGIPALLTEPVWNSTENRKKSLEVLLE 130

Query: 447 TFNTPAMYVAIQAVLSLYASGVP 515
                A Y+A  +    +A+G P
Sbjct: 131 GMQFEACYLAPTSTCVSFAAGRP 153



 Score = 38.3 bits (85), Expect = 0.15
 Identities = 14/35 (40%), Positives = 25/35 (71%)
 Frame = +1

Query: 79  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGR 183
           +EV+A+V+D GS     G++G D P+++ PS+ G+
Sbjct: 12  DEVSAVVIDPGSYTTNIGYSGSDFPQSILPSVYGK 46


>UniRef50_UPI00006CBDF1 Cluster: Actin family protein; n=1;
           Tetrahymena thermophila SB210|Rep: Actin family protein
           - Tetrahymena thermophila SB210
          Length = 400

 Score = 50.4 bits (115), Expect = 3e-05
 Identities = 26/99 (26%), Positives = 44/99 (44%)
 Frame = +3

Query: 282 IEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTP 461
           +  G+V NW+             +++ P E P+ L E  L+ K  R+K  + +FE+ N  
Sbjct: 79  LSQGMVNNWEQASNFIEQINKKLMQINPSETPLFLIEQALSTKDVRQKCVEAVFESMNFA 138

Query: 462 AMYVAIQAVLSLYASGVPPVSCWTSATVSSTPCPFTKGY 578
           A+++    VLS Y      +    S   S+   P  +GY
Sbjct: 139 ALFIHKAPVLSSYVLAKETILLVDSGAYSTYVVPIVEGY 177


>UniRef50_UPI0000EBF019 Cluster: PREDICTED: similar to ribosomal
           protein L10; n=1; Bos taurus|Rep: PREDICTED: similar to
           ribosomal protein L10 - Bos taurus
          Length = 289

 Score = 49.6 bits (113), Expect = 6e-05
 Identities = 26/54 (48%), Positives = 33/54 (61%)
 Frame = +1

Query: 94  LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 255
           LVVD G   CK GF  D+    V P+    P+HQ  MVG+GQKDSY+G + Q +
Sbjct: 4   LVVDCGFDTCKTGFTEDNTLSCV-PTHRLVPQHQDCMVGVGQKDSYMGGKIQGR 56



 Score = 33.5 bits (73), Expect = 4.3
 Identities = 14/31 (45%), Positives = 21/31 (67%)
 Frame = +3

Query: 261 ILTLKYPIEHGIVTNWDDMEKIWHHTFYNEL 353
           + T +YP+E GI+T+ DD+ KIW     N+L
Sbjct: 59  VQTPEYPMEQGIITHPDDVGKIWITIAINQL 89


>UniRef50_Q18PR4 Cluster: Actin-related protein; n=1; Porphyra
           yezoensis|Rep: Actin-related protein - Porphyra
           yezoensis
          Length = 573

 Score = 49.6 bits (113), Expect = 6e-05
 Identities = 23/74 (31%), Positives = 41/74 (55%)
 Frame = +3

Query: 288 HGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAM 467
           +G+V NW+  E +  H +   ++ A E+  V+  E        RE++ +++FET   PA+
Sbjct: 81  NGLVANWEAYEGLLAHAYSTGVQAASEDFAVMYAEPTHACIRQRERIGELLFETHGAPAL 140

Query: 468 YVAIQAVLSLYASG 509
            V+   VL+ YA+G
Sbjct: 141 AVSPAVVLAAYANG 154



 Score = 38.3 bits (85), Expect = 0.15
 Identities = 16/35 (45%), Positives = 23/35 (65%)
 Frame = +1

Query: 76  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVG 180
           D  V ++V D GS  CK GFAG+D P +++ S +G
Sbjct: 5   DGTVPSVVFDFGSHTCKVGFAGEDLPHSLYSSNIG 39


>UniRef50_Q23FF9 Cluster: Actin family protein; n=2; Tetrahymena
           thermophila|Rep: Actin family protein - Tetrahymena
           thermophila SB210
          Length = 426

 Score = 49.2 bits (112), Expect = 8e-05
 Identities = 28/114 (24%), Positives = 60/114 (52%), Gaps = 1/114 (0%)
 Frame = +3

Query: 249 EQRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAP-EEHPVLLTEAPLNPKANREK 425
           E++  L  K+PI++G + ++D +  ++ +     L+V       +L+ ++PLNPK  + K
Sbjct: 107 EKKFELEEKFPIQNGKIVDFDAIRDLYTYALEKLLQVNEISSCNLLIIDSPLNPKNYKHK 166

Query: 426 MTQIMFETFNTPAMYVAIQAVLSLYASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           + +I+F+     ++     + LSL+++G        S    +T  P  +G+A+P
Sbjct: 167 LAEILFDDMKVNSVLFQNSSSLSLFSTGETTGLVVESGHSLTTCIPVFEGFAIP 220


>UniRef50_Q19R52 Cluster: ALP5; n=6; Trypanosomatidae|Rep: ALP5 -
           Trypanosoma cruzi strain CL Brener
          Length = 422

 Score = 49.2 bits (112), Expect = 8e-05
 Identities = 42/135 (31%), Positives = 68/135 (50%), Gaps = 7/135 (5%)
 Frame = +3

Query: 228 LCRR*GTEQRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNEL-RVAPEE--HPVLLTEAP 398
           LC +     R    +   IE G V +W+ ME++   ++ +EL +++ +E   P+LLTE  
Sbjct: 66  LCLKKAYNCRATTEVSRVIEKGEV-DWEAMEQLL--SYLDELLQLSSKEVQTPLLLTEKM 122

Query: 399 LNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGVPPVSCWTSATVSSTPC---PFT 569
           L P+  R+K+ +I+ E     A++ A   VL+LYA+G   +   TS  +    C   P  
Sbjct: 123 LVPRTQRQKLAEILMEKHGVTAVHFAQSPVLALYAAG---ICSGTSVEMGYNACHVVPVF 179

Query: 570 KGYAL-PPRHSLRFG 611
           +GY L    H L  G
Sbjct: 180 QGYPLFHATHMLNVG 194


>UniRef50_Q6CSB9 Cluster: Actin-related protein 4; n=1;
           Kluyveromyces lactis|Rep: Actin-related protein 4 -
           Kluyveromyces lactis (Yeast) (Candida sphaerica)
          Length = 520

 Score = 49.2 bits (112), Expect = 8e-05
 Identities = 30/111 (27%), Positives = 51/111 (45%), Gaps = 1/111 (0%)
 Frame = +3

Query: 255 RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEH-PVLLTEAPLNPKANREKMT 431
           R  + +K  +E+  + +WD  ++ W +    +L+    +  PVLLTE   N +A+R+K  
Sbjct: 66  RAGMEIKPIVENSTIVDWDRAQEQWEYALNTDLKFESNKGTPVLLTEPIWNSEASRKKSL 125

Query: 432 QIMFETFNTPAMYVAIQAVLSLYASGVPPVSCWTSATVSSTPCPFTKGYAL 584
           +I+ E+    A Y+A  +    +A G P           ST  P   G  L
Sbjct: 126 EILLESMEFEACYLAANSSAVSFAMGRPTCLVVDIGHDVSTVSPVIDGMTL 176



 Score = 36.3 bits (80), Expect = 0.61
 Identities = 14/40 (35%), Positives = 24/40 (60%)
 Frame = +1

Query: 79  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQG 198
           +E+ A+V+D GS +   G++G D P+++ PS  G     G
Sbjct: 12  DEINAIVIDPGSFVTNIGYSGTDCPQSIMPSSYGNVETDG 51


>UniRef50_Q9LHH0 Cluster: Actin-like protein; n=11;
           Magnoliophyta|Rep: Actin-like protein - Arabidopsis
           thaliana (Mouse-ear cress)
          Length = 724

 Score = 48.8 bits (111), Expect = 1e-04
 Identities = 23/73 (31%), Positives = 39/73 (53%), Gaps = 1/73 (1%)
 Frame = +3

Query: 279 PIEHGIVTNWDDMEKIWHHTFYN-ELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN 455
           P +  +V  ++ ME I  + F       +  +HP+L+TE   NP  +R KM +++FET+ 
Sbjct: 85  PFDSNVVYQFEIMEYILDYAFDRLGANGSGIDHPILITECACNPVQSRSKMAELLFETYG 144

Query: 456 TPAMYVAIQAVLS 494
            PA+   + A  S
Sbjct: 145 VPAVAFGVDAAFS 157



 Score = 44.0 bits (99), Expect = 0.003
 Identities = 21/49 (42%), Positives = 31/49 (63%)
 Frame = +1

Query: 94  LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGD 240
           +V+DNG+   + G+AG+  PR VF +IV RPRH+      G+  + VGD
Sbjct: 22  IVIDNGASYFRIGWAGETEPRVVFRNIVQRPRHKAT----GETVTIVGD 66


>UniRef50_Q4YVG6 Cluster: Actin, putative; n=7; Plasmodium|Rep:
           Actin, putative - Plasmodium berghei
          Length = 505

 Score = 48.4 bits (110), Expect = 1e-04
 Identities = 25/67 (37%), Positives = 43/67 (64%), Gaps = 1/67 (1%)
 Frame = +3

Query: 303 NWDDMEKIWHHTFYNE-LRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAI 479
           N++ MEK++     ++ L V  ++HP+LLTE        REK T++MFE++N   M+++ 
Sbjct: 82  NFEAMEKLFEDISGSKALDVNFQDHPILLTEPNKIDSRYREKFTELMFESYNVYQMFLSK 141

Query: 480 QAVLSLY 500
           ++VLS Y
Sbjct: 142 RSVLSCY 148


>UniRef50_A0D9D5 Cluster: Chromosome undetermined scaffold_42, whole
           genome shotgun sequence; n=1; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_42,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 94

 Score = 48.0 bits (109), Expect = 2e-04
 Identities = 24/54 (44%), Positives = 33/54 (61%), Gaps = 2/54 (3%)
 Frame = +1

Query: 94  LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRP--RHQGVMVGMGQKDSYVGDEAQ 249
           ++ D+G+G  K GFAGD+ P   FP++VGRP  R    +     KD  +GDEAQ
Sbjct: 5   IIEDSGTGYLKIGFAGDNFPSHSFPAMVGRPTLRADEQLDDANLKDIMIGDEAQ 58


>UniRef50_Q7SXV8 Cluster: ARP5 actin-related protein 5 homolog; n=6;
           Euteleostomi|Rep: ARP5 actin-related protein 5 homolog -
           Danio rerio (Zebrafish) (Brachydanio rerio)
          Length = 592

 Score = 47.2 bits (107), Expect = 3e-04
 Identities = 26/99 (26%), Positives = 52/99 (52%), Gaps = 3/99 (3%)
 Frame = +3

Query: 267 TLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPE---EHPVLLTEAPLNPKANREKMTQI 437
           TLK   +   V N+D  E ++ + F + L +  +   EHP+++TE   NP   R+ M+++
Sbjct: 92  TLKSAFDRDTVVNFDIQELVFDYIFMH-LGINTQGRVEHPLVVTEPACNPLQCRQMMSEL 150

Query: 438 MFETFNTPAMYVAIQAVLSLYASGVPPVSCWTSATVSST 554
           +FE +  P +   + ++ SL+ +        ++A V S+
Sbjct: 151 LFECYGVPRVAYGVDSLFSLHQNSSADAGAPSTALVLSS 189


