SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0021
         (393 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_UPI0000DB6D52 Cluster: PREDICTED: similar to SET domain...   167   5e-41
UniRef50_UPI00015B4FAB Cluster: PREDICTED: similar to myotubular...   131   5e-30
UniRef50_Q6NTN5 Cluster: Myotubularin-related protein 13; n=7; E...   126   2e-28
UniRef50_Q9VGH9 Cluster: CG6939-PA, isoform A; n=2; Drosophila m...   124   5e-28
UniRef50_Q7KSP6 Cluster: CG6939-PB, isoform B; n=5; Diptera|Rep:...   124   5e-28
UniRef50_A6PVG9 Cluster: SET binding factor 1; n=28; Euteleostom...   121   6e-27
UniRef50_O95248 Cluster: Myotubularin-related protein 5; n=55; D...   121   6e-27
UniRef50_Q4SXH6 Cluster: Chromosome undetermined SCAF12410, whol...   114   5e-25
UniRef50_UPI0000E7F788 Cluster: PREDICTED: similar to SBF1 prote...    60   1e-08
UniRef50_Q5C1V2 Cluster: SJCHGC06820 protein; n=1; Schistosoma j...    56   2e-07
UniRef50_A2BFP0 Cluster: Novel protein similar to vertebrate ple...    51   9e-06
UniRef50_UPI0000D55B1F Cluster: PREDICTED: similar to pleckstrin...    50   1e-05
UniRef50_UPI00004D1CDF Cluster: Pleckstrin homology-like domain ...    49   4e-05
UniRef50_Q86UU1 Cluster: Pleckstrin homology-like domain family ...    49   4e-05
UniRef50_UPI0000F1FCA6 Cluster: PREDICTED: similar to mKIAA0638 ...    48   6e-05
UniRef50_UPI00002516BD Cluster: Abhydrolase domain-containing pr...    47   1e-04
UniRef50_Q4RYQ8 Cluster: Chromosome 16 SCAF14974, whole genome s...    47   1e-04
UniRef50_UPI0000F2148C Cluster: PREDICTED: hypothetical protein;...    46   2e-04
UniRef50_UPI00003A9BE0 Cluster: Pleckstrin homology-like domain ...    46   3e-04
UniRef50_A7SUU5 Cluster: Predicted protein; n=1; Nematostella ve...    46   3e-04
UniRef50_Q8NEI7 Cluster: PHLDB2 protein; n=12; Euteleostomi|Rep:...    46   3e-04
UniRef50_Q86SQ0 Cluster: Pleckstrin homology-like domain family ...    46   3e-04
UniRef50_UPI0000498B65 Cluster: PH domain protein; n=3; Entamoeb...    45   5e-04
UniRef50_Q7Z5H3 Cluster: Rho GTPase-activating protein 22; n=32;...    45   5e-04
UniRef50_UPI00015558E6 Cluster: PREDICTED: similar to pleckstrin...    45   6e-04
UniRef50_Q9VX80 Cluster: CG5004-PA; n=2; Sophophora|Rep: CG5004-...    44   8e-04
UniRef50_Q4T1G3 Cluster: Chromosome undetermined SCAF10611, whol...    44   0.001
UniRef50_Q4SFN1 Cluster: Chromosome 7 SCAF14601, whole genome sh...    44   0.001
UniRef50_Q55EZ5 Cluster: Putative uncharacterized protein; n=1; ...    44   0.001
UniRef50_A6R389 Cluster: Putative uncharacterized protein; n=1; ...    44   0.001
UniRef50_Q559C4 Cluster: Putative uncharacterized protein; n=2; ...    42   0.003
UniRef50_Q54GT8 Cluster: Putative uncharacterized protein; n=1; ...    42   0.003
UniRef50_UPI00001E4311 Cluster: pleckstrin homology-like domain,...    42   0.004
UniRef50_UPI0000F1F7CC Cluster: PREDICTED: similar to TBC1 domai...    42   0.006
UniRef50_UPI000049A032 Cluster: PH domain protein; n=1; Entamoeb...    42   0.006
UniRef50_UPI00015A7043 Cluster: UPI00015A7043 related cluster; n...    42   0.006
UniRef50_Q54ND2 Cluster: RhoGEF domain-containing protein; n=1; ...    42   0.006
UniRef50_UPI0000498D8F Cluster: protein kinase; n=2; Entamoeba h...    41   0.007
UniRef50_Q0J5L5 Cluster: Os08g0425100 protein; n=2; Oryza sativa...    41   0.007
UniRef50_Q9H4E7 Cluster: Differentially expressed in FDCP 6; n=2...    41   0.007
UniRef50_Q4SA95 Cluster: Chromosome 19 SCAF14691, whole genome s...    41   0.010
UniRef50_Q96C94 Cluster: PHLDB1 protein; n=6; Euteleostomi|Rep: ...    41   0.010
UniRef50_Q5U3N0 Cluster: Pleckstrin homology domain-containing f...    41   0.010
UniRef50_UPI0000ECC2F9 Cluster: TBC1 domain family member 2 (Pro...    40   0.013
UniRef50_Q7SHT9 Cluster: Putative uncharacterized protein NCU025...    40   0.013
UniRef50_Q9W5D0 Cluster: Uncharacterized protein CG12467; n=3; D...    40   0.013
UniRef50_Q9U2C7 Cluster: Oxysterol-binding protein; n=5; Bilater...    40   0.017
UniRef50_Q9HB20 Cluster: Pleckstrin homology domain-containing f...    40   0.017
UniRef50_Q9LQ55 Cluster: Dynamin-2B; n=25; Magnoliophyta|Rep: Dy...    40   0.017
UniRef50_UPI0000F1E8B1 Cluster: PREDICTED: similar to Tandem PH ...    40   0.023
UniRef50_UPI0000499868 Cluster: protein kinase; n=1; Entamoeba h...    40   0.023
UniRef50_A7SVA1 Cluster: Predicted protein; n=1; Nematostella ve...    40   0.023
UniRef50_Q0UWA1 Cluster: Putative uncharacterized protein; n=1; ...    40   0.023
UniRef50_UPI0000E81979 Cluster: PREDICTED: similar to RIKEN cDNA...    39   0.030
UniRef50_Q4RMM8 Cluster: Chromosome 10 SCAF15019, whole genome s...    39   0.030
UniRef50_Q54KA7 Cluster: SecG; n=2; Dictyostelium discoideum|Rep...    39   0.030
UniRef50_A7SNK8 Cluster: Predicted protein; n=1; Nematostella ve...    39   0.030
UniRef50_UPI000049A465 Cluster: hypothetical protein 249.t00015;...    39   0.039
UniRef50_UPI00004991C3 Cluster: protein kinase; n=1; Entamoeba h...    39   0.039
UniRef50_Q29FP2 Cluster: GA11650-PA; n=2; pseudoobscura subgroup...    39   0.039
UniRef50_Q0E8N2 Cluster: CG11628-PB, isoform B; n=4; Endopterygo...    39   0.039
UniRef50_Q9BXB5 Cluster: Oxysterol-binding protein-related prote...    39   0.039
UniRef50_Q9UN19 Cluster: Dual adapter for phosphotyrosine and 3-...    39   0.039
UniRef50_UPI0000499E4A Cluster: PH domain protein; n=2; Entamoeb...    38   0.052
UniRef50_Q5KHK2 Cluster: PH (Pleckstrin homology) domain-contain...    38   0.052
UniRef50_Q4PIB1 Cluster: Putative uncharacterized protein; n=1; ...    38   0.052
UniRef50_Q96JA3 Cluster: Pleckstrin homology domain-containing f...    38   0.052
UniRef50_UPI0000F20D7C Cluster: PREDICTED: hypothetical protein;...    38   0.069
UniRef50_Q9NGQ2 Cluster: Kinesin Unc104/KIF1a homolog; n=2; Dict...    38   0.069
UniRef50_Q86EH8 Cluster: Clone ZZD379 mRNA sequence; n=2; Schist...    38   0.069
UniRef50_Q0PIM9 Cluster: TAPP1; n=1; Branchiostoma belcheri tsin...    38   0.069
UniRef50_A2FE94 Cluster: PH domain containing protein; n=1; Tric...    38   0.069
UniRef50_Q9BYX2 Cluster: TBC1 domain family member 2; n=36; Eute...    38   0.069
UniRef50_P34512 Cluster: GTP exchange factor for ARFs 1; n=3; Ca...    38   0.069
UniRef50_UPI00004999BB Cluster: protein kinase; n=3; Entamoeba h...    38   0.091
UniRef50_UPI000065EBFA Cluster: UPI000065EBFA related cluster; n...    37   0.12 
UniRef50_Q5DGD2 Cluster: SJCHGC01551 protein; n=1; Schistosoma j...    37   0.12 
UniRef50_Q0IEU3 Cluster: Centaurin alpha; n=4; Endopterygota|Rep...    37   0.12 
UniRef50_Q10FJ2 Cluster: Pleckstriny domain-containing protein, ...    37   0.16 
UniRef50_Q00Y38 Cluster: AtPH1-like protein; n=2; Ostreococcus|R...    37   0.16 
UniRef50_Q556C4 Cluster: Pleckstrin homology (PH) domain-contain...    37   0.16 
UniRef50_Q1ZXL0 Cluster: Pleckstrin homology (PH) domain-contain...    37   0.16 
UniRef50_Q0PIN0 Cluster: Bam32; n=1; Branchiostoma belcheri tsin...    37   0.16 
UniRef50_A2DS63 Cluster: AGC family protein kinase; n=3; Trichom...    37   0.16 
UniRef50_UPI0001554A30 Cluster: PREDICTED: similar to dopamine r...    36   0.21 
UniRef50_UPI0000F2C318 Cluster: PREDICTED: similar to RIKEN cDNA...    36   0.21 
UniRef50_UPI0000E49CFC Cluster: PREDICTED: similar to Ras GTPase...    36   0.21 
UniRef50_Q54W22 Cluster: Putative uncharacterized protein; n=1; ...    36   0.21 
UniRef50_A7RKJ9 Cluster: Predicted protein; n=1; Nematostella ve...    36   0.28 
UniRef50_A0E6T7 Cluster: Chromosome undetermined scaffold_80, wh...    36   0.28 
UniRef50_Q9ULM0 Cluster: Pleckstrin homology domain-containing f...    36   0.28 
UniRef50_Q6ZWC7 Cluster: CDNA FLJ41311 fis, clone BRAMY2042760; ...    36   0.28 
UniRef50_Q4S175 Cluster: Chromosome 13 SCAF14769, whole genome s...    36   0.37 
UniRef50_Q54U56 Cluster: Putative uncharacterized protein; n=1; ...    36   0.37 
UniRef50_A1CE30 Cluster: RhoGAP domain protein; n=3; Aspergillus...    36   0.37 
UniRef50_UPI00015B5EDD Cluster: PREDICTED: hypothetical protein;...    35   0.48 
UniRef50_UPI0000F1D7A0 Cluster: PREDICTED: similar to KIAA0799 p...    35   0.48 
UniRef50_Q8IR23 Cluster: CG9209-PA, isoform A; n=6; Endopterygot...    35   0.48 
UniRef50_Q54F88 Cluster: Putative uncharacterized protein; n=1; ...    35   0.48 
UniRef50_A7SJE8 Cluster: Predicted protein; n=1; Nematostella ve...    35   0.48 
UniRef50_Q6C6P3 Cluster: Yarrowia lipolytica chromosome E of str...    35   0.48 
UniRef50_P08567 Cluster: Pleckstrin; n=32; Euteleostomi|Rep: Ple...    35   0.48 
UniRef50_UPI000155439F Cluster: PREDICTED: similar to jerky; n=1...    35   0.64 
UniRef50_UPI0000F1F040 Cluster: PREDICTED: similar to RIKEN cDNA...    35   0.64 
UniRef50_UPI00004989C6 Cluster: PH domain protein; n=1; Entamoeb...    35   0.64 
UniRef50_Q00IB7 Cluster: Max1; n=3; Danio rerio|Rep: Max1 - Dani...    35   0.64 
UniRef50_Q8BGR1 Cluster: RIKEN cDNA 2610034M16 gene; n=13; Euthe...    35   0.64 
UniRef50_Q8VYJ6 Cluster: At2g30880/F7F1.9; n=6; Magnoliophyta|Re...    35   0.64 
