SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0023
         (531 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_P62266 Cluster: 40S ribosomal protein S23; n=141; cellu...    97   3e-19
UniRef50_Q8H6J0 Cluster: Putative 40S ribosomal protein; n=1; Ze...    90   3e-17
UniRef50_P32827 Cluster: 40S ribosomal protein S23; n=66; cellul...    86   4e-16
UniRef50_Q8S6I4 Cluster: Putative 40s ribosomal protein S23; n=4...    81   2e-14
UniRef50_Q0W8G5 Cluster: 30S ribosomal protein S12P; n=20; cellu...    78   1e-13
UniRef50_Q8ZYQ4 Cluster: 30S ribosomal protein S12P; n=17; Archa...    77   2e-13
UniRef50_Q5AAQ9 Cluster: Putative uncharacterized protein; n=1; ...    62   6e-09
UniRef50_A3B198 Cluster: Putative uncharacterized protein; n=1; ...    51   1e-05
UniRef50_A3H7W0 Cluster: Protein splicing (Intein) site; n=4; ce...    49   6e-05
UniRef50_A5DX89 Cluster: 30S ribosomal protein S12; n=6; Sacchar...    41   0.021
UniRef50_Q7SZ18 Cluster: Mrps12-prov protein; n=8; Euteleostomi|...    40   0.036
UniRef50_UPI00004CC6C0 Cluster: PREDICTED: hypothetical protein;...    40   0.047
UniRef50_UPI00015B40B9 Cluster: PREDICTED: similar to mitochondr...    39   0.083
UniRef50_O70089 Cluster: 30S ribosomal protein S12; n=35; cellul...    39   0.083
UniRef50_Q1HPJ4 Cluster: Mitochondrial ribosomal protein S12; n=...    38   0.14 
UniRef50_UPI0000D55D7C Cluster: PREDICTED: similar to 40S riboso...    37   0.33 
UniRef50_O14182 Cluster: Mitochondrial ribosomal protein subunit...    37   0.33 
UniRef50_Q5K6X0 Cluster: Ribosomal protein S12, putative; n=2; D...    36   0.58 
UniRef50_Q9TMN0 Cluster: Apicoplast 30S ribosomal protein S12; n...    35   1.0  
UniRef50_Q2H267 Cluster: Putative uncharacterized protein; n=1; ...    35   1.3  
UniRef50_P53732 Cluster: 37S ribosomal protein S12, mitochondria...    35   1.3  
UniRef50_O15235 Cluster: 28S ribosomal protein S12, mitochondria...    35   1.3  
UniRef50_Q9NEH6 Cluster: EG:BACH59J11.1 protein; n=2; Bilateria|...    34   1.8  
UniRef50_P10735 Cluster: 40S ribosomal protein S12, mitochondria...    34   1.8  
UniRef50_P14149 Cluster: Chloroplast 30S ribosomal protein S12; ...    34   2.4  
UniRef50_Q8BGG2 Cluster: Adult male spinal cord cDNA, RIKEN full...    33   3.1  
UniRef50_A7S120 Cluster: Predicted protein; n=1; Nematostella ve...    33   3.1  
UniRef50_Q896J7 Cluster: Iron-sulfur flavoprotein; n=1; Clostrid...    33   4.1  
UniRef50_Q56899 Cluster: Orf0.67; n=1; Yersinia enterocolitica|R...    32   7.2  
UniRef50_A2U8Z5 Cluster: Peptidase C26; n=2; Bacillaceae|Rep: Pe...    32   7.2  
UniRef50_P92532 Cluster: Mitochondrial ribosomal protein S12; n=...    32   7.2  
UniRef50_Q9QWE7 Cluster: Cysteine protease homolog; n=1; Rattus ...    32   9.5  

>UniRef50_P62266 Cluster: 40S ribosomal protein S23; n=141; cellular
           organisms|Rep: 40S ribosomal protein S23 - Homo sapiens
           (Human)
          Length = 143