>UniRef50_Q54E71 Cluster: Putative uncharacterized protein; n=1;
           Dictyostelium discoideum AX4|Rep: Putative
           uncharacterized protein - Dictyostelium discoideum AX4
          Length = 684

 Score = 47.2 bits (107), Expect = 3e-04
 Identities = 23/79 (29%), Positives = 43/79 (54%)
 Frame = +3

Query: 264 LTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMF 443
           LT+K P +  ++ +    E I+ + F+        E+PVL+TE   NP   R+ M++++F
Sbjct: 83  LTIKSPFDSNLLVHPPSQESIFDYIFHKFGIENEIENPVLITEPTSNPTFCRKYMSELLF 142

Query: 444 ETFNTPAMYVAIQAVLSLY 500
           E +N  ++   I ++ S Y
Sbjct: 143 ECYNIKSVVYGIDSLFSFY 161



 Score = 42.3 bits (95), Expect = 0.009
 Identities = 15/30 (50%), Positives = 24/30 (80%)
 Frame = +1

Query: 94  LVVDNGSGMCKAGFAGDDAPRAVFPSIVGR 183
           +++DNGS  C+AGFA D +P+ +F S+VG+
Sbjct: 33  IIIDNGSYQCRAGFANDISPKLIFRSLVGK 62


>UniRef50_Q2H0E9 Cluster: Putative uncharacterized protein; n=1;
           Chaetomium globosum|Rep: Putative uncharacterized
           protein - Chaetomium globosum (Soil fungus)
          Length = 656

 Score = 47.2 bits (107), Expect = 3e-04
 Identities = 25/86 (29%), Positives = 46/86 (53%), Gaps = 3/86 (3%)
 Frame = +3

Query: 246 TEQRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPE---EHPVLLTEAPLNPKAN 416
           T  RG +   +    GIV++WD +E +  H F        E   + P+++TEA  N   +
Sbjct: 106 TTARGHIRNAFEAGTGIVSSWDVVEHVLDHVFIKLGMNGVEGGIDMPIVMTEAVANLPYS 165

Query: 417 REKMTQIMFETFNTPAMYVAIQAVLS 494
           R+ M++++FE +N P++   I ++ S
Sbjct: 166 RKTMSEMLFECYNAPSVVYGIDSLFS 191



 Score = 37.1 bits (82), Expect = 0.35
 Identities = 19/56 (33%), Positives = 28/56 (50%), Gaps = 2/56 (3%)
 Frame = +1

Query: 88  AALVVDNGSGMCKAGFAGDDAPRAVFPSIVG--RPRHQGVMVGMGQKDSYVGDEAQ 249
           A +V+DNGS   +AG++ +D PR   P I+   R R  G       +D Y    A+
Sbjct: 54  AVIVIDNGSSTVRAGWSFEDKPRLAIPPIMSKYRDRKAGKTFSFAGQDCYADTTAR 109


>UniRef50_Q12406 Cluster: Actin-related protein 7; n=2;
           Saccharomyces cerevisiae|Rep: Actin-related protein 7 -
           Saccharomyces cerevisiae (Baker's yeast)
          Length = 477

 Score = 47.2 bits (107), Expect = 3e-04
 Identities = 22/76 (28%), Positives = 40/76 (52%), Gaps = 3/76 (3%)
 Frame = +3

Query: 291 GIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPK---ANREKMTQIMFETFNTP 461
           G+  NWD +E  W + +  +L+V+PEE P+++T    N K   A  E+  ++ F+  N P
Sbjct: 75  GLPYNWDALEMQWRYLYDTQLKVSPEELPLVITMPATNGKPDMAILERYYELAFDKLNVP 134

Query: 462 AMYVAIQAVLSLYASG 509
              + I+ +    + G
Sbjct: 135 VFQIVIEPLAIALSMG 150


>UniRef50_Q6BIA3 Cluster: CA5059|IPF3691 Candida albicans IPF3691;
           n=5; Saccharomycetales|Rep: CA5059|IPF3691 Candida
           albicans IPF3691 - Debaryomyces hansenii (Yeast)
           (Torulaspora hansenii)
          Length = 450

 Score = 46.8 bits (106), Expect = 4e-04
 Identities = 24/79 (30%), Positives = 39/79 (49%), Gaps = 3/79 (3%)
 Frame = +3

Query: 282 IEHGIVTNWDDMEKIWHHTFYN---ELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETF 452
           +E+G++ N+D +   W + + N      +  +E P++LTE P N   N+   TQI FET 
Sbjct: 62  MENGLIYNFDSIVHNWQYVYDNIDNNNAINAKEFPLMLTEQPWNTSKNKLATTQIAFETL 121

Query: 453 NTPAMYVAIQAVLSLYASG 509
             P   +    +  LY  G
Sbjct: 122 EVPIFSLVKTPLSQLYHMG 140



 Score = 37.9 bits (84), Expect = 0.20
 Identities = 22/45 (48%), Positives = 25/45 (55%)
 Frame = +1

Query: 91  ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKD 225
           A+V+DNGS   KAGFA DD P  VF S      +  V VG  Q D
Sbjct: 7   AVVIDNGSHTTKAGFALDDLPSLVFNSNYVVDSNSKVQVGDKQVD 51


>UniRef50_Q4P4D4 Cluster: Putative uncharacterized protein; n=1;
           Ustilago maydis|Rep: Putative uncharacterized protein -
           Ustilago maydis (Smut fungus)
          Length = 544

 Score = 46.8 bits (106), Expect = 4e-04
 Identities = 27/90 (30%), Positives = 48/90 (53%), Gaps = 3/90 (3%)
 Frame = +3

Query: 249 EQRGI-LTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPV-LLTEAPLN-PKANR 419
           E+RG  + + +P+  G V +W  M  +W++  ++ L +    +   +L   PL   +A  
Sbjct: 70  ERRGDDVAIFWPMRKGYVRDWQQMIALWNYVLFHLLPIRRSHNDSNILISLPLPVSRATH 129

Query: 420 EKMTQIMFETFNTPAMYVAIQAVLSLYASG 509
             +TQI FE FN+ A+ +A + +LS Y  G
Sbjct: 130 AYLTQIFFEHFNSAAITIAEKPLLSCYGVG 159


>UniRef50_A3M088 Cluster: Vacuolar targeting, actin-related protein;
           n=5; Saccharomycetales|Rep: Vacuolar targeting,
           actin-related protein - Pichia stipitis (Yeast)
          Length = 775

 Score = 46.8 bits (106), Expect = 4e-04
 Identities = 25/83 (30%), Positives = 45/83 (54%), Gaps = 3/83 (3%)
 Frame = +3

Query: 267 TLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPE---EHPVLLTEAPLNPKANREKMTQI 437
           ++K P +  +VTNWD ME +  ++  +   V       +P++LTE    P + R+ M +I
Sbjct: 98  SIKTPFDGPLVTNWDYMEVLLDYSLAHLGVVGDNGRLNNPLILTEPVGVPFSQRKNMYEI 157

Query: 438 MFETFNTPAMYVAIQAVLSLYAS 506
           +FE +  P +   I ++ S YA+
Sbjct: 158 LFEAYQAPKVTFGIDSLFSFYAN 180


>UniRef50_Q9H9F9 Cluster: Actin-related protein 5; n=19;
           Euteleostomi|Rep: Actin-related protein 5 - Homo sapiens
           (Human)
          Length = 607

 Score = 46.8 bits (106), Expect = 4e-04
 Identities = 23/80 (28%), Positives = 46/80 (57%), Gaps = 3/80 (3%)
 Frame = +3

Query: 270 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPE---EHPVLLTEAPLNPKANREKMTQIM 440
           L+ P +  +  N +  E +  ++F + L V+ +   +HP++LTEA  NP  +R+ M++++
Sbjct: 94  LRSPFDRNVPVNLELQELLLDYSFQH-LGVSSQGCVDHPIVLTEAVCNPLYSRQMMSELL 152

Query: 441 FETFNTPAMYVAIQAVLSLY 500
           FE +  P +   I ++ S Y
Sbjct: 153 FECYGIPKVAYGIDSLFSFY 172


>UniRef50_A6RD74 Cluster: Putative uncharacterized protein; n=1;
           Ajellomyces capsulatus NAm1|Rep: Putative
           uncharacterized protein - Ajellomyces capsulatus NAm1
          Length = 731

 Score = 46.4 bits (105), Expect = 6e-04
 Identities = 31/116 (26%), Positives = 52/116 (44%), Gaps = 2/116 (1%)
 Frame = +3

Query: 168 LDRGKAPPSGRDGRYGTEG-LLCRR*GTEQRGILTLKYPIEHGIVTNWDDMEKIWHHTFY 344
           ++ G    +  D  +  EG ++     T   G +   YPI +G +  W     +  H F 
Sbjct: 129 VENGHEETTVADAEHSEEGQIIYEEDPTSDEGAV---YPIRNGEIVEWSCFFALLSHIFK 185

Query: 345 NELRVAPEEH-PVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASG 509
               ++P  H P++    P+    +RE +TQ +FE F TPA  +   A+ + YA G
Sbjct: 186 T---LSPPFHTPIMFIAQPVWTARDREAITQFVFEKFQTPAFCLMDSALAACYAYG 238


>UniRef50_A1CCH7 Cluster: Chromatin remodeling complex subunit
           (Arp9), putative; n=20; Pezizomycotina|Rep: Chromatin
           remodeling complex subunit (Arp9), putative -
           Aspergillus clavatus
          Length = 693

 Score = 46.4 bits (105), Expect = 6e-04
 Identities = 26/78 (33%), Positives = 39/78 (50%)
 Frame = +3

Query: 276 YPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN 455
           YPIE+G + +W     +  H  +N L   P   P++L   P+    +RE +TQ +FE F 
Sbjct: 146 YPIENGRIVDWPCFFALLTHV-HNTLS-PPFHTPIMLISEPVWSARDREAITQFVFEKFK 203

Query: 456 TPAMYVAIQAVLSLYASG 509
           TPA  +   A+   Y  G
Sbjct: 204 TPAFCLMDSALAICYGYG 221


>UniRef50_Q17GZ9 Cluster: Actin-related protein 5; n=4;
           Endopterygota|Rep: Actin-related protein 5 - Aedes
           aegypti (Yellowfever mosquito)
          Length = 655

 Score = 46.4 bits (105), Expect = 6e-04
 Identities = 26/83 (31%), Positives = 44/83 (53%), Gaps = 3/83 (3%)
 Frame = +3

Query: 270 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPE---EHPVLLTEAPLNPKANREKMTQIM 440
           L+   +  +VT+    E+I+ + F   L +  +    HPVLLTE   NP  +R  M+++M
Sbjct: 93  LRTQFDRNVVTHLHVQEQIFDYLF-GRLGINADGCVPHPVLLTECVANPNYSRMLMSELM 151

Query: 441 FETFNTPAMYVAIQAVLSLYASG 509
           FE +  P +  A+  +LS   +G
Sbjct: 152 FECYGIPGIVYAVDGLLSYRMNG 174



 Score = 46.0 bits (104), Expect = 7e-04
 Identities = 18/34 (52%), Positives = 26/34 (76%)
 Frame = +1