UniRef50_Q552G3 Cluster: Putative uncharacterized protein; n=2; ...    35   0.64 
UniRef50_Q552E4 Cluster: Actin binding protein; n=2; Dictyosteli...    35   0.64 
UniRef50_Q17FY6 Cluster: Putative uncharacterized protein; n=1; ...    35   0.64 
UniRef50_Q9UPU7 Cluster: TBC1 domain family member 2B; n=36; Eum...    35   0.64 
UniRef50_Q4WNH0 Cluster: Rho GTPase activator (Bem3), putative; ...    35   0.64 
UniRef50_Q1DQZ7 Cluster: Putative uncharacterized protein; n=1; ...    35   0.64 
UniRef50_Q0CFX3 Cluster: Putative uncharacterized protein; n=2; ...    35   0.64 
UniRef50_UPI0000DA27B8 Cluster: PREDICTED: similar to TBC1 domai...    34   0.85 
UniRef50_Q7PX66 Cluster: ENSANGP00000009854; n=11; Eumetazoa|Rep...    34   0.85 
UniRef50_Q618J0 Cluster: Putative uncharacterized protein CBG146...    34   0.85 
UniRef50_Q5D8E7 Cluster: SJCHGC04408 protein; n=1; Schistosoma j...    34   0.85 
UniRef50_Q5CRP7 Cluster: AtPH1 like protein with a pleckstrin ho...    34   0.85 
UniRef50_Q54PT8 Cluster: Putative uncharacterized protein; n=1; ...    34   0.85 
UniRef50_A6RIY7 Cluster: Putative uncharacterized protein; n=1; ...    34   0.85 
UniRef50_UPI0000660806 Cluster: Homolog of Homo sapiens "Myosin ...    34   1.1  
UniRef50_Q4RQM4 Cluster: Chromosome 2 SCAF15004, whole genome sh...    34   1.1  
UniRef50_Q55AN8 Cluster: Pleckstrin homology (PH) domain-contain...    34   1.1  
UniRef50_A7RZW1 Cluster: Predicted protein; n=1; Nematostella ve...    34   1.1  
UniRef50_A7EGQ4 Cluster: Putative uncharacterized protein; n=1; ...    34   1.1  
UniRef50_P42331 Cluster: Rho GTPase-activating protein 25; n=37;...    34   1.1  
UniRef50_O74653 Cluster: Protein pob1; n=1; Schizosaccharomyces ...    34   1.1  
UniRef50_UPI0000DB6DED Cluster: PREDICTED: similar to CG1513-PA;...    33   1.5  
UniRef50_UPI0000DB6D31 Cluster: PREDICTED: similar to pleckstrin...    33   1.5  
UniRef50_UPI000058428B Cluster: PREDICTED: similar to Pleckstrin...    33   1.5  
UniRef50_UPI000023DDD0 Cluster: hypothetical protein FG04718.1; ...    33   1.5  
UniRef50_Q4SG69 Cluster: Chromosome 17 SCAF14597, whole genome s...    33   1.5  
UniRef50_Q8IGC7 Cluster: RH55218p; n=5; Diptera|Rep: RH55218p - ...    33   1.5  
UniRef50_Q24CH5 Cluster: PH domain containing protein; n=1; Tetr...    33   1.5  
UniRef50_Q22NV8 Cluster: Putative uncharacterized protein; n=1; ...    33   1.5  
UniRef50_Q17GN5 Cluster: Putative uncharacterized protein; n=3; ...    33   1.5  
UniRef50_A2F3V7 Cluster: PH domain containing protein; n=1; Tric...    33   1.5  
UniRef50_Q5VSM6 Cluster: Oxysterol-binding protein; n=40; Coelom...    33   1.5  
UniRef50_Q5KBD9 Cluster: Oxysterol-binding protein, putative; n=...    33   1.5  
UniRef50_A5DS35 Cluster: Putative uncharacterized protein; n=1; ...    33   1.5  
UniRef50_Q9UH65 Cluster: Switch-associated protein 70; n=33; Eut...    33   1.5  
UniRef50_Q9HB19 Cluster: Pleckstrin homology domain-containing f...    33   1.5  
UniRef50_Q96SU4 Cluster: Oxysterol-binding protein-related prote...    33   1.5  
UniRef50_UPI00005872F3 Cluster: PREDICTED: hypothetical protein,...    33   2.0  
UniRef50_UPI00004992E5 Cluster: PH domain protein; n=1; Entamoeb...    33   2.0  
UniRef50_Q5W7F2 Cluster: ARF-GAP; n=5; Magnoliophyta|Rep: ARF-GA...    33   2.0  
UniRef50_A7QT71 Cluster: Chromosome chr1 scaffold_166, whole gen...    33   2.0  
UniRef50_Q9TXP3 Cluster: Mtm (Myotubularin) family protein 5; n=...    33   2.0  
UniRef50_A2DL64 Cluster: PH domain containing protein; n=1; Tric...    33   2.0  
UniRef50_Q8X0U9 Cluster: Related to budding protein BOI2; n=4; S...    33   2.0  
UniRef50_Q8IVE3 Cluster: Pleckstrin homology domain-containing f...    33   2.0  
UniRef50_Q8INB9 Cluster: RAC serine/threonine-protein kinase; n=...    33   2.0  
UniRef50_UPI0000DA2FA4 Cluster: PREDICTED: similar to Guanine nu...    33   2.6  
UniRef50_UPI00004D9442 Cluster: pleckstrin homology domain conta...    33   2.6  
UniRef50_Q8BUL6-2 Cluster: Isoform 2 of Q8BUL6 ; n=6; Mammalia|R...    33   2.6  
UniRef50_Q4SM04 Cluster: Chromosome 13 SCAF14555, whole genome s...    33   2.6  
UniRef50_Q9FIT8 Cluster: GCN4-complementing protein homolog; n=2...    33   2.6  
UniRef50_Q5BXS4 Cluster: SJCHGC05290 protein; n=1; Schistosoma j...    33   2.6  
UniRef50_Q2H559 Cluster: Putative uncharacterized protein; n=1; ...    33   2.6  
UniRef50_A7TSE3 Cluster: Putative uncharacterized protein; n=1; ...    33   2.6  
UniRef50_Q8BUL6 Cluster: Pleckstrin homology domain-containing f...    33   2.6  
UniRef50_Q9HB21 Cluster: Pleckstrin homology domain-containing f...    33   2.6  
UniRef50_P28818 Cluster: Guanine nucleotide-releasing protein; n...    33   2.6  
UniRef50_Q5M7E8 Cluster: LOC496220 protein; n=3; Tetrapoda|Rep: ...    32   3.4  
UniRef50_Q4SQC0 Cluster: Chromosome 4 SCAF14533, whole genome sh...    32   3.4  
UniRef50_Q6ZPK1 Cluster: MKIAA1686 protein; n=13; Euteleostomi|R...    32   3.4  
UniRef50_Q9C6C3 Cluster: GCN4-complementing protein, putative; 3...    32   3.4  
UniRef50_Q5N891 Cluster: Pleckstrin homology (PH) domain-contain...    32   3.4  
UniRef50_Q010V7 Cluster: Pleckstrin homology; n=2; Ostreococcus|...    32   3.4  
UniRef50_Q55FY1 Cluster: Putative uncharacterized protein; n=1; ...    32   3.4  
UniRef50_Q0V184 Cluster: Putative uncharacterized protein; n=1; ...    32   3.4  
UniRef50_A1D9C3 Cluster: Oxysterol binding protein (Osh1), putat...    32   3.4  
UniRef50_Q9H4M7 Cluster: Pleckstrin homology domain-containing f...    32   3.4  
UniRef50_UPI0000498916 Cluster: PH domain protein; n=1; Entamoeb...    32   4.5  
UniRef50_Q4SAW8 Cluster: Chromosome 3 SCAF14679, whole genome sh...    32   4.5  
UniRef50_A0ZJ84 Cluster: Putative uncharacterized protein; n=1; ...    32   4.5  
UniRef50_Q9VC05 Cluster: Oxysterol-binding protein; n=15; Endopt...    32   4.5  
UniRef50_A7S8R7 Cluster: Predicted protein; n=2; Eumetazoa|Rep: ...    32   4.5  
UniRef50_A2DYR8 Cluster: PH domain containing protein; n=1; Tric...    32   4.5  
UniRef50_A2DGQ9 Cluster: ARF GAP-like zinc finger-containing pro...    32   4.5  
UniRef50_Q6BNF1 Cluster: Debaryomyces hansenii chromosome E of s...    32   4.5  
UniRef50_Q9NYT0 Cluster: Pleckstrin-2; n=22; Euteleostomi|Rep: P...    32   4.5  
UniRef50_P54644 Cluster: RAC family serine/threonine-protein kin...    32   4.5  
UniRef50_UPI00015B5B5D Cluster: PREDICTED: similar to conserved ...    31   6.0  
UniRef50_UPI0000E47083 Cluster: PREDICTED: similar to phosphoino...    31   6.0  
UniRef50_Q4SBF8 Cluster: Chromosome 11 SCAF14674, whole genome s...    31   6.0  
UniRef50_Q4RT07 Cluster: Oxysterol-binding protein; n=5; Euteleo...    31   6.0  
UniRef50_Q4RNH3 Cluster: Chromosome undetermined SCAF15013, whol...    31   6.0  
UniRef50_Q552C1 Cluster: Pleckstrin homology (PH) domain-contain...    31   6.0  
UniRef50_Q23ND4 Cluster: Putative uncharacterized protein; n=1; ...    31   6.0  
UniRef50_Q1RLE3 Cluster: Zinc finger protein; n=1; Ciona intesti...    31   6.0  
UniRef50_A7SUD4 Cluster: Predicted protein; n=1; Nematostella ve...    31   6.0  
UniRef50_A2FS37 Cluster: PH domain containing protein; n=1; Tric...    31   6.0  
UniRef50_A1Z814 Cluster: Oxysterol-binding protein; n=3; Diptera...    31   6.0  
UniRef50_Q6NSF8 Cluster: PLEKHA5 protein; n=18; Euteleostomi|Rep...    31   6.0  
UniRef50_Q5KA89 Cluster: Signal transducer, putative; n=1; Filob...    31   6.0  
UniRef50_A3M0F7 Cluster: RHO protein signal transduction; n=1; P...    31   6.0  
UniRef50_Q9HAU0 Cluster: Pleckstrin homology domain-containing f...    31   6.0  
UniRef50_Q15027 Cluster: Centaurin-beta 1; n=12; Eutheria|Rep: C...    31   6.0  
UniRef50_UPI0000F2B0A5 Cluster: PREDICTED: hypothetical protein;...    31   7.9  
UniRef50_UPI0000D5747C Cluster: PREDICTED: similar to CG14366-PA...    31   7.9  
UniRef50_UPI000065DF70 Cluster: Pleckstrin homology domain-conta...    31   7.9  
UniRef50_Q96CS7-2 Cluster: Isoform 2 of Q96CS7 ; n=2; Homo sapie...    31   7.9  
UniRef50_Q4SRG8 Cluster: Chromosome undetermined SCAF14526, whol...    31   7.9  
UniRef50_Q4SNI4 Cluster: Chromosome 15 SCAF14542, whole genome s...    31   7.9  
UniRef50_Q4SN92 Cluster: Chromosome 8 SCAF14543, whole genome sh...    31   7.9  
UniRef50_Q0VPC9 Cluster: ATP-dependent helicase HrpA; n=1; Alcan...    31   7.9  
UniRef50_A2X7I4 Cluster: Putative uncharacterized protein; n=2; ...    31   7.9  
UniRef50_Q9VFR7 Cluster: CG14366-PA; n=1; Drosophila melanogaste...    31   7.9  
UniRef50_A7SJB4 Cluster: Predicted protein; n=1; Nematostella ve...    31   7.9  
UniRef50_A2FLX7 Cluster: AGC family protein kinase; n=4; Trichom...    31   7.9  
UniRef50_A0D2Y6 Cluster: Chromosome undetermined scaffold_36, wh...    31   7.9  
UniRef50_Q756M9 Cluster: AER225Wp; n=1; Eremothecium gossypii|Re...    31   7.9  
UniRef50_P20936 Cluster: Ras GTPase-activating protein 1; n=50; ...    31   7.9  
UniRef50_Q96CS7 Cluster: Pleckstrin homology domain-containing f...    31   7.9  
UniRef50_Q27421 Cluster: Protein outspread; n=5; Sophophora|Rep:...    31   7.9  