 Score = 96.7 bits (230), Expect = 3e-19
 Identities = 46/48 (95%), Positives = 47/48 (97%)
 Frame = -1

Query: 255 KNDEVLVAGFGRKGHAVGDIPGVRFKVVKVANVSLLALYKEKKERPRS 112
           +NDEVLVAGFGRKGHAVGDIPGVRFKVVKVANVSLLALYK KKERPRS
Sbjct: 96  ENDEVLVAGFGRKGHAVGDIPGVRFKVVKVANVSLLALYKGKKERPRS 143



 Score = 90.2 bits (214), Expect = 3e-17
 Identities = 42/48 (87%), Positives = 44/48 (91%)
 Frame = -2

Query: 395 GPPLEKVGVEAKQPNSAIRKCVRVQLIKNGKKVTAFVPRDGCLNHIEK 252
           G  LEKVGVEAKQPNSAIRKCVRVQLIKNGKK+TAFVP DGCLN IE+
Sbjct: 49  GIVLEKVGVEAKQPNSAIRKCVRVQLIKNGKKITAFVPNDGCLNFIEE 96


>UniRef50_Q8H6J0 Cluster: Putative 40S ribosomal protein; n=1; Zea
           mays|Rep: Putative 40S ribosomal protein - Zea mays
           (Maize)
          Length = 309

 Score = 89.8 bits (213), Expect = 3e-17
 Identities = 41/46 (89%), Positives = 45/46 (97%)
 Frame = -1

Query: 249 DEVLVAGFGRKGHAVGDIPGVRFKVVKVANVSLLALYKEKKERPRS 112
           DEVL+AGFGRKGHAVGDIPGVRFKVVKV+ VSLLAL+KEKKE+PRS
Sbjct: 224 DEVLIAGFGRKGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS 269


>UniRef50_P32827 Cluster: 40S ribosomal protein S23; n=66; cellular
           organisms|Rep: 40S ribosomal protein S23 - Saccharomyces
           cerevisiae (Baker's yeast)
          Length = 145

 Score = 86.2 bits (204), Expect = 4e-16
 Identities = 38/48 (79%), Positives = 44/48 (91%)
 Frame = -2

Query: 395 GPPLEKVGVEAKQPNSAIRKCVRVQLIKNGKKVTAFVPRDGCLNHIEK 252
           G  LEK+G+E+KQPNSAIRKCVRVQLIKNGKKVTAFVP DGCLN +++
Sbjct: 51  GIVLEKLGIESKQPNSAIRKCVRVQLIKNGKKVTAFVPNDGCLNFVDE 98



 Score = 85.4 bits (202), Expect = 7e-16
 Identities = 40/48 (83%), Positives = 45/48 (93%)
 Frame = -1

Query: 255 KNDEVLVAGFGRKGHAVGDIPGVRFKVVKVANVSLLALYKEKKERPRS 112
           +NDEVL+AGFGRKG A GDIPGVRFKVVKV+ VSLLAL+KEKKE+PRS
Sbjct: 98  ENDEVLLAGFGRKGKAKGDIPGVRFKVVKVSGVSLLALWKEKKEKPRS 145


>UniRef50_Q8S6I4 Cluster: Putative 40s ribosomal protein S23; n=4;
           Oryza sativa|Rep: Putative 40s ribosomal protein S23 -
           Oryza sativa (Rice)
          Length = 301

 Score = 80.6 bits (190), Expect = 2e-14
 Identities = 35/48 (72%), Positives = 41/48 (85%)
 Frame = -2

Query: 395 GPPLEKVGVEAKQPNSAIRKCVRVQLIKNGKKVTAFVPRDGCLNHIEK 252
           G  LEK+G+EAKQPNSAI KC RVQL+KNGKK+ AFVP DGCLN I++
Sbjct: 119 GIVLEKIGIEAKQPNSAICKCARVQLVKNGKKIAAFVPNDGCLNFIKE 166