Query: 88  AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPR 189
           AA+V+DNGS  C+AG+AG D P  VF +++ +PR
Sbjct: 28  AAIVIDNGSYHCRAGWAGKDVPSLVFKNVLAKPR 61


>UniRef50_Q6CF37 Cluster: Similar to sp|P53946 Saccharomyces
           cerevisiae YNL059c ARP5Actin- related protein; n=1;
           Yarrowia lipolytica|Rep: Similar to sp|P53946
           Saccharomyces cerevisiae YNL059c ARP5Actin- related
           protein - Yarrowia lipolytica (Candida lipolytica)
          Length = 724

 Score = 46.0 bits (104), Expect = 7e-04
 Identities = 22/84 (26%), Positives = 48/84 (57%), Gaps = 3/84 (3%)
 Frame = +3

Query: 264 LTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPE---EHPVLLTEAPLNPKANREKMTQ 434
           L+ + P +  +V+NW   E++  +TF  +LRV  +   ++ +++ E   +P A R  + Q
Sbjct: 83  LSARSPYDGALVSNWTVAEEVLDYTFA-KLRVGSDGCVDNHIIMNELMSSPAAQRRNLQQ 141

Query: 435 IMFETFNTPAMYVAIQAVLSLYAS 506
           ++FE +   ++ + + A+ S YA+
Sbjct: 142 VLFEGYGVRSVALGVDALFSYYAN 165


>UniRef50_A7EG89 Cluster: Putative uncharacterized protein; n=2;
           Sclerotiniaceae|Rep: Putative uncharacterized protein -
           Sclerotinia sclerotiorum 1980
          Length = 669

 Score = 46.0 bits (104), Expect = 7e-04
 Identities = 27/80 (33%), Positives = 41/80 (51%), Gaps = 1/80 (1%)
 Frame = +3

Query: 276 YPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEH-PVLLTEAPLNPKANREKMTQIMFETF 452
           +P+  G + N        HH  +N+L  +P  H PV+L   P     N E +TQ +FE F
Sbjct: 97  WPLREGRIENLPAFCAFLHHV-HNQL--SPTLHTPVMLIAQPSWTAKNHEDLTQFIFEKF 153

Query: 453 NTPAMYVAIQAVLSLYASGV 512
            TPA+ +   A+ + YA G+
Sbjct: 154 RTPALCIMDSALATSYAFGI 173


>UniRef50_Q6C982 Cluster: Actin-like protein ARP6; n=1; Yarrowia
           lipolytica|Rep: Actin-like protein ARP6 - Yarrowia
           lipolytica (Candida lipolytica)
          Length = 387

 Score = 46.0 bits (104), Expect = 7e-04
 Identities = 24/82 (29%), Positives = 38/82 (46%)
 Frame = +3

Query: 264 LTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMF 443
           L  K P E G + NWD  + +W + FYN       +  +LLT+ PL        + Q++F
Sbjct: 47  LVFKRPSEKGQLINWDIQKAVWDNLFYNPQTGVDTDSSLLLTQYPLTLPQVSANIDQVVF 106

Query: 444 ETFNTPAMYVAIQAVLSLYASG 509
           E +     +    A L  ++SG
Sbjct: 107 EEYGFEQYHRTEAANLVAWSSG 128


>UniRef50_Q7S6X6 Cluster: Actin-like protein arp-6; n=5;
           Pezizomycotina|Rep: Actin-like protein arp-6 -
           Neurospora crassa
          Length = 446

 Score = 46.0 bits (104), Expect = 7e-04
 Identities = 21/82 (25%), Positives = 42/82 (51%), Gaps = 3/82 (3%)
 Frame = +3

Query: 264 LTLKYPIEHGIVTNWDDMEKIWHHTFYNE---LRVAPEEHPVLLTEAPLNPKANREKMTQ 434
           L  + P+E G + NW+  ++IW   F+++    +  P +  ++LTE P +  + +    Q
Sbjct: 75  LAFRRPVEKGFIVNWEAQKEIWDREFFDDKAAQKCDPSDTRLILTEQPNSLPSLQTHCDQ 134

Query: 435 IMFETFNTPAMYVAIQAVLSLY 500
           I+FE +   + Y  +  V + Y
Sbjct: 135 IVFEEYGFASYYRGLGPVFNAY 156



 Score = 36.3 bits (80), Expect = 0.61
 Identities = 19/43 (44%), Positives = 26/43 (60%), Gaps = 4/43 (9%)
 Frame = +1

Query: 94  LVVDNGSGMCKAGFAGDD----APRAVFPSIVGRPRHQGVMVG 210
           LV+DNG+   KAGF  DD     PR + P+ + R RH+ + VG
Sbjct: 22  LVLDNGADTIKAGFVSDDKSDGKPR-IIPNCLARDRHRKIYVG 63


>UniRef50_Q7QA11 Cluster: ENSANGP00000003921; n=1; Anopheles gambiae
           str. PEST|Rep: ENSANGP00000003921 - Anopheles gambiae
           str. PEST
          Length = 390

 Score = 44.8 bits (101), Expect = 0.002
 Identities = 22/84 (26%), Positives = 48/84 (57%), Gaps = 3/84 (3%)
 Frame = +3

Query: 264 LTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEE---HPVLLTEAPLNPKANREKMTQ 434
           L L+   +  +VT+++  E+I+ + F  +L +  E    H V++TE   NP   R  M++
Sbjct: 58  LQLRTQFDRNVVTHYNVQEQIFDYIF-TKLGINSENSVPHKVMITECLFNPNYCRSLMSE 116

Query: 435 IMFETFNTPAMYVAIQAVLSLYAS 506
           ++FE ++ P +   + ++LS +++
Sbjct: 117 LLFECYDIPGLSYGVDSLLSFHSN 140



 Score = 34.7 bits (76), Expect = 1.9
 Identities = 14/32 (43%), Positives = 22/32 (68%)
 Frame = +1

Query: 94  LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPR 189
           +V+DNGS  C+AG+   + P  VF +I+ +PR
Sbjct: 5   IVIDNGSFNCRAGWMLKEKPALVFRNILAKPR 36


>UniRef50_Q7SHR0 Cluster: Actin-related protein 4; n=16;
           Pezizomycotina|Rep: Actin-related protein 4 - Neurospora
           crassa
          Length = 469

 Score = 44.8 bits (101), Expect = 0.002
 Identities = 20/47 (42%), Positives = 31/47 (65%)
 Frame = +3

Query: 369 EHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASG 509
           E+P+L+TEAP N    REK  +I  ET+  PA +++   VL+ +A+G
Sbjct: 145 ENPLLMTEAPWNSPKAREKAIEISMETWGVPAFWLSKTPVLAAFAAG 191



 Score = 37.5 bits (83), Expect = 0.26
 Identities = 16/34 (47%), Positives = 24/34 (70%)
 Frame = +1

Query: 79  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVG 180
           +EV+ALV+D G    +AG+AG++ P+ V PS  G
Sbjct: 20  DEVSALVLDPGYCNTRAGYAGEEMPKQVLPSFYG 53


>UniRef50_Q9UTQ7 Cluster: SWI/SNF and RSC complex subunit Arp9; n=1;
           Schizosaccharomyces pombe|Rep: SWI/SNF and RSC complex
           subunit Arp9 - Schizosaccharomyces pombe (Fission yeast)
          Length = 523

 Score = 44.4 bits (100), Expect = 0.002
 Identities = 25/82 (30%), Positives = 39/82 (47%), Gaps = 4/82 (4%)
 Frame = +3

Query: 279 PIEHGIVTNWDDMEKIWHHTFYNELRVAPEE----HPVLLTEAPLNPKANREKMTQIMFE 446
           PI+ G V +W+ ++  W H  Y+ L   P +    +PV L         +RE  TQ  FE
Sbjct: 113 PIQRGRVVDWEALKAFWKH-LYSLLLKDPNDTTFRYPVCLVIPTYWSLYDRELATQFFFE 171

Query: 447 TFNTPAMYVAIQAVLSLYASGV 512
               P   +A + ++ LYA G+
Sbjct: 172 ECQVPGFTIAYEPLMGLYAIGI 193


>UniRef50_A4S826 Cluster: Predicted protein; n=1; Ostreococcus
           lucimarinus CCE9901|Rep: Predicted protein -
           Ostreococcus lucimarinus CCE9901
          Length = 346

 Score = 43.6 bits (98), Expect = 0.004
 Identities = 21/27 (77%), Positives = 23/27 (85%), Gaps = 1/27 (3%)
 Frame = +1

Query: 70  MCDE-EVAALVVDNGSGMCKAGFAGDD 147
           M DE E++ALV DNGSGM KAGFAGDD
Sbjct: 1   MADEGELSALVCDNGSGMVKAGFAGDD 27


>UniRef50_Q6FMT7 Cluster: Similar to sp|Q12406 Saccharomyces
           cerevisiae YPR034w ARP7 Actin-like protein; n=1; Candida
           glabrata|Rep: Similar to sp|Q12406 Saccharomyces
           cerevisiae YPR034w ARP7 Actin-like protein - Candida
           glabrata (Yeast) (Torulopsis glabrata)
          Length = 529

 Score = 43.2 bits (97), Expect = 0.005
 Identities = 23/82 (28%), Positives = 44/82 (53%), Gaps = 7/82 (8%)
 Frame = +3

Query: 285 EHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIM-------F 443
           +HGI  NW  +E+++ + +  EL+V P E P+++T   L    NRE  T+I+       F
Sbjct: 87  DHGIPYNWKALERLYRYIYEKELKVDPSELPLVIT---LPSMTNRELETKIVENYMELAF 143

Query: 444 ETFNTPAMYVAIQAVLSLYASG 509
           E    P + + ++ +  + ++G
Sbjct: 144 EKLKVPVLQIVVEPLGIMLSTG 165


>UniRef50_Q0UJ41 Cluster: Putative uncharacterized protein; n=1;
           Phaeosphaeria nodorum|Rep: Putative uncharacterized
           protein - Phaeosphaeria nodorum (Septoria nodorum)
          Length = 645

 Score = 43.2 bits (97), Expect = 0.005
 Identities = 26/79 (32%), Positives = 37/79 (46%)
 Frame = +3

Query: 276 YPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN 455
           +PI+ G + +W     +  H  YN L   P    +LL   P       EK+TQ  FE F 
Sbjct: 101 WPIQDGRIVDWPCFYALLTHV-YNTLN-PPFHTAILLIAQPAWTPREHEKLTQFFFEKFK 158

Query: 456 TPAMYVAIQAVLSLYASGV 512
           TPA  +   A+ + +A GV
Sbjct: 159 TPAFGLMDAALATTWAYGV 177


>UniRef50_Q5KAQ4 Cluster: Actin-like protein ARP6; n=1;
           Filobasidiella neoformans|Rep: Actin-like protein ARP6 -
           Cryptococcus neoformans (Filobasidiella neoformans)
          Length = 490

 Score = 43.2 bits (97), Expect = 0.005
 Identities = 29/92 (31%), Positives = 42/92 (45%), Gaps = 7/92 (7%)
 Frame = +3

Query: 264 LTLKYPIEHGIVTNWDDMEKIWHHTFY-NELRVAPEEHPVLLTEAPLNPKANREKMTQIM 440
           +  + P E G++ NWD    IW   F  + L + P E  +L+TE   N     E   Q++
Sbjct: 58  IVYRRPFEKGMLVNWDAERIIWDRLFSPSVLNINPTETSLLVTEPYFNLPNIAETYDQMI 117