>UniRef50_UPI0000DB6D52 Cluster: PREDICTED: similar to SET domain
            binding factor CG6939-PB, isoform B isoform 1; n=3;
            Endopterygota|Rep: PREDICTED: similar to SET domain
            binding factor CG6939-PB, isoform B isoform 1 - Apis
            mellifera
          Length = 2007

 Score =  167 bits (407), Expect = 5e-41
 Identities = 72/82 (87%), Positives = 78/82 (95%)
 Frame = -3

Query: 253  GHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDLAEVIAVTQATPAPGPP 74
            G+LYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKG+IDLAEV++VT A P PGPP
Sbjct: 1908 GYLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGYIDLAEVVSVTPAQPMPGPP 1967

Query: 73   KKCDDRSFFDLRTSRRTYNFCA 8
            KK DD+SFFDLRT+RRTYNFCA
Sbjct: 1968 KKTDDKSFFDLRTNRRTYNFCA 1989


>UniRef50_UPI00015B4FAB Cluster: PREDICTED: similar to myotubularin;
            n=2; Apocrita|Rep: PREDICTED: similar to myotubularin -
            Nasonia vitripennis
          Length = 2064

 Score =  131 bits (316), Expect = 5e-30
 Identities = 58/82 (70%), Positives = 68/82 (82%)
 Frame = -3

Query: 253  GHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDLAEVIAVTQATPAPGPP 74
            G+L+KRGALLKGWKQRWFVLDSIKHQLRYYDAMEDS+CKG+IDLAEV++VT A P   P 
Sbjct: 1876 GYLFKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSNCKGYIDLAEVVSVTPAAPVQAPG 1935

Query: 73   KKCDDRSFFDLRTSRRTYNFCA 8
            KK DD+SFFD+     + +F A
Sbjct: 1936 KKTDDKSFFDVSAKFCSQSFFA 1957


>UniRef50_Q6NTN5 Cluster: Myotubularin-related protein 13; n=7;
            Euteleostomi|Rep: Myotubularin-related protein 13 -
            Xenopus laevis (African clawed frog)
          Length = 1873

 Score =  126 bits (304), Expect = 2e-28
 Identities = 56/91 (61%), Positives = 69/91 (75%), Gaps = 2/91 (2%)
 Frame = -3

Query: 274  RREQNA--RGHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDLAEVIAVT 101
            + E+N    G LYKRGALLKGWK RWFVLD  KHQLRYYD+ ED+ CKG+IDLA+V  V 
Sbjct: 1763 KNEENRSYEGILYKRGALLKGWKPRWFVLDITKHQLRYYDSGEDTSCKGYIDLADVETVV 1822

Query: 100  QATPAPGPPKKCDDRSFFDLRTSRRTYNFCA 8
             A P  G PK  ++++FFD++TS+R YNFCA
Sbjct: 1823 PAAPTIGAPKHANEKAFFDVKTSKRVYNFCA 1853


>UniRef50_Q9VGH9 Cluster: CG6939-PA, isoform A; n=2; Drosophila
            melanogaster|Rep: CG6939-PA, isoform A - Drosophila
            melanogaster (Fruit fly)
          Length = 1993

 Score =  124 bits (300), Expect = 5e-28
 Identities = 58/82 (70%), Positives = 65/82 (79%)
 Frame = -3

Query: 253  GHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDLAEVIAVTQATPAPGPP 74
            GHLYKRGALLKGWKQRWFVLDSIKHQLRYYD  ED+  KG I+LAEV +VT A PA    
Sbjct: 1894 GHLYKRGALLKGWKQRWFVLDSIKHQLRYYDTSEDTAPKGIIELAEVQSVTAAQPAQIGA 1953

Query: 73   KKCDDRSFFDLRTSRRTYNFCA 8
            K  D++ FFDL+TS+R YNF A
Sbjct: 1954 KGVDEKGFFDLKTSKRIYNFYA 1975


>UniRef50_Q7KSP6 Cluster: CG6939-PB, isoform B; n=5; Diptera|Rep:
            CG6939-PB, isoform B - Drosophila melanogaster (Fruit
            fly)
          Length = 1973

 Score =  124 bits (300), Expect = 5e-28
 Identities = 58/82 (70%), Positives = 65/82 (79%)
 Frame = -3

Query: 253  GHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDLAEVIAVTQATPAPGPP 74
            GHLYKRGALLKGWKQRWFVLDSIKHQLRYYD  ED+  KG I+LAEV +VT A PA    
Sbjct: 1874 GHLYKRGALLKGWKQRWFVLDSIKHQLRYYDTSEDTAPKGIIELAEVQSVTAAQPAQIGA 1933

Query: 73   KKCDDRSFFDLRTSRRTYNFCA 8
            K  D++ FFDL+TS+R YNF A
Sbjct: 1934 KGVDEKGFFDLKTSKRIYNFYA 1955


>UniRef50_A6PVG9 Cluster: SET binding factor 1; n=28;
            Euteleostomi|Rep: SET binding factor 1 - Homo sapiens
            (Human)
          Length = 1893

 Score =  121 bits (291), Expect = 6e-27
 Identities = 52/82 (63%), Positives = 61/82 (74%)
 Frame = -3

Query: 253  GHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDLAEVIAVTQATPAPGPP 74
            G LYK+GA +K WK RWFVLD  KHQLRYYD   D+ CKG IDLAEV AV   TP  G P
Sbjct: 1792 GTLYKKGAFMKPWKARWFVLDKTKHQLRYYDHRVDTECKGVIDLAEVEAVAPGTPTMGAP 1851

Query: 73   KKCDDRSFFDLRTSRRTYNFCA 8
            K  D+++FFD++T+RR YNFCA
Sbjct: 1852 KTVDEKAFFDVKTTRRVYNFCA 1873


>UniRef50_O95248 Cluster: Myotubularin-related protein 5; n=55;
            Deuterostomia|Rep: Myotubularin-related protein 5 - Homo
            sapiens (Human)
          Length = 1867

 Score =  121 bits (291), Expect = 6e-27
 Identities = 52/82 (63%), Positives = 61/82 (74%)
 Frame = -3

Query: 253  GHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDLAEVIAVTQATPAPGPP 74
            G LYK+GA +K WK RWFVLD  KHQLRYYD   D+ CKG IDLAEV AV   TP  G P
Sbjct: 1766 GTLYKKGAFMKPWKARWFVLDKTKHQLRYYDHRVDTECKGVIDLAEVEAVAPGTPTMGAP 1825

Query: 73   KKCDDRSFFDLRTSRRTYNFCA 8
            K  D+++FFD++T+RR YNFCA
Sbjct: 1826 KTVDEKAFFDVKTTRRVYNFCA 1847


>UniRef50_Q4SXH6 Cluster: Chromosome undetermined SCAF12410, whole
            genome shotgun sequence; n=1; Tetraodon nigroviridis|Rep:
            Chromosome undetermined SCAF12410, whole genome shotgun
            sequence - Tetraodon nigroviridis (Green puffer)
          Length = 1350

 Score =  114 bits (275), Expect = 5e-25
 Identities = 49/82 (59%), Positives = 63/82 (76%)
 Frame = -3

Query: 253  GHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDLAEVIAVTQATPAPGPP 74
            G L+K+GALLK WKQR FVLD  KHQLRYY++ +D  CKG I+LAEV +V   TP  G P
Sbjct: 1249 GILFKKGALLKPWKQRLFVLDKTKHQLRYYESRQDKECKGVIELAEVESVIPGTPTIGAP 1308

Query: 73   KKCDDRSFFDLRTSRRTYNFCA 8
            K  ++++FFDL+T++R YNFCA
Sbjct: 1309 KNIEEKAFFDLKTTKRVYNFCA 1330


>UniRef50_UPI0000E7F788 Cluster: PREDICTED: similar to SBF1 protein;
           n=1; Gallus gallus|Rep: PREDICTED: similar to SBF1
           protein - Gallus gallus
          Length = 394

 Score = 60.5 bits (140), Expect = 1e-08
 Identities = 25/45 (55%), Positives = 33/45 (73%)
 Frame = -3

Query: 175 LRYYDAMEDSHCKGFIDLAEVIAVTQATPAPGPPKKCDDRSFFDL 41
           LRYYD+  D+ CKG IDLAEV ++T  TP  G PK  D+++FFD+
Sbjct: 344 LRYYDSRMDTECKGVIDLAEVESITPGTPTMGAPKTVDEKAFFDV 388


>UniRef50_Q5C1V2 Cluster: SJCHGC06820 protein; n=1; Schistosoma
           japonicum|Rep: SJCHGC06820 protein - Schistosoma
           japonicum (Blood fluke)
          Length = 305

 Score = 56.4 bits (130), Expect = 2e-07
 Identities = 34/88 (38%), Positives = 49/88 (55%), Gaps = 4/88 (4%)
 Frame = -3

Query: 253 GHLYKRG--ALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDLAEVIAVTQATPAPG 80
           G+LYK G    L+ WKQR+F LD  +HQL+YY++  ++  +G IDL +V  V +      
Sbjct: 161 GYLYKLGHRKFLQQWKQRFFALDINRHQLKYYESYANASPRGCIDLQDVRTV-RIVKNFT 219

Query: 79  PPKKCDDRSFFDLRTSRRTYNF--CASR 2
             +K      F+L T+ RTY    C SR
Sbjct: 220 QQRKSPTFVVFELETNNRTYKLGCCQSR 247


>UniRef50_A2BFP0 Cluster: Novel protein similar to vertebrate
            pleckstrin homology-like domain, family B, member 1; n=3;
            Danio rerio|Rep: Novel protein similar to vertebrate
            pleckstrin homology-like domain, family B, member 1 -
            Danio rerio (Zebrafish) (Brachydanio rerio)
          Length = 1365

 Score = 50.8 bits (116), Expect = 9e-06
 Identities = 29/83 (34%), Positives = 39/83 (46%), Gaps = 9/83 (10%)
 Frame = -3

Query: 268  EQNARGHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDLAEVIAV----- 104
            E+  +GHL K G  +K WK+RWFV D +K    YY    ++  KG I    +  V     
Sbjct: 1255 EKMCKGHLVKMGGKIKSWKKRWFVFDRLKRTFSYYVDKHETKLKGVIYFQAIEEVYYDHL 1314

