SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0025
         (588 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_UPI0000E473E8 Cluster: PREDICTED: similar to fibronecti...    40   0.033
UniRef50_UPI0000E4A54C Cluster: PREDICTED: similar to gastric mu...    36   0.70 
UniRef50_Q6LLT1 Cluster: Putative type II secretory pathway, pse...    36   0.70 
UniRef50_Q0AQG2 Cluster: Acyltransferase 3; n=1; Maricaulis mari...    34   2.8  
UniRef50_UPI0000DB7853 Cluster: PREDICTED: similar to X-ray repa...    33   3.7  
UniRef50_A3E0V8 Cluster: Putative achaete-scute complex protein;...    33   3.7  
UniRef50_A6YG79 Cluster: Chloroplast enveloppe membrane protein;...    33   4.9  
UniRef50_UPI0000F2021D Cluster: PREDICTED: similar to Disks larg...    33   6.5  
UniRef50_UPI0000F1EB2F Cluster: PREDICTED: hypothetical protein;...    33   6.5  
UniRef50_A7NU55 Cluster: Chromosome chr18 scaffold_1, whole geno...    33   6.5  
UniRef50_Q7RWQ5 Cluster: Predicted protein; n=2; Neurospora cras...    33   6.5  

>UniRef50_UPI0000E473E8 Cluster: PREDICTED: similar to fibronectin
           1a; n=1; Strongylocentrotus purpuratus|Rep: PREDICTED:
           similar to fibronectin 1a - Strongylocentrotus
           purpuratus
          Length = 289

 Score = 40.3 bits (90), Expect = 0.033
 Identities = 26/82 (31%), Positives = 35/82 (42%), Gaps = 5/82 (6%)
 Frame = +3

Query: 279 TNATQAVFPVRSTPSASTMVSSQPLIMAEGTASPNVTL-TPQDLIYKKCLSELETLV--- 446
           TN T       S P+ + + ++ P  +AE T  P+ TL    DL   +  S   T V   
Sbjct: 204 TNPTTTALQTTSNPTTTALTTTVPTTIAETTTDPSTTLRVTTDLTTLQTTSYSTTTVPTN 263

Query: 447 -MPDYRQNNRPYSDVRCRENYC 509
              DY   +  YSD  C  NYC
Sbjct: 264 KCSDYCSPSNNYSDNHCSYNYC 285


>UniRef50_UPI0000E4A54C Cluster: PREDICTED: similar to gastric
           mucin; n=1; Strongylocentrotus purpuratus|Rep:
           PREDICTED: similar to gastric mucin - Strongylocentrotus
           purpuratus
          Length = 651

 Score = 35.9 bits (79), Expect = 0.70
 Identities = 24/78 (30%), Positives = 36/78 (46%), Gaps = 7/78 (8%)
 Frame = +3

Query: 264 PNSEGTNATQAVFPVRSTPSA----STMVSSQPLIMAEGTASPNVTLTPQ---DLIYKKC 422
           PNS  T  T +VFP +  PS+    +T+ SSQP + +    + N +  P    D   + C
Sbjct: 119 PNSSPTQKTTSVFPTQPKPSSTQKMTTVFSSQPKLSSTQKMATNFSTQPDPSPDTSSEDC 178

Query: 423 LSELETLVMPDYRQNNRP 476
            S L     P + Q + P
Sbjct: 179 TSLLPNTTPPSFWQPSTP 196


>UniRef50_Q6LLT1 Cluster: Putative type II secretory pathway,
           pseudopilin EpsI; n=4; Vibrionaceae|Rep: Putative type
           II secretory pathway, pseudopilin EpsI - Photobacterium
           profundum (Photobacterium sp. (strain SS9))
          Length = 106

 Score = 35.9 bits (79), Expect = 0.70
 Identities = 14/44 (31%), Positives = 25/44 (56%)
 Frame = +1

Query: 124 ILMSFTVCTTIEQSGNLLTLKKRTRRKIAEDDWIWSTTKSPTAE 255
           I+++     T+  SG + T +KR + K+A  +W WS   + TA+
Sbjct: 34  IMVADNTLATVRLSGEIPTTEKRGKSKLAGQEWYWSVKSTKTAD 77