Query: 441 FETFNTPAMYVAIQAVL----SLYAS--GVPP 518
           FE F   + +    A L     LY S  G+PP
Sbjct: 118 FEEFEFQSYFRCAPAALIPYGGLYESDQGIPP 149


>UniRef50_A6R1X8 Cluster: Putative uncharacterized protein; n=1;
           Ajellomyces capsulatus NAm1|Rep: Putative
           uncharacterized protein - Ajellomyces capsulatus NAm1
          Length = 444

 Score = 42.7 bits (96), Expect = 0.007
 Identities = 20/47 (42%), Positives = 28/47 (59%)
 Frame = +3

Query: 369 EHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASG 509
           + P+L+TE   NP   REK  +I  E + TPA Y+A    L+ +ASG
Sbjct: 139 DSPLLMTECGWNPVKAREKTIEIAMEKWGTPAFYLARNGPLAAFASG 185



 Score = 41.1 bits (92), Expect = 0.021
 Identities = 15/35 (42%), Positives = 26/35 (74%)
 Frame = +1

Query: 79  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGR 183
           +EV+A+++D G    +AGFAG+D P++V P+  G+
Sbjct: 15  DEVSAIILDPGYSTVRAGFAGEDTPKSVIPTCYGK 49


>UniRef50_Q3M0X0 Cluster: Actin6-2; n=3; Paramecium tetraurelia|Rep:
           Actin6-2 - Paramecium tetraurelia
          Length = 394

 Score = 41.9 bits (94), Expect = 0.012
 Identities = 26/121 (21%), Positives = 59/121 (48%), Gaps = 1/121 (0%)
 Frame = +3

Query: 249 EQRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAP-EEHPVLLTEAPLNPKANREK 425
           E++  + L  PI+ G + N + M++ W +   + L+++  ++  +L+ +   N K  + K
Sbjct: 68  EKKLNVQLSNPIKDGKIDNVESMKEFWQYILEDGLQISELQQVNLLIIDQVKNSKEYKSK 127

Query: 426 MTQIMFETFNTPAMYVAIQAVLSLYASGVPPVSCWTSATVSSTPCPFTKGYALPPRHSLR 605
           + ++ F+     ++     A LSL+++G+            +T  P  +G+  P  H+L 
Sbjct: 128 LAEVFFDYLKVQSVLFMNSASLSLFSTGLVSGLSIELGHAVNTIVPIYQGF--PIMHALE 185

Query: 606 F 608
           F
Sbjct: 186 F 186


>UniRef50_Q7M3Y5 Cluster: Actin; n=1; Aplysia californica|Rep: Actin
           - Aplysia californica (California sea hare)
          Length = 92

 Score = 41.5 bits (93), Expect = 0.016
 Identities = 19/20 (95%), Positives = 19/20 (95%)
 Frame = +1

Query: 85  VAALVVDNGSGMCKAGFAGD 144
           VAALVVDNGSGM KAGFAGD
Sbjct: 1   VAALVVDNGSGMXKAGFAGD 20



 Score = 41.1 bits (92), Expect = 0.021
 Identities = 18/21 (85%), Positives = 19/21 (90%)
 Frame = +3

Query: 339 FYNELRVAPEEHPVLLTEAPL 401
           F  +LRVAPEEHPVLLTEAPL
Sbjct: 17  FAGDLRVAPEEHPVLLTEAPL 37


>UniRef50_A4RLB1 Cluster: Putative uncharacterized protein; n=1;
           Magnaporthe grisea|Rep: Putative uncharacterized protein
           - Magnaporthe grisea (Rice blast fungus) (Pyricularia
           grisea)
          Length = 445

 Score = 41.1 bits (92), Expect = 0.021
 Identities = 19/53 (35%), Positives = 32/53 (60%)
 Frame = +3

Query: 351 LRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASG 509
           L +A  E+P+L+TE+P N    REK  ++  E +  PA ++    VL+ +A+G
Sbjct: 95  LELALGENPLLMTESPWNTPKAREKAIELAMEGWGVPAFWLTKTPVLAAFAAG 147


>UniRef50_Q10CH7 Cluster: Actin-related protein 7, putative,
           expressed; n=5; Oryza sativa|Rep: Actin-related protein
           7, putative, expressed - Oryza sativa subsp. japonica
           (Rice)
          Length = 398

 Score = 40.3 bits (90), Expect = 0.037
 Identities = 19/34 (55%), Positives = 24/34 (70%)
 Frame = +3

Query: 408 KANREKMTQIMFETFNTPAMYVAIQAVLSLYASG 509
           +A RE++ Q+MFE FN    Y + QAVLSLYA G
Sbjct: 156 QALREQLAQLMFEKFNVSGFYDSEQAVLSLYAVG 189


>UniRef50_Q5AXH1 Cluster: Actin-like protein arp6; n=5;
           Trichocomaceae|Rep: Actin-like protein arp6 - Emericella
           nidulans (Aspergillus nidulans)
          Length = 479

 Score = 40.3 bits (90), Expect = 0.037
 Identities = 23/98 (23%), Positives = 47/98 (47%), Gaps = 9/98 (9%)
 Frame = +3

Query: 264 LTLKYPIEHGIVTNWDDMEKIWHHTFYN-------ELRVA-PEEHPVLLTEAPLNPKANR 419
           +  + P+E G   NW+  ++IW ++F++       EL +A PE+  ++ TEAP    A +
Sbjct: 86  MLFRRPVEKGYTVNWEAQKEIWENSFFDERTVRSKELHIADPEDVTIIFTEAPNALPALQ 145

Query: 420 EKMTQIMFETFNTPAMYVAIQAVLSLYASGV-PPVSCW 530
           +   +I+ E +        +  +   +A    P ++ W
Sbjct: 146 KNADEIIMEEWGFGGYLRCVVGMAKPFALNTGPSLNAW 183


>UniRef50_UPI0000498FDF Cluster: actin; n=1; Entamoeba histolytica
           HM-1:IMSS|Rep: actin - Entamoeba histolytica HM-1:IMSS
          Length = 763

 Score = 39.9 bits (89), Expect = 0.049
 Identities = 21/53 (39%), Positives = 30/53 (56%)
 Frame = +1

Query: 97  VVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 255
           ++D GS   K+GF     P  V P++VG+  HQ    G  +++ YVGDEA  K
Sbjct: 425 IIDIGSCSIKSGFESVGTPSIVTPTVVGKNLHQ--TSGFVEQNLYVGDEAIDK 475


>UniRef50_A7TST0 Cluster: Putative uncharacterized protein; n=1;
           Vanderwaltozyma polyspora DSM 70294|Rep: Putative
           uncharacterized protein - Vanderwaltozyma polyspora DSM
           70294
          Length = 501

 Score = 39.9 bits (89), Expect = 0.049
 Identities = 23/83 (27%), Positives = 38/83 (45%), Gaps = 1/83 (1%)
 Frame = +3

Query: 270 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEH-PVLLTEAPLNPKANREKMTQIMFE 446
           +K  +++G V +WD  ++ W     N L +      P  LTE   N   NR+K  +++ E
Sbjct: 88  IKPIVKNGEVIDWDGAQEQWDWALKNALYLESNSGIPAFLTEPIWNTVENRKKSLEVLLE 147

Query: 447 TFNTPAMYVAIQAVLSLYASGVP 515
                A Y++       +ASG P
Sbjct: 148 GLQFEACYLSPTPTCISFASGRP 170



 Score = 37.1 bits (82), Expect = 0.35
 Identities = 14/34 (41%), Positives = 23/34 (67%)
 Frame = +1

Query: 79  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVG 180
           +E++A+V+D GS     G++G D P+A+ PS  G
Sbjct: 12  DEISAVVIDPGSFTTNIGYSGTDCPQAILPSYYG 45


>UniRef50_Q9GZN1 Cluster: Actin-related protein 6; n=26;
           Chordata|Rep: Actin-related protein 6 - Homo sapiens
           (Human)
          Length = 396

 Score = 39.9 bits (89), Expect = 0.049
 Identities = 20/75 (26%), Positives = 38/75 (50%), Gaps = 1/75 (1%)
 Frame = +3

Query: 279 PIEHGIVTNWDDMEKIWHHTFYNEL-RVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN 455
           P + G + NWD   ++W + F  E+ +V   +  +++TE   N  + +E M +I+FE + 
Sbjct: 59  PFQKGYLVNWDVQRQVWDYLFGKEMYQVDFLDTNIIITEPYFNFTSIQESMNEILFEEYQ 118

Query: 456 TPAMYVAIQAVLSLY 500
             A+       LS +
Sbjct: 119 FQAVLRVNAGALSAH 133


>UniRef50_A4S172 Cluster: Predicted protein; n=3; Ostreococcus|Rep:
           Predicted protein - Ostreococcus lucimarinus CCE9901
          Length = 503

 Score = 39.5 bits (88), Expect = 0.065
 Identities = 21/77 (27%), Positives = 34/77 (44%)
 Frame = +3

Query: 264 LTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMF 443
           L L+ P + G V +W+   +I        L V P    +++TE P      RE + +++F
Sbjct: 88  LALRRPCDRGYVVHWEQQREILDDALRRTLGVDPTRCDLIITEPPFALPRTREALDEMVF 147

Query: 444 ETFNTPAMYVAIQAVLS 494
           E F      V   A L+
Sbjct: 148 EYFGFRRALVTTPAKLT 164


>UniRef50_Q0IFH2 Cluster: Actin; n=4; Endopterygota|Rep: Actin -
           Aedes aegypti (Yellowfever mosquito)
          Length = 400

 Score = 39.5 bits (88), Expect = 0.065
 Identities = 18/62 (29%), Positives = 36/62 (58%), Gaps = 1/62 (1%)
 Frame = +3

Query: 285 EHGIVTNWDDMEKIWHHTFYNEL-RVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTP 461
           + G + NWD  + +W + F ++   V   E P+L+TE   N ++ +E M +I++E ++  
Sbjct: 65  QRGYLVNWDIQKTVWDYMFSSDCCPVNFSETPLLITEPLFNFQSIQEAMLEILYEEYDCD 124

Query: 462 AM 467
           A+
Sbjct: 125 AV 126


>UniRef50_Q0H7S7 Cluster: Actin; n=29; Sordariomycetes|Rep: Actin -
           Phaeoacremonium sphinctrophorum
          Length = 39

 Score = 39.5 bits (88), Expect = 0.065
 Identities = 16/19 (84%), Positives = 18/19 (94%)
 Frame = +1

Query: 118 MCKAGFAGDDAPRAVFPSI 174
           MCKAGFAGDDAPRAVF ++
Sbjct: 1   MCKAGFAGDDAPRAVFRNL 19


>UniRef50_A7TM96 Cluster: Putative uncharacterized protein; n=1;
           Vanderwaltozyma polyspora DSM 70294|Rep: Putative
           uncharacterized protein - Vanderwaltozyma polyspora DSM
           70294
          Length = 488

 Score = 39.5 bits (88), Expect = 0.065
 Identities = 22/73 (30%), Positives = 37/73 (50%), Gaps = 7/73 (9%)
 Frame = +3