Query: 103  TQATPAPGPP----KKCDDRSFF 47
              AT +P P      K  DR +F
Sbjct: 1315 RSATKSPNPSLTFCVKTHDRLYF 1337


>UniRef50_UPI0000D55B1F Cluster: PREDICTED: similar to pleckstrin
            homology-like domain, family B, member 2; n=1; Tribolium
            castaneum|Rep: PREDICTED: similar to pleckstrin
            homology-like domain, family B, member 2 - Tribolium
            castaneum
          Length = 1201

 Score = 50.4 bits (115), Expect = 1e-05
 Identities = 19/43 (44%), Positives = 27/43 (62%)
 Frame = -3

Query: 262  NARGHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKG 134
            + RG L+K+G+ L GW +RWFV D  KH L YY+   +   +G
Sbjct: 1092 SCRGFLHKKGSKLNGWSKRWFVFDRNKHTLTYYNDKSEKKARG 1134


>UniRef50_UPI00004D1CDF Cluster: Pleckstrin homology-like domain
            family B member 1 (Protein LL5-alpha).; n=1; Xenopus
            tropicalis|Rep: Pleckstrin homology-like domain family B
            member 1 (Protein LL5-alpha). - Xenopus tropicalis
          Length = 1227

 Score = 48.8 bits (111), Expect = 4e-05
 Identities = 21/47 (44%), Positives = 27/47 (57%)
 Frame = -3

Query: 268  EQNARGHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFI 128
            E+  RG L K G  +K WK+RWFV D +K  L YY    ++  KG I
Sbjct: 1117 EKMCRGFLTKMGGKIKSWKKRWFVFDRLKRTLSYYVDKHEAKLKGVI 1163


>UniRef50_Q86UU1 Cluster: Pleckstrin homology-like domain family B
            member 1; n=66; Eumetazoa|Rep: Pleckstrin homology-like
            domain family B member 1 - Homo sapiens (Human)
          Length = 1377

 Score = 48.8 bits (111), Expect = 4e-05
 Identities = 20/43 (46%), Positives = 26/43 (60%)
 Frame = -3

Query: 256  RGHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFI 128
            RG+L K G  +K WK+RWFV D +K  L YY    ++  KG I
Sbjct: 1260 RGYLVKMGGKIKSWKKRWFVFDRLKRTLSYYVDKHETKLKGVI 1302


>UniRef50_UPI0000F1FCA6 Cluster: PREDICTED: similar to mKIAA0638
            protein; n=1; Danio rerio|Rep: PREDICTED: similar to
            mKIAA0638 protein - Danio rerio
          Length = 1390

 Score = 48.0 bits (109), Expect = 6e-05
 Identities = 20/47 (42%), Positives = 26/47 (55%)
 Frame = -3

Query: 268  EQNARGHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFI 128
            E+  +G L K G  +K WK+RWFV D +K    YY    +S  KG I
Sbjct: 1275 EKMCKGFLVKMGGKIKSWKKRWFVFDRLKRTFSYYADKHESKLKGVI 1321


>UniRef50_UPI00002516BD Cluster: Abhydrolase domain-containing protein
            10, mitochondrial precursor (EC 3.4.-.-).; n=2;
            Theria|Rep: Abhydrolase domain-containing protein 10,
            mitochondrial precursor (EC 3.4.-.-). - Rattus norvegicus
          Length = 1271

 Score = 47.2 bits (107), Expect = 1e-04
 Identities = 20/47 (42%), Positives = 26/47 (55%)
 Frame = -3

Query: 268  EQNARGHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFI 128
            E+  RG+L K G  +K WK+RWFV D  K    YY    ++  KG I
Sbjct: 1161 EKTCRGYLIKMGGKIKTWKKRWFVFDRNKRTFSYYADKHEAKLKGVI 1207


>UniRef50_Q4RYQ8 Cluster: Chromosome 16 SCAF14974, whole genome
            shotgun sequence; n=1; Tetraodon nigroviridis|Rep:
            Chromosome 16 SCAF14974, whole genome shotgun sequence -
            Tetraodon nigroviridis (Green puffer)
          Length = 1369

 Score = 47.2 bits (107), Expect = 1e-04
 Identities = 19/47 (40%), Positives = 26/47 (55%)
 Frame = -3

Query: 268  EQNARGHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFI 128
            E+  RG L K G  +K WK+RWFV D ++    YY    ++  KG I
Sbjct: 1259 EKTCRGFLVKMGGKIKSWKKRWFVFDRLRRTFSYYIDKHETKLKGVI 1305


>UniRef50_UPI0000F2148C Cluster: PREDICTED: hypothetical protein; n=1;
            Danio rerio|Rep: PREDICTED: hypothetical protein - Danio
            rerio
          Length = 1329

 Score = 46.4 bits (105), Expect = 2e-04
 Identities = 20/47 (42%), Positives = 26/47 (55%)
 Frame = -3

Query: 268  EQNARGHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFI 128
            E+  RG L K G  +K WK+RWFV D  +  L YY    ++  KG I
Sbjct: 1208 EKTCRGFLIKMGGKIKTWKKRWFVFDRNRRTLSYYADKHEAKLKGVI 1254


>UniRef50_UPI00003A9BE0 Cluster: Pleckstrin homology-like domain
            family B member 2 (Protein LL5-beta).; n=5; Amniota|Rep:
            Pleckstrin homology-like domain family B member 2
            (Protein LL5-beta). - Gallus gallus
          Length = 1253

 Score = 46.0 bits (104), Expect = 3e-04
 Identities = 20/47 (42%), Positives = 25/47 (53%)
 Frame = -3

Query: 268  EQNARGHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFI 128
            E+  RG L K G  +K WK+RWFV D  K    YY    ++  KG I
Sbjct: 1143 EKTCRGFLIKMGGKIKTWKKRWFVFDRNKRTFTYYADKHETKLKGVI 1189


>UniRef50_A7SUU5 Cluster: Predicted protein; n=1; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 562

 Score = 46.0 bits (104), Expect = 3e-04
 Identities = 30/86 (34%), Positives = 46/86 (53%), Gaps = 3/86 (3%)
 Frame = -3

Query: 256 RGHLYKRGAL-LKG--WKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDLAEVIAVTQATPA 86
           RG L KRG   L G  W++RWF  D+ + +L YY    ++H +GFIDL ++I   Q  P 
Sbjct: 453 RGWLCKRGVRGLTGRRWRRRWFATDN-EGRLYYYKKTNNTHPRGFIDL-DIIVAVQDKPT 510

Query: 85  PGPPKKCDDRSFFDLRTSRRTYNFCA 8
               ++  + + FD+ T  R +   A
Sbjct: 511 ---DEQDTNNALFDVITPARVFELMA 533


>UniRef50_Q8NEI7 Cluster: PHLDB2 protein; n=12; Euteleostomi|Rep:
           PHLDB2 protein - Homo sapiens (Human)
          Length = 195

 Score = 46.0 bits (104), Expect = 3e-04
 Identities = 20/47 (42%), Positives = 25/47 (53%)
 Frame = -3

Query: 268 EQNARGHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFI 128
           E+  RG L K G  +K WK+RWFV D  K    YY    ++  KG I
Sbjct: 85  EKTCRGFLIKMGGKIKTWKKRWFVFDRNKRTFSYYADKHETKLKGVI 131


>UniRef50_Q86SQ0 Cluster: Pleckstrin homology-like domain family B
            member 2; n=44; Euteleostomi|Rep: Pleckstrin
            homology-like domain family B member 2 - Homo sapiens
            (Human)
          Length = 1253

 Score = 46.0 bits (104), Expect = 3e-04
 Identities = 20/47 (42%), Positives = 25/47 (53%)
 Frame = -3

Query: 268  EQNARGHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFI 128
            E+  RG L K G  +K WK+RWFV D  K    YY    ++  KG I
Sbjct: 1143 EKTCRGFLIKMGGKIKTWKKRWFVFDRNKRTFSYYADKHETKLKGVI 1189


>UniRef50_UPI0000498B65 Cluster: PH domain protein; n=3; Entamoeba
           histolytica HM-1:IMSS|Rep: PH domain protein - Entamoeba
           histolytica HM-1:IMSS
          Length = 509

 Score = 45.2 bits (102), Expect = 5e-04
 Identities = 27/74 (36%), Positives = 35/74 (47%)
 Frame = -3

Query: 289 VLVERRREQNARGHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDLAEVI 110
           V V   +  N  G   K+G   K WK+RWFV+   K  + Y+    D+  KG+IDL    
Sbjct: 7   VSVASLQPSNFEGWATKQGGSWKSWKRRWFVIKDRK--MWYFAGKNDTEAKGWIDLTPGT 64

Query: 109 AVTQATPAPGPPKK 68
            V   T  PG  KK
Sbjct: 65  EVKDLT-QPGQKKK 77


>UniRef50_Q7Z5H3 Cluster: Rho GTPase-activating protein 22; n=32;
           Euteleostomi|Rep: Rho GTPase-activating protein 22 -
           Homo sapiens (Human)
          Length = 698

 Score = 45.2 bits (102), Expect = 5e-04
 Identities = 25/62 (40%), Positives = 35/62 (56%)
 Frame = -3

Query: 253 GHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDLAEVIAVTQATPAPGPP 74
           G L K+ +++K W+QRWFVL     QL YY   ++   +GFI L +   VT+  P P  P
Sbjct: 42  GWLKKQRSIMKNWQQRWFVLRG--DQLFYYKDKDEIKPQGFISL-QGTQVTELPPGPEDP 98

Query: 73  KK 68
            K
Sbjct: 99  GK 100


>UniRef50_UPI00015558E6 Cluster: PREDICTED: similar to pleckstrin
           homology-like domain, family B, member 3; n=1;
           Ornithorhynchus anatinus|Rep: PREDICTED: similar to
           pleckstrin homology-like domain, family B, member 3 -
           Ornithorhynchus anatinus
          Length = 489

 Score = 44.8 bits (101), Expect = 6e-04
 Identities = 19/43 (44%), Positives = 25/43 (58%)
 Frame = -3

Query: 256 RGHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFI 128
           RG L K G  +K W++RWF  D  K +L YY   E++  KG I
Sbjct: 377 RGPLIKMGGRIKTWRKRWFCFDRSKRRLAYYADKEETKLKGVI 419


>UniRef50_Q9VX80 Cluster: CG5004-PA; n=2; Sophophora|Rep: CG5004-PA -
            Drosophila melanogaster (Fruit fly)
          Length = 1247

 Score = 44.4 bits (100), Expect = 8e-04
 Identities = 29/89 (32%), Positives = 42/89 (47%), Gaps = 3/89 (3%)
 Frame = -3

Query: 262  NARGHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKG---FIDLAEVIAVTQAT 92
            + RG+L+K GA    W +RWFVLD  +  L YY    +   +G   F  + EV       
Sbjct: 1142 SCRGYLHKLGATFHAWSRRWFVLDRQRSALIYYSDKSERKPRGGAYFATIDEVYLDHLNA 1201

Query: 91   PAPGPPKKCDDRSFFDLRTSRRTYNFCAS 5
               G P  C     F ++T +R+YN  A+
Sbjct: 1202 SKSGRP-HCT----FIVKTKKRSYNLQAA 1225


>UniRef50_Q4T1G3 Cluster: Chromosome undetermined SCAF10611, whole
           genome shotgun sequence; n=2; Tetraodontidae|Rep:
           Chromosome undetermined SCAF10611, whole genome shotgun
           sequence - Tetraodon nigroviridis (Green puffer)
          Length = 266

 Score = 44.0 bits (99), Expect = 0.001
 Identities = 19/50 (38%), Positives = 27/50 (54%)
 Frame = -3