>UniRef50_Q0W8G5 Cluster: 30S ribosomal protein S12P; n=20; cellular
           organisms|Rep: 30S ribosomal protein S12P - Uncultured
           methanogenic archaeon RC-I
          Length = 142

 Score = 78.2 bits (184), Expect = 1e-13
 Identities = 34/48 (70%), Positives = 42/48 (87%)
 Frame = -2

Query: 395 GPPLEKVGVEAKQPNSAIRKCVRVQLIKNGKKVTAFVPRDGCLNHIEK 252
           G  LEKVGVEAKQPNSAIRKC+R+QLIKNG+++TAF P DG +N I++
Sbjct: 47  GIVLEKVGVEAKQPNSAIRKCIRIQLIKNGRQITAFCPGDGAINFIDE 94



 Score = 47.6 bits (108), Expect = 2e-04
 Identities = 23/47 (48%), Positives = 33/47 (70%), Gaps = 1/47 (2%)
 Frame = -1

Query: 255 KNDEVLVAGFG-RKGHAVGDIPGVRFKVVKVANVSLLALYKEKKERP 118
           ++DEV + G G R G + GDIPGVRF+V KV +VSL  +   K+++P
Sbjct: 94  EHDEVTIEGIGGRMGGSYGDIPGVRFRVFKVNDVSLEEMVAGKRDKP 140


>UniRef50_Q8ZYQ4 Cluster: 30S ribosomal protein S12P; n=17;
           Archaea|Rep: 30S ribosomal protein S12P - Pyrobaculum
           aerophilum
          Length = 147

 Score = 77.4 bits (182), Expect = 2e-13
 Identities = 35/48 (72%), Positives = 42/48 (87%)
 Frame = -2

Query: 395 GPPLEKVGVEAKQPNSAIRKCVRVQLIKNGKKVTAFVPRDGCLNHIEK 252
           G  LEKVGVEA++PN+A+RKCVRVQL+KNGK VTAFVP DG LN+I +
Sbjct: 52  GIVLEKVGVEARKPNAAVRKCVRVQLVKNGKVVTAFVPLDGSLNYINE 99



 Score = 53.2 bits (122), Expect = 4e-06
 Identities = 24/47 (51%), Positives = 37/47 (78%), Gaps = 1/47 (2%)
 Frame = -1

Query: 255 KNDEVLVAGFGR-KGHAVGDIPGVRFKVVKVANVSLLALYKEKKERP 118
           ++DEV++   G  +G ++GDIPGVRFKV+KV  VSL A+++ KK++P
Sbjct: 99  EHDEVVIERIGGPEGRSLGDIPGVRFKVIKVNGVSLWAIWRGKKQKP 145


>UniRef50_Q5AAQ9 Cluster: Putative uncharacterized protein; n=1;
           Candida albicans|Rep: Putative uncharacterized protein -
           Candida albicans (Yeast)
          Length = 102

 Score = 62.5 bits (145), Expect = 6e-09
 Identities = 30/50 (60%), Positives = 34/50 (68%)
 Frame = +2

Query: 104 YTYDLGRSFFSL*RARRDTLATFTTLKRTPGMSPTA*PLRPNPATSTSSF 253
           Y YDLG SFFS  +A ++T  T TTL  TPG+SP A PL P PA  TSSF
Sbjct: 3   YIYDLGFSFFSFHKANKETPETLTTLNLTPGISPLALPLLPKPANKTSSF 52



 Score = 58.0 bits (134), Expect = 1e-07
 Identities = 26/45 (57%), Positives = 32/45 (71%)
 Frame = +1

Query: 265 FRQPSRGTNAVTFFPFLMSCTRTHLRMAELGCLASTPTFSRGGPV 399
           F+QPS GT AVTF PFL++ T TH  +AE GCL S P FS+  P+
Sbjct: 57  FKQPSFGTKAVTFLPFLINWTSTHFSIAEFGCLDSIPIFSKTIPL 101