Query: 291 GIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANR-------EKMTQIMFET 449
           G+  NW+ +EK W + F  +L+  P E PVL+T  P +   N        E+  +I FE 
Sbjct: 73  GVPYNWEALEKQWEYIFEKQLKCDPTELPVLIT-IPSSISKNEDIENKVIEQYCKIAFEK 131

Query: 450 FNTPAMYVAIQAV 488
           F  P + +  +++
Sbjct: 132 FKIPYLQIVNESL 144


>UniRef50_Q6BXN0 Cluster: Actin-related protein 4; n=7;
           Saccharomycetales|Rep: Actin-related protein 4 -
           Debaryomyces hansenii (Yeast) (Torulaspora hansenii)
          Length = 492

 Score = 39.5 bits (88), Expect = 0.065
 Identities = 17/78 (21%), Positives = 40/78 (51%)
 Frame = +3

Query: 282 IEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTP 461
           ++  ++ +W+   + +H+ F + L +  +E P+L+TE        R+ + +  +E F+ P
Sbjct: 88  LKDSVIIDWEAAIEQYHYYFDDVLTLNYKEQPILITEPVWCTPQYRQTLLETFYENFDFP 147

Query: 462 AMYVAIQAVLSLYASGVP 515
           A+++A       +  G P
Sbjct: 148 ALFLAKSPTCISFQQGRP 165



 Score = 35.9 bits (79), Expect = 0.80
 Identities = 15/49 (30%), Positives = 28/49 (57%)
 Frame = +1

Query: 79  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKD 225
           +E+ A+V+D+ S   + G+AGDD P+ + PS    P    + +   +K+
Sbjct: 14  DEINAIVLDSSSFHTRIGYAGDDFPKIITPSSYASPNEDAMELDNKKKN 62


>UniRef50_Q5CWA5 Cluster: Actin; n=2; Cryptosporidium|Rep: Actin -
           Cryptosporidium parvum Iowa II
          Length = 389

 Score = 39.1 bits (87), Expect = 0.086
 Identities = 19/74 (25%), Positives = 34/74 (45%)
 Frame = +3

Query: 363 PEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGVPPVSCWTSAT 542
           P+++PV+L E P  P      + QI+ E +  P +    + ++SL+ +G          T
Sbjct: 93  PKDYPVILLERPFFPIELSNYIKQILLENYQVPGVKRISEPIVSLFTTGFKTGIVVDIGT 152

Query: 543 VSSTPCPFTKGYAL 584
             +  CP   GY +
Sbjct: 153 NETIVCPIYDGYPI 166


>UniRef50_A1C924 Cluster: Actin family protein; n=4;
           Eurotiomycetidae|Rep: Actin family protein - Aspergillus
           clavatus
          Length = 436

 Score = 39.1 bits (87), Expect = 0.086
 Identities = 18/53 (33%), Positives = 32/53 (60%), Gaps = 8/53 (15%)
 Frame = +3

Query: 264 LTLKYPIEHGIVTNWDDMEKIWHHTFYNE-------LRVA-PEEHPVLLTEAP 398
           +  + P+E G + NW+  ++IW  +F++E       LR+  PE+  ++LTEAP
Sbjct: 86  MAFRRPVEKGYIVNWEAQKEIWETSFFDEKTVRSKDLRIENPEDTTLVLTEAP 138


>UniRef50_Q963K1 Cluster: Actin-3; n=1; Cercomonas sp. ATCC
           50318|Rep: Actin-3 - Cercomonas sp. ATCC 50318
          Length = 266

 Score = 38.7 bits (86), Expect = 0.11
 Identities = 15/21 (71%), Positives = 19/21 (90%)
 Frame = +2

Query: 509 RTTGIVLDFGDGVFHTVPIYE 571
           RTTG+VLD GDG+ +TVPIY+
Sbjct: 22  RTTGVVLDSGDGITYTVPIYD 42



 Score = 34.3 bits (75), Expect = 2.4
 Identities = 17/46 (36%), Positives = 26/46 (56%)
 Frame = +3

Query: 450 FNTPAMYVAIQAVLSLYASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           FNTPA++++  A+L+LY+SG        S    +   P   GYA+P
Sbjct: 2   FNTPAVHISNSAMLALYSSGRTTGVVLDSGDGITYTVPIYDGYAIP 47


>UniRef50_Q4UGT7 Cluster: Actin-related protein, putative; n=2;
           Theileria|Rep: Actin-related protein, putative -
           Theileria annulata
          Length = 575

 Score = 38.7 bits (86), Expect = 0.11
 Identities = 23/72 (31%), Positives = 34/72 (47%), Gaps = 1/72 (1%)
 Frame = +3

Query: 345 NELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTP-AMYVAIQAVLSLYASGVPPV 521
           N L V PE   + LTEA L P  +R+   +I+FE F  P A +++ Q   S +     P 
Sbjct: 128 NYLSVIPESSSICLTEANLCPAQSRQLSAEIIFEDFGFPLACFLSSQTASSYFYQNYTPS 187

Query: 522 SCWTSATVSSTP 557
              +   + S P
Sbjct: 188 RAKSDPVLYSYP 199



 Score = 36.7 bits (81), Expect = 0.46
 Identities = 15/32 (46%), Positives = 22/32 (68%)
 Frame = +1

Query: 94  LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPR 189
           +V++NGSG  K G AG+  P  V P+ VG+P+
Sbjct: 12  VVLENGSGYVKIGMAGNKKPPHVIPNCVGQPK 43


>UniRef50_A7AWQ4 Cluster: Actin, putative; n=1; Babesia bovis|Rep:
           Actin, putative - Babesia bovis
          Length = 405

 Score = 38.7 bits (86), Expect = 0.11
 Identities = 17/47 (36%), Positives = 29/47 (61%)
 Frame = +3

Query: 369 EHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASG 509
           +HP+++TE     K  R+   +I+FE  + PA Y+A +A LS ++ G
Sbjct: 126 QHPMMVTEPTAECKQFRDCTLEILFEQLDVPAAYLAKRATLSAFSVG 172


>UniRef50_A3FQH9 Cluster: Actin-like protein, putative; n=2;
           Cryptosporidium|Rep: Actin-like protein, putative -
           Cryptosporidium parvum Iowa II
          Length = 367

 Score = 38.7 bits (86), Expect = 0.11
 Identities = 20/75 (26%), Positives = 38/75 (50%)
 Frame = +3

Query: 279 PIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNT 458
           P   G++ +      IW + F N++ ++P +  +L+TE  LNP + +  + +I+FE F  
Sbjct: 44  PFSEGLLIDVSMENDIWEYIF-NKMNISPGDIGLLVTEPFLNPSSLQHSLFEIIFEQFGF 102

Query: 459 PAMYVAIQAVLSLYA 503
               V     +S +A
Sbjct: 103 NKAIVTNPPAISQFA 117


>UniRef50_Q4WA13 Cluster: Chromatin remodeling complex subunit
           (Arp5), putative; n=14; Pezizomycotina|Rep: Chromatin
           remodeling complex subunit (Arp5), putative -
           Aspergillus fumigatus (Sartorya fumigata)
          Length = 757

 Score = 38.7 bits (86), Expect = 0.11
 Identities = 16/41 (39%), Positives = 28/41 (68%)
 Frame = +1

Query: 88  AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVG 210
           +A+V+DNGS + KAG++ D +PR + P ++ R R + +  G
Sbjct: 59  SAIVIDNGSSLLKAGWSFDVSPRFILPPVMSRYRDRKLNKG 99



 Score = 38.3 bits (85), Expect = 0.15
 Identities = 22/80 (27%), Positives = 40/80 (50%), Gaps = 5/80 (6%)
 Frame = +3

Query: 270 LKYPIEHG--IVTNWDDMEKIWHHTFYN---ELRVAPEEHPVLLTEAPLNPKANREKMTQ 434
           L+Y  + G  +V NWD ME +  + F     +      + P+++TE   N    R  M +
Sbjct: 117 LRYAFDPGTSVVGNWDVMEGLLDYVFIKLGVDGANGGVDRPIVMTEPIANLNYPRRMMNE 176

Query: 435 IMFETFNTPAMYVAIQAVLS 494
           I+FE ++ P++   I ++ S
Sbjct: 177 ILFECYSAPSVAYGIDSLFS 196


>UniRef50_Q9NZ32 Cluster: Actin-related protein 10; n=40;
           Eumetazoa|Rep: Actin-related protein 10 - Homo sapiens
           (Human)
          Length = 417

 Score = 38.7 bits (86), Expect = 0.11
 Identities = 15/34 (44%), Positives = 21/34 (61%)
 Frame = +1

Query: 82  EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGR 183
           E  A+V+D G    K GFAG+  PR + PS++ R
Sbjct: 12  EKTAVVIDLGEAFTKCGFAGETGPRCIIPSVIKR 45


>UniRef50_A6RD01 Cluster: Putative uncharacterized protein; n=1;
           Ajellomyces capsulatus NAm1|Rep: Putative
           uncharacterized protein - Ajellomyces capsulatus NAm1
          Length = 762

 Score = 38.3 bits (85), Expect = 0.15
 Identities = 20/70 (28%), Positives = 35/70 (50%), Gaps = 3/70 (4%)
 Frame = +3

Query: 294 IVTNWDDMEKIWHHTFYN---ELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPA 464
           ++ NWD ME +  + F     +      + P++LTE   N    R  M +I+FE ++ PA
Sbjct: 179 VIGNWDVMEGVLDYIFLKLGVDGANGSVDRPIVLTEPIANLGYTRRMMNEILFECYSAPA 238

Query: 465 MYVAIQAVLS 494
           +   I ++ S
Sbjct: 239 VAYGIDSLFS 248



 Score = 36.7 bits (81), Expect = 0.46
 Identities = 14/34 (41%), Positives = 25/34 (73%)
 Frame = +1

Query: 88  AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPR 189
           +A+V+DNGS + KAG++ D +PR + P ++ + R
Sbjct: 111 SAIVIDNGSYLVKAGWSFDKSPRFIIPPVMAKYR 144


>UniRef50_UPI00006CC3F4 Cluster: Actin family protein; n=1;
           Tetrahymena thermophila SB210|Rep: Actin family protein
           - Tetrahymena thermophila SB210
          Length = 725

 Score = 37.9 bits (84), Expect = 0.20
 Identities = 17/76 (22%), Positives = 39/76 (51%), Gaps = 2/76 (2%)
 Frame = +3

Query: 279 PIEHGIVTNWDDMEKIWHHTFYNELRVAPE--EHPVLLTEAPLNPKANREKMTQIMFETF 452
           P E  I+  +  +E + +   +NE+ V     +HP+++TE   NP+  R+ + +  FE +
Sbjct: 106 PYERNIIQQFGLLENL-NDFIFNEIGVVESKVDHPLIITEPVANPEYCRQNLLEQYFECY 164

Query: 453 NTPAMYVAIQAVLSLY 500
             P++ + +    + +
Sbjct: 165 EIPSVMIGVDTFFATF 180


>UniRef50_A3FQE6 Cluster: Putative uncharacterized protein; n=2;
           Cryptosporidium|Rep: Putative uncharacterized protein -
           Cryptosporidium parvum Iowa II
          Length = 396

 Score = 37.5 bits (83), Expect = 0.26
 Identities = 13/36 (36%), Positives = 25/36 (69%)
 Frame = +1

Query: 88  AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQ 195
           +++++D G+   +AG+ GDD PR+V P+ +G P  +
Sbjct: 15  SSIILDIGTQSIRAGYGGDDLPRSVVPTCIGIPNKE 50