Query: 277 RRREQNARGHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFI 128
           R   +   G L KRG  +K WK+RWF+ D+   +L YY   ++   KG I
Sbjct: 155 RLTSRRCAGFLTKRGGRVKTWKKRWFLFDTEHRRLAYYTDCDERKLKGVI 204


>UniRef50_Q4SFN1 Cluster: Chromosome 7 SCAF14601, whole genome shotgun
            sequence; n=2; Tetraodontidae|Rep: Chromosome 7
            SCAF14601, whole genome shotgun sequence - Tetraodon
            nigroviridis (Green puffer)
          Length = 1252

 Score = 44.0 bits (99), Expect = 0.001
 Identities = 18/47 (38%), Positives = 25/47 (53%)
 Frame = -3

Query: 268  EQNARGHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFI 128
            ++  RG L K G  +K WK+RWFV D  +    YY    ++  KG I
Sbjct: 1096 DKTCRGFLVKMGGKIKTWKKRWFVFDQNRRTFTYYADKHETKMKGVI 1142


>UniRef50_Q55EZ5 Cluster: Putative uncharacterized protein; n=1;
           Dictyostelium discoideum AX4|Rep: Putative
           uncharacterized protein - Dictyostelium discoideum AX4
          Length = 331

 Score = 44.0 bits (99), Expect = 0.001
 Identities = 28/83 (33%), Positives = 46/83 (55%), Gaps = 1/83 (1%)
 Frame = -3

Query: 253 GHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDLAEVIAVTQATPAPGPP 74
           G+LYK+G + K W++RW +L S   +L Y+    + H  GF+DL + I + Q+       
Sbjct: 13  GNLYKKGKINKSWQKRWCML-SKDSKLFYHKQANEKH-SGFVDLRQCI-IKQS------- 62

Query: 73  KKCDDR-SFFDLRTSRRTYNFCA 8
             C ++ + F++ TS R Y F A
Sbjct: 63  -DCTEKENIFEINTSNRIYLFSA 84


>UniRef50_A6R389 Cluster: Putative uncharacterized protein; n=1;
            Ajellomyces capsulatus NAm1|Rep: Putative uncharacterized
            protein - Ajellomyces capsulatus NAm1
          Length = 1689

 Score = 44.0 bits (99), Expect = 0.001
 Identities = 25/68 (36%), Positives = 37/68 (54%), Gaps = 1/68 (1%)
 Frame = -3

Query: 253  GHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGF-IDLAEVIAVTQATPAPGP 77
            G+L KRG    GWK R+FVLD    +L+YY++    H     I  A++   +Q+T +   
Sbjct: 1023 GYLTKRGKNFGGWKARYFVLDG--PELKYYESPSGPHMGTIKIHHAQIGKQSQSTNSSQS 1080

Query: 76   PKKCDDRS 53
            P + DD S
Sbjct: 1081 PSRLDDES 1088


>UniRef50_Q559C4 Cluster: Putative uncharacterized protein; n=2;
           Dictyostelium discoideum|Rep: Putative uncharacterized
           protein - Dictyostelium discoideum AX4
          Length = 264

 Score = 42.3 bits (95), Expect = 0.003
 Identities = 30/84 (35%), Positives = 44/84 (52%), Gaps = 1/84 (1%)
 Frame = -3

Query: 253 GHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDLAEVIAVTQATPAPGPP 74
           G + K+G  +K WK+RW VL+  +  L Y+ + + S  KG I LAE+I+V       G  
Sbjct: 18  GSVIKQGGRIKNWKKRWCVLN--EEGLHYFKS-QHSIEKGSILLAEIISV------EGDD 68

Query: 73  KKCDDRSF-FDLRTSRRTYNFCAS 5
           K    R + F + T  R Y  CA+
Sbjct: 69  KPATKRKYCFKVTTIDRKYRICAT 92


>UniRef50_Q54GT8 Cluster: Putative uncharacterized protein; n=1;
           Dictyostelium discoideum AX4|Rep: Putative
           uncharacterized protein - Dictyostelium discoideum AX4
          Length = 904

 Score = 42.3 bits (95), Expect = 0.003
 Identities = 20/51 (39%), Positives = 33/51 (64%), Gaps = 1/51 (1%)
 Frame = -3

Query: 253 GHLYKRGALLKGWKQRWFVL-DSIKHQLRYYDAMEDSHCKGFIDLAEVIAV 104
           G+L+K+G   K W++RWFVL D+I   L YY + +D+   G I + E++ +
Sbjct: 419 GYLFKKGHNFKSWRRRWFVLKDNI---LSYYKSPKDTAPAGIIPINEIVNI 466


>UniRef50_UPI00001E4311 Cluster: pleckstrin homology-like domain,
           family B, member 3; n=11; Eutheria|Rep: pleckstrin
           homology-like domain, family B, member 3 - Mus musculus
          Length = 648

 Score = 41.9 bits (94), Expect = 0.004
 Identities = 18/43 (41%), Positives = 24/43 (55%)
 Frame = -3

Query: 256 RGHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFI 128
           RG L K G  +K W++RWF  D    +L YY   E++  KG I
Sbjct: 544 RGPLVKMGGRIKTWRKRWFCFDRQARRLAYYADKEETKLKGVI 586


>UniRef50_UPI0000F1F7CC Cluster: PREDICTED: similar to TBC1 domain
           family, member 2,; n=2; Danio rerio|Rep: PREDICTED:
           similar to TBC1 domain family, member 2, - Danio rerio
          Length = 222

 Score = 41.5 bits (93), Expect = 0.006
 Identities = 19/44 (43%), Positives = 24/44 (54%)
 Frame = -3

Query: 253 GHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDL 122
           G+L K+G  LK WK RWF  +    QL YY    D +  G +DL
Sbjct: 60  GYLNKQGGPLKTWKSRWFAYEEKSCQLFYYRMAHDINSLGKVDL 103


>UniRef50_UPI000049A032 Cluster: PH domain protein; n=1; Entamoeba
           histolytica HM-1:IMSS|Rep: PH domain protein - Entamoeba
           histolytica HM-1:IMSS
          Length = 654

 Score = 41.5 bits (93), Expect = 0.006
 Identities = 20/58 (34%), Positives = 31/58 (53%)
 Frame = -3

Query: 241 KRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDLAEVIAVTQATPAPGPPKK 68
           K+G  +K WK+RWFVL   +  L Y+ A   +  +G+I+L     + + T    P KK
Sbjct: 25  KQGGSVKNWKKRWFVLKPTR--LWYFKAKNSTSAQGYIELTPQTTIQEETGMNVPGKK 80


>UniRef50_UPI00015A7043 Cluster: UPI00015A7043 related cluster; n=1;
           Danio rerio|Rep: UPI00015A7043 UniRef100 entry - Danio
           rerio
          Length = 384

 Score = 41.5 bits (93), Expect = 0.006
 Identities = 19/44 (43%), Positives = 24/44 (54%)
 Frame = -3

Query: 253 GHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDL 122
           G+L K+G  LK WK RWF  +    QL YY    D +  G +DL
Sbjct: 4   GYLNKQGGPLKTWKSRWFAYEEKSCQLFYYRMAHDINSLGKVDL 47


>UniRef50_Q54ND2 Cluster: RhoGEF domain-containing protein; n=1;
            Dictyostelium discoideum AX4|Rep: RhoGEF
            domain-containing protein - Dictyostelium discoideum AX4
          Length = 1377

 Score = 41.5 bits (93), Expect = 0.006
 Identities = 19/49 (38%), Positives = 29/49 (59%)
 Frame = -3

Query: 256  RGHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDLAEVI 110
            +G+L K+GA+ + W +RWFVL   +  L Y+   +D   KG I L  V+
Sbjct: 1283 QGYLTKKGAMRRNWTKRWFVLK--QGYLFYFKTSKDKKPKGIIQLTNVV 1329


>UniRef50_UPI0000498D8F Cluster: protein kinase; n=2; Entamoeba
           histolytica HM-1:IMSS|Rep: protein kinase - Entamoeba
           histolytica HM-1:IMSS
          Length = 479

 Score = 41.1 bits (92), Expect = 0.007
 Identities = 19/45 (42%), Positives = 27/45 (60%)
 Frame = -3

Query: 253 GHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDLA 119
           G + KRG +++ W QRWFVL    + + YY   +  H KG+I LA
Sbjct: 22  GFMVKRGHIVRNWLQRWFVL---TNDILYYFDEQKLHLKGYIPLA 63


>UniRef50_Q0J5L5 Cluster: Os08g0425100 protein; n=2; Oryza sativa
           (japonica cultivar-group)|Rep: Os08g0425100 protein -
           Oryza sativa subsp. japonica (Rice)
          Length = 766

 Score = 41.1 bits (92), Expect = 0.007
 Identities = 18/46 (39%), Positives = 25/46 (54%)
 Frame = -3

Query: 253 GHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDLAE 116
           G L+K+ A    W  RWFVL+    +L Y    E+ H +G I+L E
Sbjct: 557 GFLFKKRAKANDWSNRWFVLNERSGKLGYTKKQEERHFRGVINLEE 602


>UniRef50_Q9H4E7 Cluster: Differentially expressed in FDCP 6; n=26;
           Euteleostomi|Rep: Differentially expressed in FDCP 6 -
           Homo sapiens (Human)
          Length = 631

 Score = 41.1 bits (92), Expect = 0.007
 Identities = 32/102 (31%), Positives = 47/102 (46%)
 Frame = -3

Query: 310 LSTIL*TVLVERRREQNARGHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGF 131
           LS  +  V  E  ++   +G+L+KRG L + W +RWF L      L Y+ + E    +G 
Sbjct: 202 LSMAIHEVYQELIQDVLKQGYLWKRGHLRRNWAERWFQLQ--PSCLCYFGSEECKEKRGI 259

Query: 130 IDLAEVIAVTQATPAPGPPKKCDDRSFFDLRTSRRTYNFCAS 5
           I L     V       G  K+C     F ++T+ RTY   AS
Sbjct: 260 IPLDAHCCVEVLPDRDG--KRC----MFCVKTANRTYEMSAS 295


>UniRef50_Q4SA95 Cluster: Chromosome 19 SCAF14691, whole genome
           shotgun sequence; n=5; Clupeocephala|Rep: Chromosome 19
           SCAF14691, whole genome shotgun sequence - Tetraodon
           nigroviridis (Green puffer)
          Length = 570

 Score = 40.7 bits (91), Expect = 0.010
 Identities = 26/103 (25%), Positives = 47/103 (45%), Gaps = 2/103 (1%)
 Frame = -3

Query: 307 STIL*TVLVERRREQNARGHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFI 128
           S  L  V +E       RG+++K+G + + W +RWFVL     +    + ++D   +  +
Sbjct: 198 SLALDEVFLEMYHNVLKRGYMWKKGHVRRNWTERWFVLKPSSIEYFVSEDLKDKRGEVKL 257

Query: 127 DLAEVIAVTQATPAP--GPPKKCDDRSFFDLRTSRRTYNFCAS 5
           D   V+ V +    P    P +   R  F ++T  +T+   AS
Sbjct: 258 DKNCVVEVGKEMQRPVFPVPDRDGKRCMFCVKTHNKTFEISAS 300


>UniRef50_Q96C94 Cluster: PHLDB1 protein; n=6; Euteleostomi|Rep:
           PHLDB1 protein - Homo sapiens (Human)
          Length = 101

 Score = 40.7 bits (91), Expect = 0.010
 Identities = 16/36 (44%), Positives = 21/36 (58%)
 Frame = -3

Query: 235 GALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFI 128
           G  +K WK+RWFV D +K  L YY    ++  KG I
Sbjct: 2   GGKIKSWKKRWFVFDRLKRTLSYYVDKHETKLKGVI 37