>UniRef50_A3B198 Cluster: Putative uncharacterized protein; n=1;
           Oryza sativa (japonica cultivar-group)|Rep: Putative
           uncharacterized protein - Oryza sativa subsp. japonica
           (Rice)
          Length = 128

 Score = 51.2 bits (117), Expect = 1e-05
 Identities = 22/27 (81%), Positives = 25/27 (92%)
 Frame = -1

Query: 249 DEVLVAGFGRKGHAVGDIPGVRFKVVK 169
           DEVL++GFG KGHAVGDI GVRF+VVK
Sbjct: 67  DEVLISGFGHKGHAVGDIRGVRFEVVK 93


>UniRef50_A3H7W0 Cluster: Protein splicing (Intein) site; n=4;
           cellular organisms|Rep: Protein splicing (Intein) site -
           Caldivirga maquilingensis IC-167
          Length = 661

 Score = 49.2 bits (112), Expect = 6e-05
 Identities = 24/47 (51%), Positives = 33/47 (70%), Gaps = 1/47 (2%)
 Frame = -1

Query: 255 KNDEVLVAGFGR-KGHAVGDIPGVRFKVVKVANVSLLALYKEKKERP 118
           ++DEV++   G  +G A GD+PGVRFKV KV  VSL A+   KK++P
Sbjct: 613 EHDEVIIERIGGPEGRAYGDLPGVRFKVTKVNGVSLKAILLGKKQKP 659



 Score = 43.6 bits (98), Expect = 0.003
 Identities = 21/28 (75%), Positives = 22/28 (78%)
 Frame = -2

Query: 335 CVRVQLIKNGKKVTAFVPRDGCLNHIEK 252
           CVRVQL KNGK VTAFVP DG LN I +
Sbjct: 586 CVRVQLTKNGKVVTAFVPWDGGLNLINE 613



 Score = 38.7 bits (86), Expect = 0.083
 Identities = 17/29 (58%), Positives = 22/29 (75%)
 Frame = -2

Query: 395 GPPLEKVGVEAKQPNSAIRKCVRVQLIKN 309
           G  LEKVGVEA++PN+A+RKCV    + N
Sbjct: 52  GIVLEKVGVEARKPNAAVRKCVTPDTLIN 80


>UniRef50_A5DX89 Cluster: 30S ribosomal protein S12; n=6;
           Saccharomycetales|Rep: 30S ribosomal protein S12 -
           Lodderomyces elongisporus (Yeast) (Saccharomyces
           elongisporus)
          Length = 183

 Score = 40.7 bits (91), Expect = 0.021
 Identities = 17/33 (51%), Positives = 26/33 (78%)
 Frame = -2

Query: 371 VEAKQPNSAIRKCVRVQLIKNGKKVTAFVPRDG 273
           ++ K+PNSA+RKC RV+L  NGK ++A +P +G
Sbjct: 99  LKPKKPNSALRKCARVRL-SNGKVISALIPGEG 130


>UniRef50_Q7SZ18 Cluster: Mrps12-prov protein; n=8;
           Euteleostomi|Rep: Mrps12-prov protein - Xenopus laevis
           (African clawed frog)
          Length = 150

 Score = 39.9 bits (89), Expect = 0.036
 Identities = 18/30 (60%), Positives = 23/30 (76%)
 Frame = -2

Query: 362 KQPNSAIRKCVRVQLIKNGKKVTAFVPRDG 273
           K+PNSA RKC RV+L  NGK+V  F+P +G
Sbjct: 82  KKPNSANRKCARVRL-SNGKEVICFIPGEG 110


>UniRef50_UPI00004CC6C0 Cluster: PREDICTED: hypothetical protein;
           n=1; Mus musculus|Rep: PREDICTED: hypothetical protein -
           Mus musculus
          Length = 143

 Score = 39.5 bits (88), Expect = 0.047
 Identities = 15/39 (38%), Positives = 31/39 (79%)
 Frame = +1