>UniRef50_Q5K9I3 Cluster: Protein-vacuolar targeting-related
           protein, putative; n=1; Filobasidiella neoformans|Rep:
           Protein-vacuolar targeting-related protein, putative -
           Cryptococcus neoformans (Filobasidiella neoformans)
          Length = 724

 Score = 37.5 bits (83), Expect = 0.26
 Identities = 18/75 (24%), Positives = 36/75 (48%)
 Frame = +3

Query: 369 EHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGVPPVSCWTSATVS 548
           +HP+++TE   NP  +R   ++++FE +N P++   + ++ +    G            +
Sbjct: 123 QHPIVMTERLANPLFSRAMTSELLFELYNAPSVAFGVDSLFAFSRQGKKDGLTINLGHQA 182

Query: 549 STPCPFTKGYALPPR 593
           +T  P   G AL  R
Sbjct: 183 TTIIPIFDGQALVNR 197


>UniRef50_P45890 Cluster: Actin-like protein 13E; n=8;
           Eumetazoa|Rep: Actin-like protein 13E - Drosophila
           melanogaster (Fruit fly)
          Length = 398

 Score = 37.5 bits (83), Expect = 0.26
 Identities = 16/73 (21%), Positives = 37/73 (50%), Gaps = 1/73 (1%)
 Frame = +3

Query: 285 EHGIVTNWDDMEKIWHHTFYNE-LRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTP 461
           + G + NW   + +W + F  + +  + E   +++TE  +N ++ +E   +I+FE +   
Sbjct: 64  QRGYLLNWHTQKTVWDYIFSKDGIGCSLENRNIVITEPQMNFQSIQEATLEILFEEYKVD 123

Query: 462 AMYVAIQAVLSLY 500
            +Y    A L+ +
Sbjct: 124 GVYKTTAADLAAF 136


>UniRef50_Q4UIK3 Cluster: Actin, putative; n=2; Theileria|Rep:
           Actin, putative - Theileria annulata
          Length = 468

 Score = 37.1 bits (82), Expect = 0.35
 Identities = 19/73 (26%), Positives = 36/73 (49%)
 Frame = +3

Query: 366 EEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGVPPVSCWTSATV 545
           ++ PV+++E  L+    R+  T+++FETF    +++  ++ LS YAS             
Sbjct: 110 QDTPVIVSEPSLHNPKFRQNFTELLFETFKVENVFLCKRSALSCYASACTSGVVVDIGGS 169

Query: 546 SSTPCPFTKGYAL 584
            +   P  +GY L
Sbjct: 170 CTNIAPVLEGYTL 182


>UniRef50_Q09443 Cluster: Actin-like protein C08B11.6; n=2;
           Caenorhabditis|Rep: Actin-like protein C08B11.6 -
           Caenorhabditis elegans
          Length = 418

 Score = 37.1 bits (82), Expect = 0.35
 Identities = 19/58 (32%), Positives = 29/58 (50%)
 Frame = +3

Query: 279 PIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETF 452
           PIE G V NWD  ++IW  TF   + V      + LT+      A  +  ++I+F+ F
Sbjct: 62  PIERGYVVNWDTQQQIWEKTF-GSMDVEASTSRIALTDNNYLIPALPDVSSEILFDYF 118


>UniRef50_Q6SQL6 Cluster: Actin; n=1; Pandalus platyceros|Rep: Actin
           - Pandalus platyceros
          Length = 179

 Score = 36.3 bits (80), Expect = 0.61
 Identities = 22/50 (44%), Positives = 29/50 (58%), Gaps = 2/50 (4%)
 Frame = +3

Query: 444 ETFNTPAMYVAIQAVLSLYAS--GVPPVSCWTSATVSSTPCPFTKGYALP 587
           E+F+TPAMY    + LS  ++   +P VS  T   VS T CP   G+ALP
Sbjct: 1   ESFSTPAMYCISASRLSSPSTPLAIPLVSSVTLLMVSPTWCPSMIGFALP 50


>UniRef50_Q75BT7 Cluster: ACR184Cp; n=1; Eremothecium gossypii|Rep:
           ACR184Cp - Ashbya gossypii (Yeast) (Eremothecium
           gossypii)
          Length = 401

 Score = 35.9 bits (79), Expect = 0.80
 Identities = 16/59 (27%), Positives = 29/59 (49%)
 Frame = +3

Query: 291 GIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAM 467
           G+ T+W+ +E+     +  +LRV PEE PV +T  P      R +  +++      P +
Sbjct: 65  GVPTDWEMLERFCRWIYATQLRVGPEELPVCITVPPDLSATVRSQFHELVLCKLRAPVL 123


>UniRef50_Q4UF64 Cluster: Actin-related protein, putative; n=2;
           Theileria|Rep: Actin-related protein, putative -
           Theileria annulata
          Length = 451

 Score = 35.1 bits (77), Expect = 1.4
 Identities = 16/53 (30%), Positives = 28/53 (52%)
 Frame = +3

Query: 351 LRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASG 509
           L + P  HP+L+ E     K  R+   +++FE     A Y+A +A L+ ++ G
Sbjct: 120 LGLDPSIHPILVVEPTAESKQFRDSSLEVIFEQIGACASYLAKRAALTAFSVG 172


>UniRef50_A7AQU0 Cluster: Actin-related, putative; n=1; Babesia
           bovis|Rep: Actin-related, putative - Babesia bovis
          Length = 508

 Score = 35.1 bits (77), Expect = 1.4
 Identities = 16/49 (32%), Positives = 24/49 (48%)
 Frame = +1

Query: 97  VVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDE 243
           VVDNGSG+ K   A    P  V P+ +G P+ +     +    +  GD+
Sbjct: 13  VVDNGSGLLKFSLASSVKPPFVLPNCIGHPKRKFTSQNLADGSASGGDD 61


>UniRef50_Q9P708 Cluster: Putative uncharacterized protein
           13E11.080; n=1; Neurospora crassa|Rep: Putative
           uncharacterized protein 13E11.080 - Neurospora crassa
          Length = 267

 Score = 35.1 bits (77), Expect = 1.4
 Identities = 21/67 (31%), Positives = 27/67 (40%)
 Frame = +3

Query: 369 EHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGVPPVSCWTSATVS 548
           + PV  T+    P        +I   T  +P     +  +L  Y  G P  S  TSAT S
Sbjct: 131 DRPVTPTDVSPAPSFRARSYKRISRPTLLSPTATAELHELLMAYLYGTPSSSNLTSATTS 190

Query: 549 STPCPFT 569
           S P P T
Sbjct: 191 SAPSPTT 197


>UniRef50_Q8I450 Cluster: Actin-related protein, putative; n=5;
           Plasmodium|Rep: Actin-related protein, putative -
           Plasmodium falciparum (isolate 3D7)
          Length = 565

 Score = 34.7 bits (76), Expect = 1.9
 Identities = 15/35 (42%), Positives = 22/35 (62%)
 Frame = +1

Query: 82  EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRP 186
           ++ ++V+D G    K G+AGD+ P  VF S VG P
Sbjct: 6   DILSIVIDLGFENTKVGYAGDENPTNVFSSNVGMP 40


>UniRef50_UPI00015B5EE4 Cluster: PREDICTED: similar to Actin-related
           protein 10 homolog (S. cerevisiae); n=1; Nasonia
           vitripennis|Rep: PREDICTED: similar to Actin-related
           protein 10 homolog (S. cerevisiae) - Nasonia vitripennis
          Length = 373

 Score = 34.3 bits (75), Expect = 2.4
 Identities = 13/61 (21%), Positives = 33/61 (54%)
 Frame = +3

Query: 330 HHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASG 509
           H+ F+    ++P++  +++ E+PL P   R  + ++MF  F   ++ V    ++++   G
Sbjct: 73  HYIFFKRTVISPKDIRIVILESPLIPSKFRNTLVKVMFRHFEVGSLMVLPAHLVTISTLG 132

Query: 510 V 512
           +
Sbjct: 133 M 133


>UniRef50_Q7RR61 Cluster: Actin-like 6; n=3; Plasmodium
           (Vinckeia)|Rep: Actin-like 6 - Plasmodium yoelii yoelii
          Length = 538

 Score = 34.3 bits (75), Expect = 2.4
 Identities = 14/35 (40%), Positives = 24/35 (68%)
 Frame = +1

Query: 82  EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRP 186
           +V+++V+D G    K G++GD+ P+ +F S VG P
Sbjct: 6   DVSSIVIDLGFENIKLGYSGDENPKNIFSSNVGVP 40


>UniRef50_Q2H309 Cluster: Putative uncharacterized protein; n=1;
           Chaetomium globosum|Rep: Putative uncharacterized
           protein - Chaetomium globosum (Soil fungus)
          Length = 675

 Score = 34.3 bits (75), Expect = 2.4
 Identities = 19/75 (25%), Positives = 35/75 (46%)
 Frame = +3

Query: 276 YPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN 455
           YPI+ G + N +       H  + +L       PV+L  +P   + + E +T+ +FE   
Sbjct: 103 YPIQAGRIANMEAFLAFLEHV-HAQLTTTYHNTPVMLMASPQWTRPDCETITRYVFEKTK 161

Query: 456 TPAMYVAIQAVLSLY 500
           TPA+ +    + + Y
Sbjct: 162 TPALCLIHSGIATQY 176


>UniRef50_Q47QE0 Cluster: Probable amino-acid transmembrane
           lipoprotein ABC transporter; n=1; Thermobifida fusca
           YX|Rep: Probable amino-acid transmembrane lipoprotein
           ABC transporter - Thermobifida fusca (strain YX)
          Length = 295

 Score = 33.9 bits (74), Expect = 3.2
 Identities = 21/59 (35%), Positives = 29/59 (49%), Gaps = 1/59 (1%)
 Frame = -3

Query: 568 VNGHGVEDTVAEV-QHDTGGTPDAYSESTAWMATYMAGVLNVSNMIWVIFSLLALGLRG 395
           V G G    +  + QH T   P  +S ST    TY  G +++SN+  VI  + A GL G
Sbjct: 99  VGGIGAASVLLAIAQHYTKSVPFGFSASTFKTTTYQLGAIHISNVQLVIL-VAAFGLAG 156


>UniRef50_A0UKU0 Cluster: FAD dependent oxidoreductase; n=5;
           Burkholderia cepacia complex|Rep: FAD dependent
           oxidoreductase - Burkholderia multivorans ATCC 17616
          Length = 374

 Score = 33.9 bits (74), Expect = 3.2
 Identities = 18/51 (35%), Positives = 29/51 (56%), Gaps = 1/51 (1%)
 Frame = -2

Query: 587 GKCVSFRKWARCGRHRRRSPARYRWYAGRVQREHGLD-GDVHGGRVECFEH 438
           G+C+ + +W+R       S  R+  +A ++QRE G+D G    G +E FEH
Sbjct: 58  GRCLPYARWSR------ESSERWGAFAAQLQRETGVDCGFERPGGIELFEH 102


>UniRef50_UPI0000E477BD Cluster: PREDICTED: similar to
           uncharacterized hypothalamus protein HARP11; n=1;
           Strongylocentrotus purpuratus|Rep: PREDICTED: similar to
           uncharacterized hypothalamus protein HARP11 -
           Strongylocentrotus purpuratus
          Length = 481