>UniRef50_Q5U3N0 Cluster: Pleckstrin homology domain-containing
           family A member 8; n=5; Clupeocephala|Rep: Pleckstrin
           homology domain-containing family A member 8 - Danio
           rerio (Zebrafish) (Brachydanio rerio)
          Length = 549

 Score = 40.7 bits (91), Expect = 0.010
 Identities = 21/47 (44%), Positives = 28/47 (59%), Gaps = 2/47 (4%)
 Frame = -3

Query: 253 GHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDS--HCKGFIDLA 119
           G LYK    + GW+ RWFVL+     L YYD+ ED+   CKG I ++
Sbjct: 3   GVLYKWTNYISGWQPRWFVLEG--GTLSYYDSQEDAWKGCKGSIKIS 47


>UniRef50_UPI0000ECC2F9 Cluster: TBC1 domain family member 2
           (Prostate antigen recognized and identified by SEREX)
           (PARIS-1).; n=2; Gallus gallus|Rep: TBC1 domain family
           member 2 (Prostate antigen recognized and identified by
           SEREX) (PARIS-1). - Gallus gallus
          Length = 807

 Score = 40.3 bits (90), Expect = 0.013
 Identities = 27/84 (32%), Positives = 38/84 (45%), Gaps = 2/84 (2%)
 Frame = -3

Query: 253 GHLYKRGAL--LKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDLAEVIAVTQATPAPG 80
           G+L K G    +K WK RWF+ D  K  L YY   +D +  G IDL+      +A     
Sbjct: 51  GYLNKLGIRGPIKTWKSRWFIYDENKCHLLYYRTAQDINPLGSIDLSTACFDCKAE---- 106

Query: 79  PPKKCDDRSFFDLRTSRRTYNFCA 8
                +D   F++RT  R +   A
Sbjct: 107 -----NDEGVFEIRTPNRVFTLKA 125


>UniRef50_Q7SHT9 Cluster: Putative uncharacterized protein
           NCU02524.1; n=2; Sordariomycetes|Rep: Putative
           uncharacterized protein NCU02524.1 - Neurospora crassa
          Length = 1464

 Score = 40.3 bits (90), Expect = 0.013
 Identities = 22/53 (41%), Positives = 31/53 (58%)
 Frame = -3

Query: 256 RGHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDLAEVIAVTQ 98
           +G+L KRG    GWK R+F+LDS    L+YY+    +H  G I L +   +TQ
Sbjct: 844 KGYLTKRGKNFGGWKARYFILDS--PHLKYYETPGGAHL-GTIKLQKAQIMTQ 893


>UniRef50_Q9W5D0 Cluster: Uncharacterized protein CG12467; n=3;
           Diptera|Rep: Uncharacterized protein CG12467 -
           Drosophila melanogaster (Fruit fly)
          Length = 1561

 Score = 40.3 bits (90), Expect = 0.013
 Identities = 24/58 (41%), Positives = 31/58 (53%), Gaps = 2/58 (3%)
 Frame = -3

Query: 253 GHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCK--GFIDLAEVIAVTQATPA 86
           GHL K G  LK W++RWFVL +    L Y+ +  D   K  G I L EV  + +A  A
Sbjct: 655 GHLAKLGGKLKTWRKRWFVLKN--GSLNYWKSQHDVQRKPQGQIQLDEVCRINRAEGA 710


>UniRef50_Q9U2C7 Cluster: Oxysterol-binding protein; n=5;
           Bilateria|Rep: Oxysterol-binding protein -
           Caenorhabditis elegans
          Length = 766

 Score = 39.9 bits (89), Expect = 0.017
 Identities = 24/55 (43%), Positives = 29/55 (52%), Gaps = 1/55 (1%)
 Frame = -3

Query: 253 GHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSH-CKGFIDLAEVIAVTQAT 92
           G L K    LKG++QRWFVLDS      Y +  E  H C+G I+L E    T  T
Sbjct: 65  GWLNKWTNYLKGYRQRWFVLDSNATLSYYRNPSEVGHTCRGSINLQEARVHTDKT 119


>UniRef50_Q9HB20 Cluster: Pleckstrin homology domain-containing
           family A member 3; n=22; Euteleostomi|Rep: Pleckstrin
           homology domain-containing family A member 3 - Homo
           sapiens (Human)
          Length = 300

 Score = 39.9 bits (89), Expect = 0.017
 Identities = 21/40 (52%), Positives = 25/40 (62%)
 Frame = -3

Query: 253 GHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKG 134
           G LYK    L GW+ RWFVLD+    L YYD+ +D  CKG
Sbjct: 3   GVLYKWTNYLTGWQPRWFVLDN--GILSYYDSQDDV-CKG 39


>UniRef50_Q9LQ55 Cluster: Dynamin-2B; n=25; Magnoliophyta|Rep:
           Dynamin-2B - Arabidopsis thaliana (Mouse-ear cress)
          Length = 920

 Score = 39.9 bits (89), Expect = 0.017
 Identities = 17/46 (36%), Positives = 26/46 (56%)
 Frame = -3

Query: 253 GHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDLAE 116
           G+L K+ A   GW +RWFVL+    +L Y    E+ + +G + L E
Sbjct: 584 GYLMKKSAKTNGWSRRWFVLNEKTGKLGYTKKQEERNFRGTVTLEE 629


>UniRef50_UPI0000F1E8B1 Cluster: PREDICTED: similar to Tandem PH
           Domain Containing Protein-2; n=1; Danio rerio|Rep:
           PREDICTED: similar to Tandem PH Domain Containing
           Protein-2 - Danio rerio
          Length = 566

 Score = 39.5 bits (88), Expect = 0.023
 Identities = 30/94 (31%), Positives = 46/94 (48%), Gaps = 6/94 (6%)
 Frame = -3

Query: 283 VERRREQNAR------GHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDL 122
           V  RR Q+AR      G+  K+G + K WK+R+F+LD     + YY +  D      I L
Sbjct: 349 VPLRRCQSARPNALRSGYCVKQGNVRKSWKRRFFILDD--QTVSYYKSEMDKEPLRSIRL 406

Query: 121 AEVIAVTQATPAPGPPKKCDDRSFFDLRTSRRTY 20
            +V+ V +     G     D  + F++ TS RT+
Sbjct: 407 RDVLKVNECLVKSGDLLSRD--NLFEIITSARTF 438


>UniRef50_UPI0000499868 Cluster: protein kinase; n=1; Entamoeba
           histolytica HM-1:IMSS|Rep: protein kinase - Entamoeba
           histolytica HM-1:IMSS
          Length = 441

 Score = 39.5 bits (88), Expect = 0.023
 Identities = 30/84 (35%), Positives = 35/84 (41%), Gaps = 1/84 (1%)
 Frame = -3

Query: 253 GHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDLAEVIAVTQATPAPGPP 74
           G L K+G   K WK RWFVLD     L YY         G IDL    A+      P   
Sbjct: 5   GWLAKQGGGWKNWKHRWFVLDGT--TLTYYKDQLRMKKMGEIDLMLAFAI-----VPNEE 57

Query: 73  KKCDDRSF-FDLRTSRRTYNFCAS 5
            K  +  + F + T  R YN  AS
Sbjct: 58  LKLKNFPYIFSISTPSRVYNISAS 81


>UniRef50_A7SVA1 Cluster: Predicted protein; n=1; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 390

 Score = 39.5 bits (88), Expect = 0.023
 Identities = 20/60 (33%), Positives = 31/60 (51%)
 Frame = -3

Query: 271 REQNARGHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDLAEVIAVTQAT 92
           R +   G+L K+G +   WK RWFVL     +L Y+   E++   G++DL     V+  T
Sbjct: 6   RRKIKEGYLVKKGHVRHNWKTRWFVL--YDEKLCYFKKKEETDPAGWVDLLGCFIVSPCT 63


>UniRef50_Q0UWA1 Cluster: Putative uncharacterized protein; n=1;
            Phaeosphaeria nodorum|Rep: Putative uncharacterized
            protein - Phaeosphaeria nodorum (Septoria nodorum)
          Length = 1507

 Score = 39.5 bits (88), Expect = 0.023
 Identities = 26/73 (35%), Positives = 36/73 (49%), Gaps = 2/73 (2%)
 Frame = -3

Query: 274  RREQNARGHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDL--AEVIAVT 101
            +  Q   G+L KRG    GWK R+FVLD    + RYY+    +H  G I L  A++   +
Sbjct: 873  KTRQRKEGYLTKRGKNFGGWKARFFVLDG--PEFRYYEVEGGAHL-GTIKLQNAQIGKQS 929

Query: 100  QATPAPGPPKKCD 62
            Q      P +K D
Sbjct: 930  QQQSNQSPQRKDD 942


>UniRef50_UPI0000E81979 Cluster: PREDICTED: similar to RIKEN cDNA
            2610034M16 gene; n=3; Gallus gallus|Rep: PREDICTED:
            similar to RIKEN cDNA 2610034M16 gene - Gallus gallus
          Length = 1300

 Score = 39.1 bits (87), Expect = 0.030
 Identities = 21/40 (52%), Positives = 27/40 (67%), Gaps = 4/40 (10%)
 Frame = -3

Query: 256  RGHLYKR--GALLKGWKQRWFVLDSIKHQ--LRYYDAMED 149
            RG+L+KR   A+LKGW++RWFVL   KH   L YY   +D
Sbjct: 1058 RGYLHKRTQSAILKGWRKRWFVL---KHNGYLHYYKHKKD 1094


>UniRef50_Q4RMM8 Cluster: Chromosome 10 SCAF15019, whole genome
            shotgun sequence; n=10; Euteleostomi|Rep: Chromosome 10
            SCAF15019, whole genome shotgun sequence - Tetraodon
            nigroviridis (Green puffer)
          Length = 2087

 Score = 39.1 bits (87), Expect = 0.030
 Identities = 23/56 (41%), Positives = 29/56 (51%), Gaps = 5/56 (8%)
 Frame = -3

Query: 274  RREQNARGHLYKRGALL-----KGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDL 122
            ++E    G LYK+G  L     + WK RWFVL   K  L YYD   +   KG ID+
Sbjct: 1228 KQESLKSGWLYKKGGGLSTLSRRNWKMRWFVLRDSK--LMYYDNDSEEKLKGTIDI 1281


>UniRef50_Q54KA7 Cluster: SecG; n=2; Dictyostelium discoideum|Rep:
           SecG - Dictyostelium discoideum AX4
          Length = 986

 Score = 39.1 bits (87), Expect = 0.030
 Identities = 19/49 (38%), Positives = 28/49 (57%)
 Frame = -3

Query: 256 RGHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDLAEVI 110
           +G L K+G  +K WK+RWF+L +  + L YY   +D    G I L  V+
Sbjct: 788 KGWLTKQGGRIKTWKKRWFILTA--NCLLYYKTPQDHEPCGIIPLENVV 834


>UniRef50_A7SNK8 Cluster: Predicted protein; n=1; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 1867

 Score = 39.1 bits (87), Expect = 0.030
 Identities = 22/60 (36%), Positives = 32/60 (53%), Gaps = 5/60 (8%)
 Frame = -3

Query: 274 RREQNARGHLYKRGALL--KGWKQRWFVLDSIKHQLRYY---DAMEDSHCKGFIDLAEVI 110
           R  ++  G+LYK+G     KGWK+RWFV D     L+YY   D+ E  H      + +V+
Sbjct: 759 RNLRSTSGYLYKQGGRQNNKGWKKRWFVFDGT--SLKYYTNKDSQESLHIIPVTQMKDVL 816



 Score = 36.3 bits (80), Expect = 0.21
 Identities = 23/55 (41%), Positives = 29/55 (52%), Gaps = 1/55 (1%)
 Frame = -3