Query: 139 VESEERHVGYFYHLKTNSGNVTDGVTFTTESRH*YFVVF 255
           ++S++R++GYF HLK +S ++T  +TF+T+S + + ++F
Sbjct: 9   LQSQQRNIGYFNHLKEDSRDITYSMTFSTKSSN-WIIIF 46



 Score = 33.5 bits (73), Expect = 3.1
 Identities = 18/43 (41%), Positives = 22/43 (51%)
 Frame = +3

Query: 252 FFDVV*ATVTGDECGHFLSVLNELYTDAFADGRVGLLSFYTNF 380
           F + V A + G E    L VLNEL+ DA  DGR+ L      F
Sbjct: 46  FLNEVQAAIIGHERCDLLPVLNELHPDALPDGRIWLFGLNPYF 88


>UniRef50_UPI00015B40B9 Cluster: PREDICTED: similar to mitochondrial
           ribosomal protein S12; n=1; Nasonia vitripennis|Rep:
           PREDICTED: similar to mitochondrial ribosomal protein
           S12 - Nasonia vitripennis
          Length = 173

 Score = 38.7 bits (86), Expect = 0.083
 Identities = 20/41 (48%), Positives = 29/41 (70%)
 Frame = -2

Query: 395 GPPLEKVGVEAKQPNSAIRKCVRVQLIKNGKKVTAFVPRDG 273
           G  L+ +  + K+PNSA RKCV V+L  NGK++TA++P  G
Sbjct: 93  GVVLKTLIKKPKKPNSANRKCVLVRL-SNGKEMTAYIPGIG 132


>UniRef50_O70089 Cluster: 30S ribosomal protein S12; n=35; cellular
           organisms|Rep: 30S ribosomal protein S12 - Aquifex
           aeolicus
          Length = 128

 Score = 38.7 bits (86), Expect = 0.083
 Identities = 23/59 (38%), Positives = 37/59 (62%)
 Frame = -2

Query: 371 VEAKQPNSAIRKCVRVQLIKNGKKVTAFVPRDGCLNHIEKTTKY*WRDSVVKVTPSVTF 195
           V  K+PNSA+RK  RV+L  NG +VTA++P +G  +++++ +    R   VK  P V +
Sbjct: 40  VTPKKPNSALRKVARVRL-SNGIEVTAYIPGEG--HNLQEHSIVLVRGGRVKDLPGVRY 95


>UniRef50_Q1HPJ4 Cluster: Mitochondrial ribosomal protein S12; n=3;
           Coelomata|Rep: Mitochondrial ribosomal protein S12 -
           Bombyx mori (Silk moth)
          Length = 111

 Score = 37.9 bits (84), Expect = 0.14
 Identities = 20/41 (48%), Positives = 28/41 (68%)
 Frame = -2

Query: 395 GPPLEKVGVEAKQPNSAIRKCVRVQLIKNGKKVTAFVPRDG 273
           G  L+ V  + K+PNSA RKCV V+L  NGK++ A++P  G
Sbjct: 31  GVVLKTVIKKPKKPNSANRKCVLVRL-SNGKEMVAYIPGIG 70


>UniRef50_UPI0000D55D7C Cluster: PREDICTED: similar to 40S ribosomal
           protein S12, mitochondrial precursor (MT-RPS12)
           (Technical knockout locus protein); n=2; Coelomata|Rep:
           PREDICTED: similar to 40S ribosomal protein S12,
           mitochondrial precursor (MT-RPS12) (Technical knockout
           locus protein) - Tribolium castaneum
          Length = 156

 Score = 36.7 bits (81), Expect = 0.33
 Identities = 19/41 (46%), Positives = 28/41 (68%)
 Frame = -2

Query: 395 GPPLEKVGVEAKQPNSAIRKCVRVQLIKNGKKVTAFVPRDG 273
           G  L+ +  + K+PNSA RKCV V+L  NGK++ A++P  G
Sbjct: 78  GVVLKTLIKKPKKPNSANRKCVLVRL-SNGKEMVAYIPGIG 117