 Score = 33.5 bits (73), Expect = 4.3
 Identities = 15/30 (50%), Positives = 18/30 (60%)
 Frame = +1

Query: 82  EVAALVVDNGSGMCKAGFAGDDAPRAVFPS 171
           E  A V D G+   K GFAG+ +PRA  PS
Sbjct: 12  EKTAAVFDIGAAYTKVGFAGETSPRATIPS 41


>UniRef50_Q4UAS1 Cluster: Theileria-specific sub-telomeric protein,
           SVSP family, putative; n=1; Theileria annulata|Rep:
           Theileria-specific sub-telomeric protein, SVSP family,
           putative - Theileria annulata
          Length = 743

 Score = 33.5 bits (73), Expect = 4.3
 Identities = 19/42 (45%), Positives = 22/42 (52%), Gaps = 1/42 (2%)
 Frame = -3

Query: 259 PLCSVPHLLHKSPSVPYR-PSRPDGGAFPRSRGTRREEHHLL 137
           P  S P LLH  P+VP R PS P  G    + GT R   H+L
Sbjct: 356 PRLSRPVLLHPRPTVPLRHPSNPGPGILGPAPGTLRFPSHIL 397


>UniRef50_A5KAY0 Cluster: Actin-related protein, putative; n=1;
           Plasmodium vivax|Rep: Actin-related protein, putative -
           Plasmodium vivax
          Length = 600

 Score = 33.5 bits (73), Expect = 4.3
 Identities = 15/35 (42%), Positives = 22/35 (62%)
 Frame = +1

Query: 82  EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRP 186
           ++ ++VVD G    K G+AGD+ P  +F S VG P
Sbjct: 6   DILSIVVDLGFENTKIGYAGDENPTNIFSSNVGVP 40


>UniRef50_Q4PFM4 Cluster: Putative uncharacterized protein; n=2;
            cellular organisms|Rep: Putative uncharacterized protein
            - Ustilago maydis (Smut fungus)
          Length = 2677

 Score = 33.5 bits (73), Expect = 4.3
 Identities = 26/86 (30%), Positives = 37/86 (43%)
 Frame = +3

Query: 354  RVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGVPPVSCWT 533
            R AP+  P     A + P+   E MT +MF  F++PA   A     +    G  PV+   
Sbjct: 1718 RSAPD--PSSSASATVPPQKQSEPMTPLMFGGFDSPAAAHAKAPAKAFAGFGSSPVA--P 1773

Query: 534  SATVSSTPCPFTKGYALPPRHSLRFG 611
             AT ++     +   A PP   L FG
Sbjct: 1774 PATTAAAAPSISAPKAAPPSQPLSFG 1799


>UniRef50_Q4P820 Cluster: Putative uncharacterized protein; n=1;
           Ustilago maydis|Rep: Putative uncharacterized protein -
           Ustilago maydis (Smut fungus)
          Length = 724

 Score = 33.5 bits (73), Expect = 4.3
 Identities = 22/78 (28%), Positives = 34/78 (43%), Gaps = 10/78 (12%)
 Frame = +3

Query: 264 LTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAP----------EEHPVLLTEAPLNPKA 413
           L L+ P + GIV +W   + IW H   N L   P              V++TEA LN + 
Sbjct: 126 LHLRLPHQSGIVVDWAAQKTIWDHVLTNHLAKLPGGIAKRGKLLAGKAVIMTEAYLNLEP 185

Query: 414 NREKMTQIMFETFNTPAM 467
            +     ++FE +   A+
Sbjct: 186 AQHATDLLLFEHYGAQAV 203


>UniRef50_A7EFN6 Cluster: Putative uncharacterized protein; n=1;
            Sclerotinia sclerotiorum 1980|Rep: Putative
            uncharacterized protein - Sclerotinia sclerotiorum 1980
          Length = 1510

 Score = 33.5 bits (73), Expect = 4.3
 Identities = 17/45 (37%), Positives = 26/45 (57%), Gaps = 2/45 (4%)
 Frame = -1

Query: 165  EHGARSIISCETGLAHTGAIVYYQRG--NFFVAHLELVKLVRCRC 37
            EH A++I SC T + H GA V Y +G  +  +A+L+  K +   C
Sbjct: 1250 EHSAQAIFSCATVVIHNGADVSYLKGYSSLRIANLQSTKELAALC 1294


>UniRef50_UPI0000E254E7 Cluster: PREDICTED: similar to putative cell
           wall protein FLO11p, partial; n=1; Pan troglodytes|Rep:
           PREDICTED: similar to putative cell wall protein FLO11p,
           partial - Pan troglodytes
          Length = 295

 Score = 33.1 bits (72), Expect = 5.7
 Identities = 15/31 (48%), Positives = 18/31 (58%)
 Frame = -3

Query: 235 LHKSPSVPYRPSRPDGGAFPRSRGTRREEHH 143
           LH++PS P  PS PD  + PRS  T   E H
Sbjct: 45  LHRTPSHPRSPSTPDTESHPRSPSTPDTESH 75


>UniRef50_A6CGF0 Cluster: Cation efflux system protein,
           AcrB/AcrD/AcrF family protein; n=2; Bacteria|Rep: Cation
           efflux system protein, AcrB/AcrD/AcrF family protein -
           Planctomyces maris DSM 8797
          Length = 1146

 Score = 33.1 bits (72), Expect = 5.7
 Identities = 19/53 (35%), Positives = 25/53 (47%)
 Frame = +3

Query: 162 VPLDRGKAPPSGRDGRYGTEGLLCRR*GTEQRGILTLKYPIEHGIVTNWDDME 320
           V + R K P  G     G  GLL  R   E + ILTL  P+E   ++ W  +E
Sbjct: 140 VGIHRRKGPQGGTLIPVGQTGLLAERTEREGKPILTLWNPVERNDLSRWQKVE 192


>UniRef50_A0VEX0 Cluster: Glycosyl transferase, family 39; n=1;
           Delftia acidovorans SPH-1|Rep: Glycosyl transferase,
           family 39 - Delftia acidovorans SPH-1
          Length = 541

 Score = 33.1 bits (72), Expect = 5.7
 Identities = 17/50 (34%), Positives = 25/50 (50%)
 Frame = +2

Query: 464 HVRRHPSRALAVRVRRTTGIVLDFGDGVFHTVPIYERIRTSPTPFLAFWD 613
           HV       LA++ +R  G  +   DG ++ VP Y R+R  P P +  WD
Sbjct: 400 HVHSSRELGLALKSQRHMGEPVYMLDGYWYDVPFYARLR-EPVPVVGRWD 448


>UniRef50_Q8SRZ3 Cluster: ACTIN-RELATED PROTEIN; n=1;
           Encephalitozoon cuniculi|Rep: ACTIN-RELATED PROTEIN -
           Encephalitozoon cuniculi
          Length = 555

 Score = 33.1 bits (72), Expect = 5.7
 Identities = 13/32 (40%), Positives = 24/32 (75%)
 Frame = +1

Query: 94  LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPR 189
           +V+DNG+  CKAG+ G ++P+ VF +++ R +
Sbjct: 23  IVIDNGTYECKAGYCG-ESPQMVFKNVLYRQK 53


>UniRef50_A5E5Q2 Cluster: Putative uncharacterized protein; n=1;
           Lodderomyces elongisporus NRRL YB-4239|Rep: Putative
           uncharacterized protein - Lodderomyces elongisporus
           (Yeast) (Saccharomyces elongisporus)
          Length = 541

 Score = 33.1 bits (72), Expect = 5.7
 Identities = 15/70 (21%), Positives = 39/70 (55%), Gaps = 1/70 (1%)
 Frame = +3

Query: 267 TLKYPI-EHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMF 443
           T  +PI  + ++T+WD     + + ++  L++   + P+++TE   +    R+ + + ++
Sbjct: 67  TTVHPIVTNSLITDWDAAMDQFAY-YFKLLKIEQNDQPIMITEPIWSTYEYRKTLVEKIY 125

Query: 444 ETFNTPAMYV 473
             F+ PA+Y+
Sbjct: 126 AKFDFPALYL 135



 Score = 32.7 bits (71), Expect = 7.5
 Identities = 15/43 (34%), Positives = 26/43 (60%)
 Frame = +1

Query: 79  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMV 207
           +E+ A+++D G+   + G+AGDD P+ +  S  G+   QG  V
Sbjct: 13  DEINAIILDIGTHTTRIGYAGDDFPKIITTSNYGK-TSQGTKV 54


>UniRef50_UPI0000D56D2E Cluster: PREDICTED: hypothetical protein; n=1;
            Tribolium castaneum|Rep: PREDICTED: hypothetical protein
            - Tribolium castaneum
          Length = 1518

 Score = 32.7 bits (71), Expect = 7.5
 Identities = 22/79 (27%), Positives = 34/79 (43%), Gaps = 2/79 (2%)
 Frame = +3

Query: 360  APEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLS--LYASGVPPVSCWT 533
            APEE  + +TEAPL     R  +T   FE +  P+    ++ + S   Y     P +   
Sbjct: 1082 APEEEYIEVTEAPLPKPTRRNSVTTPKFEEYTGPSFVDFVKKLKSDPKYQEITDPPTTEK 1141

Query: 534  SATVSSTPCPFTKGYALPP 590
             A  ++TP    K  +  P
Sbjct: 1142 RAEDATTPTTTAKAVSTDP 1160


>UniRef50_A4G6E1 Cluster: Putative uncharacterized protein; n=1;
            Herminiimonas arsenicoxydans|Rep: Putative
            uncharacterized protein - Herminiimonas arsenicoxydans
          Length = 2687

 Score = 32.7 bits (71), Expect = 7.5
 Identities = 24/83 (28%), Positives = 43/83 (51%), Gaps = 2/83 (2%)
 Frame = -3

Query: 586  GSAYPFVNGHGVEDTVAEVQHDTGGTPDAYSESTAWMATYMAGVLN--VSNMIWVIFSLL 413
            G  Y + +G GV+DT+  +Q+ TGG+ D    +++    +  G+ N  VS       + +
Sbjct: 1389 GRGY-YTSGAGVQDTLTNIQNATGGSGDDTFIASSAANKFEGGLGNNTVSYAGTAGNNTI 1447

Query: 412  ALGLRGASVSRTGCSSGATRSSL 344
             L    A+ + TG +SG T S++
Sbjct: 1448 DLATANAAATGTGFASGDTFSNI 1470



 Score = 32.7 bits (71), Expect = 7.5
 Identities = 24/83 (28%), Positives = 43/83 (51%), Gaps = 2/83 (2%)
 Frame = -3

Query: 586  GSAYPFVNGHGVEDTVAEVQHDTGGTPDAYSESTAWMATYMAGVLN--VSNMIWVIFSLL 413
            G  Y + +G GV+DT+  +Q+ TGG+ D    +++    +  G+ N  VS       + +
Sbjct: 1589 GRGY-YTSGAGVQDTLTNIQNATGGSGDDTFIASSAANKFEGGLGNNTVSYAGTAGNNTI 1647

Query: 412  ALGLRGASVSRTGCSSGATRSSL 344
             L    A+ + TG +SG T S++
Sbjct: 1648 DLATANAAATGTGFASGDTFSNI 1670


>UniRef50_UPI0000DA243C Cluster: PREDICTED: similar to codanin 1; n=1;
            Rattus norvegicus|Rep: PREDICTED: similar to codanin 1 -
            Rattus norvegicus
          Length = 1226