>UniRef50_Q0AQG2 Cluster: Acyltransferase 3; n=1; Maricaulis maris
           MCS10|Rep: Acyltransferase 3 - Maricaulis maris (strain
           MCS10)
          Length = 354

 Score = 33.9 bits (74), Expect = 2.8
 Identities = 22/65 (33%), Positives = 30/65 (46%), Gaps = 3/65 (4%)
 Frame = +1

Query: 175 LTLKKRTRRKIAEDDWIWSTTKSPTAEE*CRIQKVQMQHKLYFRFV---LLQARPRWSPA 345
           L L     R + E DW+ S T  PT +    +    + H+LYF  V   +L   PRW  A
Sbjct: 102 LVLDDSLSRGMGELDWVASLTLLPTGQPPLLLVGWTLTHELYFYLVYGLVLFLPPRWRRA 161

Query: 346 SL**W 360
           +L  W
Sbjct: 162 ALGLW 166


>UniRef50_UPI0000DB7853 Cluster: PREDICTED: similar to X-ray repair
           complementing defective repair in Chinese hamster cells
           5; n=1; Apis mellifera|Rep: PREDICTED: similar to X-ray
           repair complementing defective repair in Chinese hamster
           cells 5 - Apis mellifera
          Length = 517

 Score = 33.5 bits (73), Expect = 3.7
 Identities = 24/96 (25%), Positives = 42/96 (43%), Gaps = 3/96 (3%)
 Frame = +3

Query: 210 RRRLDLEYYQKSDCRRIMPNSEGTNATQAVFPVRSTPSASTMVSSQPLIMAEGTASPNVT 389
           +  +DLE++ KS    I+P+SE +N T+  + +      +  V+    +    +    V 
Sbjct: 260 KNNIDLEHFYKSATHVILPSSEESNVTKPFYSLVQAMHETNSVAIVRKVFRNNSTPRMVA 319

Query: 390 LTPQDLIYKK--CLSELETLVMPDYR-QNNRPYSDV 488
           L P   I  +  CL E+E     D R   +RP   +
Sbjct: 320 LFPCIDIPNEPWCLVEIELAFAEDQRLMESRPMKSI 355


>UniRef50_A3E0V8 Cluster: Putative achaete-scute complex protein;
           n=1; Panulirus argus|Rep: Putative achaete-scute complex
           protein - Panulirus argus (Spiny lobster)
          Length = 299

 Score = 33.5 bits (73), Expect = 3.7
 Identities = 21/64 (32%), Positives = 29/64 (45%)
 Frame = +3

Query: 240 KSDCRRIMPNSEGTNATQAVFPVRSTPSASTMVSSQPLIMAEGTASPNVTLTPQDLIYKK 419
           +  CRR          TQ + P+R +P     +S    ++   TASP  TLTP     K+
Sbjct: 8   RRSCRRRHSRRMSATTTQRLVPIRPSPHKGVTISKAVTVITT-TASP-ATLTPPKTGVKR 65

Query: 420 CLSE 431
            LSE
Sbjct: 66  KLSE 69


>UniRef50_A6YG79 Cluster: Chloroplast enveloppe membrane protein;
           n=1; Leptosira terrestris|Rep: Chloroplast enveloppe
           membrane protein - Leptosira terrestris (Pleurastrum
           terrestre)
          Length = 445

 Score = 33.1 bits (72), Expect = 4.9
 Identities = 13/39 (33%), Positives = 23/39 (58%)
 Frame = +2

Query: 239 KVRLQKNNAEFRRYKCNTSCISGSFYSKRVHDGLQPAFN 355
           K+ LQKN  E  ++  NT       Y +++HDG++ ++N
Sbjct: 163 KLILQKNVFEIYKFSENTDFFKDKMYGEQIHDGVKNSYN 201