>UniRef50_O14182 Cluster: Mitochondrial ribosomal protein subunit
           S12; n=2; Ascomycota|Rep: Mitochondrial ribosomal
           protein subunit S12 - Schizosaccharomyces pombe (Fission
           yeast)
          Length = 146

 Score = 36.7 bits (81), Expect = 0.33
 Identities = 17/33 (51%), Positives = 24/33 (72%)
 Frame = -2

Query: 371 VEAKQPNSAIRKCVRVQLIKNGKKVTAFVPRDG 273
           V+ K+PNSA+RK  RV+L   G+ VTA++P  G
Sbjct: 61  VKPKKPNSAVRKVARVRL-STGRSVTAYIPGIG 92


>UniRef50_Q5K6X0 Cluster: Ribosomal protein S12, putative; n=2;
           Dikarya|Rep: Ribosomal protein S12, putative -
           Cryptococcus neoformans (Filobasidiella neoformans)
          Length = 176

 Score = 35.9 bits (79), Expect = 0.58
 Identities = 15/30 (50%), Positives = 23/30 (76%)
 Frame = -2

Query: 362 KQPNSAIRKCVRVQLIKNGKKVTAFVPRDG 273
           ++PNSA+RK  RV+L  NG+  TA++P +G
Sbjct: 94  RKPNSAVRKVARVKL-SNGQMTTAYIPGEG 122


>UniRef50_Q9TMN0 Cluster: Apicoplast 30S ribosomal protein S12; n=3;
           Eukaryota|Rep: Apicoplast 30S ribosomal protein S12 -
           Toxoplasma gondii
          Length = 121

 Score = 35.1 bits (77), Expect = 1.0
 Identities = 14/30 (46%), Positives = 24/30 (80%)
 Frame = -2

Query: 362 KQPNSAIRKCVRVQLIKNGKKVTAFVPRDG 273
           K+PNSA+RK  +++L KN K++ A++P +G
Sbjct: 41  KKPNSALRKIAKIKL-KNKKEILAYIPGEG 69


>UniRef50_Q2H267 Cluster: Putative uncharacterized protein; n=1;
           Chaetomium globosum|Rep: Putative uncharacterized
           protein - Chaetomium globosum (Soil fungus)
          Length = 141

 Score = 34.7 bits (76), Expect = 1.3
 Identities = 17/37 (45%), Positives = 26/37 (70%), Gaps = 1/37 (2%)
 Frame = -2

Query: 380 KVGV-EAKQPNSAIRKCVRVQLIKNGKKVTAFVPRDG 273
           +VG+ + K+PNS  RK  RV+L   GK +TA++P +G
Sbjct: 49  RVGITKPKKPNSGERKTARVRL-STGKVITAYIPGEG 84


>UniRef50_P53732 Cluster: 37S ribosomal protein S12, mitochondrial
           precursor; n=18; Dikarya|Rep: 37S ribosomal protein S12,
           mitochondrial precursor - Saccharomyces cerevisiae
           (Baker's yeast)
          Length = 153

 Score = 34.7 bits (76), Expect = 1.3
 Identities = 18/41 (43%), Positives = 27/41 (65%)
 Frame = -2

Query: 395 GPPLEKVGVEAKQPNSAIRKCVRVQLIKNGKKVTAFVPRDG 273
           G  L  + ++ K+PNSA RK  RV+L  NG  V+A++P +G
Sbjct: 60  GVVLRVMVLKPKKPNSAQRKACRVRL-TNGNVVSAYIPGEG 99


>UniRef50_O15235 Cluster: 28S ribosomal protein S12, mitochondrial
           precursor; n=13; Deuterostomia|Rep: 28S ribosomal
           protein S12, mitochondrial precursor - Homo sapiens
           (Human)
          Length = 138

 Score = 34.7 bits (76), Expect = 1.3
 Identities = 15/30 (50%), Positives = 21/30 (70%)
 Frame = -2