 Score = 32.3 bits (70), Expect = 9.9
 Identities = 20/58 (34%), Positives = 28/58 (48%), Gaps = 1/58 (1%)
 Frame = -3

Query: 244  PHLLHKSPSVP-YRPSRPDGGAFPRSRGTRREEHHLLRNRPCTYRSHCLLPTRQLLRR 74
            PHL  K  ++P  R S P GG+FPR+ GT  +    +   P      C   + Q+L R
Sbjct: 1025 PHLRDKRCALPGCRTSGPXGGSFPRASGTAPKPAGPVTEMPPVSVPDCXAASGQVLCR 1082


>UniRef50_UPI000061673C Cluster: Thrombospondin repeat containing 1;
           n=1; Bos taurus|Rep: Thrombospondin repeat containing 1
           - Bos Taurus
          Length = 464

 Score = 32.3 bits (70), Expect = 9.9
 Identities = 18/46 (39%), Positives = 23/46 (50%), Gaps = 1/46 (2%)
 Frame = -3

Query: 292 PCSMGYLRVRIPLCSVPHL-LHKSPSVPYRPSRPDGGAFPRSRGTR 158
           PC +G  R R   C +P   LH+   +P RP R      PR +GTR
Sbjct: 18  PCGVGVQR-RSRTCQLPTTQLHQGLPLPPRPPRHPEALLPRGQGTR 62


>UniRef50_Q8AXX1 Cluster: Putative gag protein; n=1; Danio
           rerio|Rep: Putative gag protein - Danio rerio
           (Zebrafish) (Brachydanio rerio)
          Length = 612

 Score = 32.3 bits (70), Expect = 9.9
 Identities = 13/27 (48%), Positives = 18/27 (66%)
 Frame = -2

Query: 143 SPAKPALHIPEPLSTTNAATSSSHILN 63
           SP  P+ H+P P S+  +A SSSH+ N
Sbjct: 62  SPITPSRHLPSPASSYASARSSSHVSN 88


>UniRef50_Q910X7 Cluster: Capsid protein; n=3; Human astrovirus|Rep:
           Capsid protein - Human astrovirus 2
          Length = 148

 Score = 32.3 bits (70), Expect = 9.9
 Identities = 20/70 (28%), Positives = 30/70 (42%)
 Frame = +3

Query: 330 HHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASG 509
           H  + +E   + E + V L    +N     E+ T+I    F T A        + L ASG
Sbjct: 56  HSPYGSEPEDSDENNRVTLLSTLINQGMTVERATRITKRAFPTCAEKTKRSIYMDLLASG 115

Query: 510 VPPVSCWTSA 539
             P S W++A
Sbjct: 116 ASPSSAWSNA 125


>UniRef50_Q1NK22 Cluster: Electron-transferring-flavoprotein
           dehydrogenase; n=2; delta proteobacterium MLMS-1|Rep:
           Electron-transferring-flavoprotein dehydrogenase - delta
           proteobacterium MLMS-1
          Length = 553

 Score = 32.3 bits (70), Expect = 9.9
 Identities = 21/43 (48%), Positives = 22/43 (51%), Gaps = 4/43 (9%)
 Frame = -3

Query: 220 SVPYRPSRP-DGGAFPRSRGT-RREEH--HLLRNRPCTYRSHC 104
           S PY+PSRP D  AF    GT  REE   HLL   P   R  C
Sbjct: 448 SYPYKPSRPFDKDAFTAKSGTGHREEEPCHLLIADPAICREQC 490


>UniRef50_A4FI13 Cluster: Integral membrane protein; n=1;
           Saccharopolyspora erythraea NRRL 2338|Rep: Integral
           membrane protein - Saccharopolyspora erythraea (strain
           NRRL 23338)
          Length = 346

 Score = 32.3 bits (70), Expect = 9.9
 Identities = 21/55 (38%), Positives = 29/55 (52%)
 Frame = +2

Query: 374 PSPAH*GSPQPQGQQREDDPDHVRNIQHARHVRRHPSRALAVRVRRTTGIVLDFG 538
           P PAH   P+P     +  P H  + + AR V R P+RA+A   RRT G ++  G
Sbjct: 147 PRPAHATDPRP-AHAVDRQPAHAVDPRSARAVDRQPARAVAA-PRRTGGRLVRAG 199


>UniRef50_A3N9F3 Cluster: Putative uncharacterized protein; n=7;
           Burkholderia|Rep: Putative uncharacterized protein -
           Burkholderia pseudomallei (strain 668)
          Length = 218

 Score = 32.3 bits (70), Expect = 9.9
 Identities = 17/41 (41%), Positives = 21/41 (51%)
 Frame = +1

Query: 472 SPSKPCSRCTRPAYHRYRAGLRRRCLPHRAHLRKDTHFPHA 594
           SP   C+R T  A  R  +  RRR   HR H R+ +H P A
Sbjct: 98  SPRARCARRTAVAPARCASHARRRSPGHRCHARRGSHPPDA 138


>UniRef50_Q5CWZ9 Cluster: Putative uncharacterized protein; n=3;
           Cryptosporidium|Rep: Putative uncharacterized protein -
           Cryptosporidium parvum Iowa II
          Length = 1498

 Score = 32.3 bits (70), Expect = 9.9
 Identities = 17/69 (24%), Positives = 31/69 (44%)
 Frame = -3

Query: 304 LVTIPCSMGYLRVRIPLCSVPHLLHKSPSVPYRPSRPDGGAFPRSRGTRREEHHLLRNRP 125
           ++ + CS       +   S+PH  H  P + Y+       AFP S  T  ++H++  N P
Sbjct: 87  ILVLDCSQNLHLFSLKSVSIPHSKHDCPYISYKIPN-SFIAFPTSINTIIKDHNIKENEP 145

Query: 124 CTYRSHCLL 98
             + +  L+
Sbjct: 146 NIFSNQLLI 154


>UniRef50_Q5BXM4 Cluster: SJCHGC05761 protein; n=1; Schistosoma
           japonicum|Rep: SJCHGC05761 protein - Schistosoma
           japonicum (Blood fluke)
          Length = 246

 Score = 32.3 bits (70), Expect = 9.9
 Identities = 14/35 (40%), Positives = 20/35 (57%)
 Frame = +1

Query: 82  EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRP 186
           E  A+V D G+   K GFAG+  PR + P+ +  P
Sbjct: 33  EKTAVVFDIGTVYTKCGFAGETGPRFIIPTAITLP 67


>UniRef50_Q4D7T4 Cluster: Putative uncharacterized protein; n=2;
           Trypanosoma cruzi|Rep: Putative uncharacterized protein
           - Trypanosoma cruzi
          Length = 565

 Score = 32.3 bits (70), Expect = 9.9
 Identities = 17/48 (35%), Positives = 25/48 (52%)
 Frame = +2

Query: 314 HGEDLASYLLQ*AACRPRGTPSPAH*GSPQPQGQQREDDPDHVRNIQH 457
           H ED+  ++ + +A  PR T  P H G+  P+G QRE+     R   H
Sbjct: 37  HPEDVMGFIHEWSA--PRRTGGPTHTGTSCPEGAQREEAVSSERKQSH 82


>UniRef50_Q2PE20 Cluster: CG10067-PB, isoform B; n=1; Drosophila
           melanogaster|Rep: CG10067-PB, isoform B - Drosophila
           melanogaster (Fruit fly)
          Length = 36

 Score = 32.3 bits (70), Expect = 9.9
 Identities = 13/15 (86%), Positives = 15/15 (100%)
 Frame = +1

Query: 70  MCDEEVAALVVDNGS 114
           MCD+EVAALVVDNG+
Sbjct: 1   MCDDEVAALVVDNGA 15


>UniRef50_Q7S8X5 Cluster: Putative uncharacterized protein
           NCU08840.1; n=1; Neurospora crassa|Rep: Putative
           uncharacterized protein NCU08840.1 - Neurospora crassa
          Length = 751

 Score = 32.3 bits (70), Expect = 9.9
 Identities = 18/75 (24%), Positives = 34/75 (45%)
 Frame = +3

Query: 276 YPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN 455
           YPI+ G +   D       H  ++ L       P++L  +P   + + E + + +FE   
Sbjct: 106 YPIQGGHIVVMDAFLAFLEHV-HSSLTTTYHNTPIMLMASPQWTRPDCETLARYIFEKTK 164

Query: 456 TPAMYVAIQAVLSLY 500
           TPA+ +   A+ + Y
Sbjct: 165 TPALCLINSAIATQY 179


>UniRef50_Q0W6D4 Cluster: Putative uncharacterized protein; n=1;
           uncultured methanogenic archaeon RC-I|Rep: Putative
           uncharacterized protein - Uncultured methanogenic
           archaeon RC-I
          Length = 427

 Score = 32.3 bits (70), Expect = 9.9
 Identities = 16/45 (35%), Positives = 20/45 (44%)
 Frame = -2

Query: 215 PIPTITP*WRGLPTIEGNTARGASSPAKPALHIPEPLSTTNAATS 81
           P PT+TP     PT+E        +P       P P+ TT A TS
Sbjct: 353 PTPTVTPTPTPEPTVEATPVPATPTPTVEPTVAPSPVPTTTAQTS 397


>UniRef50_Q9C073 Cluster: Protein FAM117A; n=17; Amniota|Rep:
           Protein FAM117A - Homo sapiens (Human)
          Length = 453

 Score = 32.3 bits (70), Expect = 9.9
 Identities = 17/54 (31%), Positives = 25/54 (46%)
 Frame = -2

Query: 239 SPT*ESFCPIPTITP*WRGLPTIEGNTARGASSPAKPALHIPEPLSTTNAATSS 78
           +PT  +FCP+  + P + G+  I  N      SP  PA   P P     A+ +S
Sbjct: 375 NPTGSAFCPVNLMKPLFPGMGFIFRNCPSNPGSPLPPASPRPPPRKDPEASKAS 428


>UniRef50_Q6BML9 Cluster: Actin-like protein ARP6; n=3;
           Saccharomycetaceae|Rep: Actin-like protein ARP6 -
           Debaryomyces hansenii (Yeast) (Torulaspora hansenii)
          Length = 409

 Score = 32.3 bits (70), Expect = 9.9
 Identities = 22/80 (27%), Positives = 34/80 (42%), Gaps = 4/80 (5%)
 Frame = +3

Query: 264 LTLKYPIEHGIVTNWDDMEKIWHHTFY----NELRVAPEEHPVLLTEAPLNPKANREKMT 431
           +  K P +HG + +W+  + +W +TF     N+   A   H + LTE P           
Sbjct: 56  MIFKRPYDHGHLISWETEKAVWDYTFNKASPNQELDASITH-LTLTETPFQLPQLSMNTD 114

Query: 432 QIMFETFNTPAMYVAIQAVL 491
           QI+FE +     Y    A L
Sbjct: 115 QIVFEEYGFNEYYRCAPASL 134


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 757,019,149
Number of Sequences: 1657284
Number of extensions: 18252210
Number of successful extensions: 64191
Number of sequences better than 10.0: 232
Number of HSP's better than 10.0 without gapping: 58492
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 63999
length of database: 575,637,011
effective HSP length: 97
effective length of database: 414,880,463
effective search space used: 46466611856
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).