Query: 253  GHLY-KRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDLAEVIAVTQAT 92
            G+LY K GA+    K+RWF       QL+YY    D    G IDLA V ++T  T
Sbjct: 1200 GYLYRKEGAM----KKRWFTFKD--RQLKYYRGCGDKEPMGVIDLANVTSLTMNT 1248


>UniRef50_UPI000049A465 Cluster: hypothetical protein 249.t00015;
           n=1; Entamoeba histolytica HM-1:IMSS|Rep: hypothetical
           protein 249.t00015 - Entamoeba histolytica HM-1:IMSS
          Length = 338

 Score = 38.7 bits (86), Expect = 0.039
 Identities = 27/80 (33%), Positives = 36/80 (45%), Gaps = 1/80 (1%)
 Frame = -3

Query: 256 RGHLYKRGALLKGWKQRWF-VLDSIKHQLRYYDAMEDSHCKGFIDLAEVIAVTQATPAPG 80
           RG + K+G   K WK+RWF        +L YY     S  KG ID+++   VT       
Sbjct: 14  RGWVTKQGGSHKSWKKRWFQTTPRNPFRLDYYTNDSCSSLKGHIDMSQ---VTDMITTRN 70

Query: 79  PPKKCDDRSFFDLRTSRRTY 20
             K    R  F L T +RT+
Sbjct: 71  KDKDGSMRYGFQLVTEKRTW 90


>UniRef50_UPI00004991C3 Cluster: protein kinase; n=1; Entamoeba
           histolytica HM-1:IMSS|Rep: protein kinase - Entamoeba
           histolytica HM-1:IMSS
          Length = 377

 Score = 38.7 bits (86), Expect = 0.039
 Identities = 17/53 (32%), Positives = 30/53 (56%)
 Frame = -3

Query: 268 EQNARGHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDLAEVI 110
           +Q   G++ K G+ +K WK+RWFV  +    + YY   +++  KG +D+   I
Sbjct: 5   KQIQTGYIVKEGSNVKSWKKRWFVF-TTDGNISYYTNRQETCKKGEVDMRHAI 56


>UniRef50_Q29FP2 Cluster: GA11650-PA; n=2; pseudoobscura
           subgroup|Rep: GA11650-PA - Drosophila pseudoobscura
           (Fruit fly)
          Length = 1621

 Score = 38.7 bits (86), Expect = 0.039
 Identities = 23/58 (39%), Positives = 30/58 (51%), Gaps = 2/58 (3%)
 Frame = -3

Query: 253 GHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCK--GFIDLAEVIAVTQATPA 86
           GHL K G  LK W++RWFVL +    L Y+ +  D   K  G I L E   + +A  A
Sbjct: 753 GHLAKLGGKLKTWRKRWFVLKN--GSLNYWKSQHDVQRKPQGQIQLDEACRINRAEGA 808


>UniRef50_Q0E8N2 Cluster: CG11628-PB, isoform B; n=4;
           Endopterygota|Rep: CG11628-PB, isoform B - Drosophila
           melanogaster (Fruit fly)
          Length = 488

 Score = 38.7 bits (86), Expect = 0.039
 Identities = 17/47 (36%), Positives = 27/47 (57%)
 Frame = -3

Query: 253 GHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDLAEV 113
           G L+K+G   K WK+RWF+L+   + L Y++   D   +G I L  +
Sbjct: 359 GWLWKQGGRYKSWKRRWFILND--NCLYYFEYTTDKEPRGIIPLENI 403


>UniRef50_Q9BXB5 Cluster: Oxysterol-binding protein-related protein
           10; n=27; Euteleostomi|Rep: Oxysterol-binding
           protein-related protein 10 - Homo sapiens (Human)
          Length = 764

 Score = 38.7 bits (86), Expect = 0.039
 Identities = 26/67 (38%), Positives = 36/67 (53%), Gaps = 2/67 (2%)
 Frame = -3

Query: 277 RRREQNARGHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCK--GFIDLAEVIAV 104
           RRRE    G L K   LL+GW+ R+FVLD     L+Y+   +  H K  G + L+  I V
Sbjct: 71  RRREPALEGVLSKYTNLLQGWQNRYFVLDFEAGILQYFVNEQSKHQKPRGVLSLSGAI-V 129

Query: 103 TQATPAP 83
           + +  AP
Sbjct: 130 SLSDEAP 136


>UniRef50_Q9UN19 Cluster: Dual adapter for phosphotyrosine and
           3-phosphotyrosine and 3- phosphoinositide; n=25;
           Euteleostomi|Rep: Dual adapter for phosphotyrosine and
           3-phosphotyrosine and 3- phosphoinositide - Homo sapiens
           (Human)
          Length = 280

 Score = 38.7 bits (86), Expect = 0.039
 Identities = 19/50 (38%), Positives = 28/50 (56%)
 Frame = -3

Query: 253 GHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDLAEVIAV 104
           G+L K+G L+K WK RWF L   +++L+Y+           +DL E  AV
Sbjct: 169 GYLTKQGGLVKTWKTRWFTLH--RNELKYFKDQMSPEPIRILDLTECSAV 216


>UniRef50_UPI0000499E4A Cluster: PH domain protein; n=2; Entamoeba
           histolytica HM-1:IMSS|Rep: PH domain protein - Entamoeba
           histolytica HM-1:IMSS
          Length = 469

 Score = 38.3 bits (85), Expect = 0.052
 Identities = 21/56 (37%), Positives = 30/56 (53%)
 Frame = -3

Query: 289 VLVERRREQNARGHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDL 122
           + VE  R     G   K+G  +K WK+RWFVL    ++L Y+ +      KGFI+L
Sbjct: 7   ISVESLRPALFEGWGKKQGGSVKTWKKRWFVLKD--NRLWYFASKTAEEAKGFIEL 60


>UniRef50_Q5KHK2 Cluster: PH (Pleckstrin homology) domain-containing
           protein, putative; n=1; Filobasidiella neoformans|Rep:
           PH (Pleckstrin homology) domain-containing protein,
           putative - Cryptococcus neoformans (Filobasidiella
           neoformans)
          Length = 705

 Score = 38.3 bits (85), Expect = 0.052
 Identities = 20/50 (40%), Positives = 29/50 (58%)
 Frame = -3

Query: 253 GHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDLAEVIAV 104
           G+LYK+    + WK+RWFVL + K  L YY   ++   K  I+L E+  V
Sbjct: 154 GYLYKKQEKRRAWKKRWFVLRNEK--LAYYKDDKEYSLKRVINLREIHTV 201


>UniRef50_Q4PIB1 Cluster: Putative uncharacterized protein; n=1;
           Ustilago maydis|Rep: Putative uncharacterized protein -
           Ustilago maydis (Smut fungus)
          Length = 738

 Score = 38.3 bits (85), Expect = 0.052
 Identities = 20/50 (40%), Positives = 29/50 (58%)
 Frame = -3

Query: 253 GHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDLAEVIAV 104
           G+L K+G   K WK+RW+VL S K  L YY   ++     FID+ ++  V
Sbjct: 71  GYLEKKGEKRKTWKKRWWVLRSSK--LAYYKNDKEYQLLRFIDVGDIKTV 118


>UniRef50_Q96JA3 Cluster: Pleckstrin homology domain-containing
           family A member 8; n=29; Coelomata|Rep: Pleckstrin
           homology domain-containing family A member 8 - Homo
           sapiens (Human)
          Length = 519

 Score = 38.3 bits (85), Expect = 0.052
 Identities = 22/47 (46%), Positives = 27/47 (57%), Gaps = 2/47 (4%)
 Frame = -3

Query: 253 GHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDS--HCKGFIDLA 119
           G LYK    L GW+ RWF+L      L YYD+ ED+   CKG I +A
Sbjct: 3   GVLYKWTNYLSGWQPRWFLL--CGGILSYYDSPEDAWKGCKGSIQMA 47


>UniRef50_UPI0000F20D7C Cluster: PREDICTED: hypothetical protein;
           n=2; Danio rerio|Rep: PREDICTED: hypothetical protein -
           Danio rerio
          Length = 456

 Score = 37.9 bits (84), Expect = 0.069
 Identities = 23/82 (28%), Positives = 38/82 (46%)
 Frame = -3

Query: 253 GHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDLAEVIAVTQATPAPGPP 74
           G+L+K+G L + W +RWF L        YY + +   C+G I++     V       G  
Sbjct: 218 GYLWKKGHLRRNWTERWFCLK--PGSFSYYVSEDARDCRGVIEMDHNCCVEVLPDRDG-- 273

Query: 73  KKCDDRSFFDLRTSRRTYNFCA 8
           K+C     F ++T  +T+   A
Sbjct: 274 KRC----MFCVKTLNKTFEISA 291


>UniRef50_Q9NGQ2 Cluster: Kinesin Unc104/KIF1a homolog; n=2;
            Dictyostelium discoideum|Rep: Kinesin Unc104/KIF1a
            homolog - Dictyostelium discoideum (Slime mold)
          Length = 2205

 Score = 37.9 bits (84), Expect = 0.069
 Identities = 22/59 (37%), Positives = 30/59 (50%), Gaps = 1/59 (1%)
 Frame = -3

Query: 271  REQNARGHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDLA-EVIAVTQ 98
            +E    G+L K+ A  + WK RWFV    K  L Y    +D+H    IDL    +A+TQ
Sbjct: 1522 KEDETSGYLKKKSAFKEEWKPRWFVFK--KPYLYYSHNQKDTHKLKKIDLTNSSVAITQ 1578


>UniRef50_Q86EH8 Cluster: Clone ZZD379 mRNA sequence; n=2;
           Schistosoma japonicum|Rep: Clone ZZD379 mRNA sequence -
           Schistosoma japonicum (Blood fluke)
          Length = 235

 Score = 37.9 bits (84), Expect = 0.069
 Identities = 23/74 (31%), Positives = 33/74 (44%), Gaps = 1/74 (1%)
 Frame = -3

Query: 226 LKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDLAEVIA-VTQATPAPGPPKKCDDRSF 50
           L+ WK  W VL     +LRY+++ +D   K  I++  V   +        PPK       
Sbjct: 20  LRRWKPAWLVLYG-NGELRYFESRDDYVAKATINVPRVCEKILSGHRNIDPPKDRSIECI 78

Query: 49  FDLRTSRRTYNFCA 8
           F LRT    + FCA
Sbjct: 79  FGLRTHESDWYFCA 92


>UniRef50_Q0PIM9 Cluster: TAPP1; n=1; Branchiostoma belcheri
           tsingtauense|Rep: TAPP1 - Branchiostoma belcheri
           tsingtauense
          Length = 320

 Score = 37.9 bits (84), Expect = 0.069
 Identities = 20/54 (37%), Positives = 30/54 (55%)
 Frame = -3

Query: 253 GHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDLAEVIAVTQAT 92
           G   K+GA++K WK+R+FVLD     L YY +  D+     I L +++ V   T
Sbjct: 187 GFCVKQGAVVKNWKRRYFVLD--HEGLSYYKSNTDTDPIKMISLLDILHVKSYT 238


>UniRef50_A2FE94 Cluster: PH domain containing protein; n=1;
           Trichomonas vaginalis G3|Rep: PH domain containing
           protein - Trichomonas vaginalis G3
          Length = 1728

 Score = 37.9 bits (84), Expect = 0.069
 Identities = 20/44 (45%), Positives = 27/44 (61%)
 Frame = -3

Query: 253 GHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDL 122
           G+L K G L+K WK+RWFVL      L YY+  ++   KG I+L
Sbjct: 8   GYLQKDGGLIKTWKKRWFVLKG--KMLLYYEE-KNGALKGEIEL 48