Query: 362 KQPNSAIRKCVRVQLIKNGKKVTAFVPRDG 273
           K+PNSA RKC RV+L   G++   F+P +G
Sbjct: 71  KKPNSANRKCCRVRL-STGREAVCFIPGEG 99


>UniRef50_Q9NEH6 Cluster: EG:BACH59J11.1 protein; n=2;
           Bilateria|Rep: EG:BACH59J11.1 protein - Drosophila
           melanogaster (Fruit fly)
          Length = 154

 Score = 34.3 bits (75), Expect = 1.8
 Identities = 18/41 (43%), Positives = 27/41 (65%)
 Frame = -2

Query: 395 GPPLEKVGVEAKQPNSAIRKCVRVQLIKNGKKVTAFVPRDG 273
           G  L+ +  + K+PNSA RKCV V+L   GK++ A++P  G
Sbjct: 74  GVVLKTLIKKPKKPNSANRKCVLVRL-STGKEMVAYIPGIG 113


>UniRef50_P10735 Cluster: 40S ribosomal protein S12, mitochondrial
           precursor; n=7; Coelomata|Rep: 40S ribosomal protein
           S12, mitochondrial precursor - Drosophila melanogaster
           (Fruit fly)
          Length = 140

 Score = 34.3 bits (75), Expect = 1.8
 Identities = 18/41 (43%), Positives = 27/41 (65%)
 Frame = -2

Query: 395 GPPLEKVGVEAKQPNSAIRKCVRVQLIKNGKKVTAFVPRDG 273
           G  L+ +  + K+PNSA RKCV V+L   GK++ A++P  G
Sbjct: 60  GVVLKTLIKKPKKPNSANRKCVLVRL-STGKEMVAYIPGIG 99


>UniRef50_P14149 Cluster: Chloroplast 30S ribosomal protein S12;
           n=5; cellular organisms|Rep: Chloroplast 30S ribosomal
           protein S12 - Chlamydomonas reinhardtii
          Length = 133

 Score = 33.9 bits (74), Expect = 2.4
 Identities = 22/59 (37%), Positives = 34/59 (57%)
 Frame = -2

Query: 371 VEAKQPNSAIRKCVRVQLIKNGKKVTAFVPRDGCLNHIEKTTKY*WRDSVVKVTPSVTF 195
           V  K+PNSA+RK  RV+L   G +VTA++P  G  +++++      R   VK  P V +
Sbjct: 40  VTPKKPNSALRKVARVRL-TTGFEVTAYIP--GVGHNLQEHAVVLVRGGRVKDLPGVRY 95


>UniRef50_Q8BGG2 Cluster: Adult male spinal cord cDNA, RIKEN
           full-length enriched library, clone:A330001L23
           product:hypothetical protein, full insert sequence; n=8;
           Euarchontoglires|Rep: Adult male spinal cord cDNA, RIKEN
           full-length enriched library, clone:A330001L23
           product:hypothetical protein, full insert sequence - Mus
           musculus (Mouse)
          Length = 154

 Score = 33.5 bits (73), Expect = 3.1
 Identities = 18/43 (41%), Positives = 22/43 (51%)
 Frame = +3

Query: 252 FFDVV*ATVTGDECGHFLSVLNELYTDAFADGRVGLLSFYTNF 380
           F + V A + G E    L VLNEL+ DA  DGR+ L      F
Sbjct: 15  FLNEVQAAIIGHERCDLLPVLNELHPDALPDGRIWLFGLNPYF 57


>UniRef50_A7S120 Cluster: Predicted protein; n=1; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 110

 Score = 33.5 bits (73), Expect = 3.1
 Identities = 14/27 (51%), Positives = 21/27 (77%)
 Frame = -2

Query: 362 KQPNSAIRKCVRVQLIKNGKKVTAFVP 282
           K+PNSA RKC  ++L  NGK ++A++P
Sbjct: 48  KKPNSAQRKCALLKL-SNGKTISAYIP 73