>UniRef50_UPI0000F2021D Cluster: PREDICTED: similar to Disks
           large-associated protein 2 (DAP-2)
           (SAP90/PSD-95-associated protein 2) (SAPAP2)
           (PSD-95/SAP90-binding protein 2); n=3; Euteleostomi|Rep:
           PREDICTED: similar to Disks large-associated protein 2
           (DAP-2) (SAP90/PSD-95-associated protein 2) (SAPAP2)
           (PSD-95/SAP90-binding protein 2) - Danio rerio
          Length = 1066

 Score = 32.7 bits (71), Expect = 6.5
 Identities = 17/63 (26%), Positives = 29/63 (46%)
 Frame = +3

Query: 213 RRLDLEYYQKSDCRRIMPNSEGTNATQAVFPVRSTPSASTMVSSQPLIMAEGTASPNVTL 392
           R +   + Q  DC   M +S  T+  ++   V  TPS  T   + P +    T+ P +++
Sbjct: 564 RAIQAGFSQDDDCVPSMTSSTVTSTIRSTTAVTYTPSTPTYKRTPPPVPPRSTSKPLISI 623

Query: 393 TPQ 401
           T Q
Sbjct: 624 TAQ 626


>UniRef50_UPI0000F1EB2F Cluster: PREDICTED: hypothetical protein;
           n=2; Danio rerio|Rep: PREDICTED: hypothetical protein -
           Danio rerio
          Length = 1072

 Score = 32.7 bits (71), Expect = 6.5
 Identities = 18/62 (29%), Positives = 27/62 (43%)
 Frame = +3

Query: 213 RRLDLEYYQKSDCRRIMPNSEGTNATQAVFPVRSTPSASTMVSSQPLIMAEGTASPNVTL 392
           RR+DL  Y+  DC   MP S    A  A       P+        P+++    +SP+ +L
Sbjct: 297 RRIDLSMYRDPDCLLQMPISAPVPAAAAAPSDPPQPTVPISDPPAPVVLPPAPSSPSASL 356

Query: 393 TP 398
            P
Sbjct: 357 PP 358


>UniRef50_A7NU55 Cluster: Chromosome chr18 scaffold_1, whole genome
           shotgun sequence; n=5; Vitis vinifera|Rep: Chromosome
           chr18 scaffold_1, whole genome shotgun sequence - Vitis
           vinifera (Grape)
          Length = 477

 Score = 32.7 bits (71), Expect = 6.5
 Identities = 16/41 (39%), Positives = 20/41 (48%)
 Frame = -1

Query: 306 PEIQLVLHLYLLNSALFFCSRTFGSTPDPIVFCNFSSRPLL 184
           P + L+ HLYLL   L            PI+F  F SRP+L
Sbjct: 32  PTLPLIGHLYLLKKPLHRTLSKISDRHGPILFLRFGSRPVL 72


>UniRef50_Q7RWQ5 Cluster: Predicted protein; n=2; Neurospora
           crassa|Rep: Predicted protein - Neurospora crassa
          Length = 559

 Score = 32.7 bits (71), Expect = 6.5
 Identities = 29/95 (30%), Positives = 42/95 (44%), Gaps = 9/95 (9%)
 Frame = +3

Query: 183 EEADEKKNCRRRLDLEYYQKSDCRRIMPNSEGTNATQA---------VFPVRSTPSASTM 335
           EE        R    E    S   ++MPN +GT   ++         +FPVRST      
Sbjct: 106 EETKASTFRHRMFSFESPSDSPELKVMPNKDGTEIRRSLDAESFFDRIFPVRSTS----- 160

Query: 336 VSSQPLIMAEGTASPNVTLTPQDLIYKKCLSELET 440
            SS P   +EG  SP +T++P     ++ LS LE+
Sbjct: 161 -SSYP---SEGVKSPELTVSPPMTFGRRILSSLES 191


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 562,667,439
Number of Sequences: 1657284
Number of extensions: 11573777
Number of successful extensions: 31787
Number of sequences better than 10.0: 11
Number of HSP's better than 10.0 without gapping: 30509
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 31752
length of database: 575,637,011
effective HSP length: 97
effective length of database: 414,880,463
effective search space used: 40658285374
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).