>UniRef50_Q896J7 Cluster: Iron-sulfur flavoprotein; n=1; Clostridium
           tetani|Rep: Iron-sulfur flavoprotein - Clostridium
           tetani
          Length = 185

 Score = 33.1 bits (72), Expect = 4.1
 Identities = 11/35 (31%), Positives = 21/35 (60%)
 Frame = +1

Query: 367 STPTFSRGGPVPIRPIVSRITIHWPSFYNRRDWEN 471
           +TP +    P P++ ++ R+ ++W   Y R+D EN
Sbjct: 78  ATPIYFANVPSPLKALIDRLQVYWSKKYIRKDREN 112


>UniRef50_Q56899 Cluster: Orf0.67; n=1; Yersinia enterocolitica|Rep:
           Orf0.67 - Yersinia enterocolitica
          Length = 295

 Score = 32.3 bits (70), Expect = 7.2
 Identities = 19/46 (41%), Positives = 26/46 (56%)
 Frame = -2

Query: 422 RLTIGRIGTGPPLEKVGVEAKQPNSAIRKCVRVQLIKNGKKVTAFV 285
           RLT  R+GTG  +  VGVE      A+R+C+   ++KN  K  A V
Sbjct: 101 RLT--RVGTGLQVRAVGVENAAVRHALRQCLLYDMVKNLLKNIAAV 144


>UniRef50_A2U8Z5 Cluster: Peptidase C26; n=2; Bacillaceae|Rep:
           Peptidase C26 - Bacillus coagulans 36D1
          Length = 234

 Score = 32.3 bits (70), Expect = 7.2
 Identities = 23/76 (30%), Positives = 35/76 (46%), Gaps = 8/76 (10%)
 Frame = +1

Query: 61  YKQRASRQQVTYHNVHL*SWSLLFLFVESEERHVGYFYHLKTN--------SGNVTDGVT 216
           +KQRA+R  ++ H VH+   SLL  +  SE   V  F+H            S    DG+ 
Sbjct: 133 HKQRAARSHLS-HTVHVLPGSLLEKWAGSETMKVNSFHHQAVRTVKAPLMVSARAPDGII 191

Query: 217 FTTESRH*YFVVFSMW 264
              E+R+  F++   W
Sbjct: 192 EAVENRNARFMIGVQW 207


>UniRef50_P92532 Cluster: Mitochondrial ribosomal protein S12;
           n=1255; cellular organisms|Rep: Mitochondrial ribosomal
           protein S12 - Arabidopsis thaliana (Mouse-ear cress)
          Length = 125

 Score = 32.3 bits (70), Expect = 7.2
 Identities = 19/56 (33%), Positives = 33/56 (58%)
 Frame = -2

Query: 362 KQPNSAIRKCVRVQLIKNGKKVTAFVPRDGCLNHIEKTTKY*WRDSVVKVTPSVTF 195
           K+PNSA+RK  +V+L  N   + A++P +G  +++++ +    R   VK  P V F
Sbjct: 43  KKPNSALRKIAKVRL-SNRHDIFAYIPGEG--HNLQEHSTVLIRGGRVKDLPGVKF 95


>UniRef50_Q9QWE7 Cluster: Cysteine protease homolog; n=1; Rattus
           sp.|Rep: Cysteine protease homolog - Rattus sp
          Length = 57

 Score = 31.9 bits (69), Expect = 9.5
 Identities = 17/23 (73%), Positives = 18/23 (78%)
 Frame = +2

Query: 455 VVTGKTLALPQLNRLCSTSPFSG 523
           VVTGKTLA P+    CSTSPFSG
Sbjct: 14  VVTGKTLA-PKEVAPCSTSPFSG 35


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 539,015,621
Number of Sequences: 1657284
Number of extensions: 11082777
Number of successful extensions: 25080
Number of sequences better than 10.0: 32
Number of HSP's better than 10.0 without gapping: 24240
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 25073
length of database: 575,637,011
effective HSP length: 95
effective length of database: 418,195,031
effective search space used: 33873797511
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).