>UniRef50_Q9BYX2 Cluster: TBC1 domain family member 2; n=36;
           Euteleostomi|Rep: TBC1 domain family member 2 - Homo
           sapiens (Human)
          Length = 917

 Score = 37.9 bits (84), Expect = 0.069
 Identities = 21/60 (35%), Positives = 30/60 (50%), Gaps = 2/60 (3%)
 Frame = -3

Query: 253 GHLYKRGAL--LKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDLAEVIAVTQATPAPG 80
           G+L K G    ++GWK RWF  D  K QL Y    +D++    IDL+  +   +A    G
Sbjct: 50  GYLSKFGGKGPIRGWKSRWFFYDERKCQLYYSRTAQDANPLDSIDLSSAVFDCKADAEEG 109


>UniRef50_P34512 Cluster: GTP exchange factor for ARFs 1; n=3;
           Caenorhabditis|Rep: GTP exchange factor for ARFs 1 -
           Caenorhabditis elegans
          Length = 393

 Score = 37.9 bits (84), Expect = 0.069
 Identities = 21/41 (51%), Positives = 25/41 (60%)
 Frame = -3

Query: 235 GALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDLAEV 113
           GAL   WK+RWFVL   ++ L Y+D M D   KG I LA V
Sbjct: 279 GAL--SWKKRWFVLS--ENCLYYFDQMTDKEPKGIITLANV 315


>UniRef50_UPI00004999BB Cluster: protein kinase; n=3; Entamoeba
           histolytica HM-1:IMSS|Rep: protein kinase - Entamoeba
           histolytica HM-1:IMSS
          Length = 420

 Score = 37.5 bits (83), Expect = 0.091
 Identities = 16/45 (35%), Positives = 27/45 (60%)
 Frame = -3

Query: 256 RGHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDL 122
           RG + K G+ +K WK+RWFV  +    L Y+   +++  KG +D+
Sbjct: 7   RGVMIKEGSKVKNWKKRWFVFHN-NGMLDYFTDKKETDQKGSVDM 50


>UniRef50_UPI000065EBFA Cluster: UPI000065EBFA related cluster; n=1;
           Takifugu rubripes|Rep: UPI000065EBFA UniRef100 entry -
           Takifugu rubripes
          Length = 919

 Score = 37.1 bits (82), Expect = 0.12
 Identities = 15/23 (65%), Positives = 19/23 (82%), Gaps = 2/23 (8%)
 Frame = -3

Query: 256 RGHLYKR--GALLKGWKQRWFVL 194
           RG+LYKR    L+KGW++RWFVL
Sbjct: 744 RGYLYKRTQSGLIKGWRKRWFVL 766


>UniRef50_Q5DGD2 Cluster: SJCHGC01551 protein; n=1; Schistosoma
           japonicum|Rep: SJCHGC01551 protein - Schistosoma
           japonicum (Blood fluke)
          Length = 253

 Score = 37.1 bits (82), Expect = 0.12
 Identities = 19/50 (38%), Positives = 30/50 (60%), Gaps = 1/50 (2%)
 Frame = -3

Query: 256 RGHLYKRGALLKGWKQRWFVL-DSIKHQLRYYDAMEDSHCKGFIDLAEVI 110
           +G+LYK    +KG+++RWFVL D +    R    M  + C+G I+LA  +
Sbjct: 2   KGYLYKWTNYIKGYQKRWFVLQDGLVSYYRNQSEMAHT-CRGTINLANAV 50


>UniRef50_Q0IEU3 Cluster: Centaurin alpha; n=4; Endopterygota|Rep:
           Centaurin alpha - Aedes aegypti (Yellowfever mosquito)
          Length = 384

 Score = 37.1 bits (82), Expect = 0.12
 Identities = 31/81 (38%), Positives = 38/81 (46%), Gaps = 2/81 (2%)
 Frame = -3

Query: 253 GHLYKRGA-LLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDLAEVIAVTQATPAPGP 77
           G L K G      +KQRWF LD  K  L Y+D   D++ KG I L     +   +   G 
Sbjct: 257 GWLLKTGPRTTDSYKQRWFTLDDRK--LMYHDDPLDANPKGEIFLGN--HLDGYSVRIGA 312

Query: 76  PKKCDDRSF-FDLRTSRRTYN 17
           P    D+ F F L T  RTYN
Sbjct: 313 PVGAKDQGFSFTLFTPERTYN 333


>UniRef50_Q10FJ2 Cluster: Pleckstriny domain-containing protein,
           putative, expressed; n=6; Oryza sativa|Rep: Pleckstriny
           domain-containing protein, putative, expressed - Oryza
           sativa subsp. japonica (Rice)
          Length = 393

 Score = 36.7 bits (81), Expect = 0.16
 Identities = 24/85 (28%), Positives = 38/85 (44%), Gaps = 2/85 (2%)
 Frame = -3

Query: 256 RGHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFI--DLAEVIAVTQATPAP 83
           +G L KR   L+ W +RW +LD    ++ Y     ++  KG I  D +  I ++      
Sbjct: 34  QGPLLKRSETLRKWNERWVILDPTSGKMEYKIRRNETAIKGTIIFDASSTITLSPVN-FQ 92

Query: 82  GPPKKCDDRSFFDLRTSRRTYNFCA 8
           G P K D   F+     ++ Y  CA
Sbjct: 93  GMP-KYDGCCFYIGTPQKKDYFLCA 116


>UniRef50_Q00Y38 Cluster: AtPH1-like protein; n=2; Ostreococcus|Rep:
           AtPH1-like protein - Ostreococcus tauri
          Length = 327

 Score = 36.7 bits (81), Expect = 0.16
 Identities = 24/70 (34%), Positives = 34/70 (48%), Gaps = 2/70 (2%)
 Frame = -3

Query: 283 VERRREQNARGHLYKRGALLKGWKQRWFVLDSIK--HQLRYYDAMEDSHCKGFIDLAEVI 110
           VE  R+    G L KRG +++ W++RWFVL   K    L       +S  +G IDL   +
Sbjct: 210 VEFWRDAARAGWLTKRGDVIRTWRRRWFVLKDGKLFWFLDPSHVTPESKTRGVIDLRYCL 269

Query: 109 AVTQATPAPG 80
           + T A    G
Sbjct: 270 SSTSACDKTG 279


>UniRef50_Q556C4 Cluster: Pleckstrin homology (PH) domain-containing
           protein; n=2; Dictyostelium discoideum|Rep: Pleckstrin
           homology (PH) domain-containing protein - Dictyostelium
           discoideum AX4
          Length = 458

 Score = 36.7 bits (81), Expect = 0.16
 Identities = 19/58 (32%), Positives = 30/58 (51%)
 Frame = -3

Query: 289 VLVERRREQNARGHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDLAE 116
           V V +    +  G L K+G  ++ W++RWFVL   K  L Y+ +  D    G I+L +
Sbjct: 8   VSVSQLAPSDREGWLTKQGGSIRTWRRRWFVLKGKK--LFYFKSKGDIEATGLIELEQ 63


>UniRef50_Q1ZXL0 Cluster: Pleckstrin homology (PH) domain-containing
           protein; n=2; Dictyostelium discoideum|Rep: Pleckstrin
           homology (PH) domain-containing protein - Dictyostelium
           discoideum AX4
          Length = 808

 Score = 36.7 bits (81), Expect = 0.16
 Identities = 21/52 (40%), Positives = 32/52 (61%), Gaps = 2/52 (3%)
 Frame = -3

Query: 253 GHLYKRG--ALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDLAEVIAV 104
           G+L K+G   L++ +K+RWF+    K  L YY+   DS   GF++L E+I V
Sbjct: 129 GYLKKQGDKGLVRSFKKRWFLQRDTK--LFYYEKEGDSEPYGFVNLPEMINV 178


>UniRef50_Q0PIN0 Cluster: Bam32; n=1; Branchiostoma belcheri
           tsingtauense|Rep: Bam32 - Branchiostoma belcheri
           tsingtauense
          Length = 250

 Score = 36.7 bits (81), Expect = 0.16
 Identities = 17/44 (38%), Positives = 26/44 (59%)
 Frame = -3

Query: 253 GHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDL 122
           G+L K+G   K WK RWFVL    ++++Y+ A  D+     +DL
Sbjct: 156 GYLTKQGFNFKSWKTRWFVLKG--NEMKYFRARLDTDALRVLDL 197


>UniRef50_A2DS63 Cluster: AGC family protein kinase; n=3;
           Trichomonas vaginalis G3|Rep: AGC family protein kinase
           - Trichomonas vaginalis G3
          Length = 453

 Score = 36.7 bits (81), Expect = 0.16
 Identities = 28/78 (35%), Positives = 39/78 (50%)
 Frame = -3

Query: 253 GHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDLAEVIAVTQATPAPGPP 74
           G   K+G ++K WK+R+FVL      L YYD   D +  G I L   + V   +PAP   
Sbjct: 7   GWATKQGGMIKTWKKRYFVLTD--DWLVYYD-KPDGNEHGRIPLDPTVVV---SPAP--- 57

Query: 73  KKCDDRSFFDLRTSRRTY 20
             C  +  + + TS RTY
Sbjct: 58  -DCKKQPAYKIVTSGRTY 74


>UniRef50_UPI0001554A30 Cluster: PREDICTED: similar to dopamine
            receptor interacting protein 1; n=1; Ornithorhynchus
            anatinus|Rep: PREDICTED: similar to dopamine receptor
            interacting protein 1 - Ornithorhynchus anatinus
          Length = 1317

 Score = 36.3 bits (80), Expect = 0.21
 Identities = 18/38 (47%), Positives = 25/38 (65%), Gaps = 2/38 (5%)
 Frame = -3

Query: 256  RGHLYKR--GALLKGWKQRWFVLDSIKHQLRYYDAMED 149
            RG+L+KR    LL+GW++RWFVL      L+YY   +D
Sbjct: 1075 RGYLHKRTHSGLLRGWRKRWFVLKP-DGCLQYYKHKQD 1111


>UniRef50_UPI0000F2C318 Cluster: PREDICTED: similar to RIKEN cDNA
            2610034M16 gene; n=3; Tetrapoda|Rep: PREDICTED: similar
            to RIKEN cDNA 2610034M16 gene - Monodelphis domestica
          Length = 1383

 Score = 36.3 bits (80), Expect = 0.21
 Identities = 20/40 (50%), Positives = 25/40 (62%), Gaps = 4/40 (10%)
 Frame = -3

Query: 256  RGHLYKR--GALLKGWKQRWFVLDSIKHQ--LRYYDAMED 149
            RG+L+KR     LKGW++RWFVL   KH   L YY   +D
Sbjct: 1141 RGYLHKRTHSGFLKGWRKRWFVL---KHDGYLLYYKRKKD 1177


>UniRef50_UPI0000E49CFC Cluster: PREDICTED: similar to Ras
           GTPase-activating protein 1 (GTPase-activating protein)
           (GAP) (Ras p21 protein activator) (p120GAP) (RasGAP);
           n=3; Strongylocentrotus purpuratus|Rep: PREDICTED:
           similar to Ras GTPase-activating protein 1
           (GTPase-activating protein) (GAP) (Ras p21 protein
           activator) (p120GAP) (RasGAP) - Strongylocentrotus
           purpuratus
          Length = 628

 Score = 36.3 bits (80), Expect = 0.21
 Identities = 20/56 (35%), Positives = 32/56 (57%), Gaps = 2/56 (3%)
 Frame = -3

Query: 256 RGHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDL--AEVIAVTQA 95
           +GHL K+    K WK  +F+L++ +  L Y+D    +  +G IDL  A V AV ++
Sbjct: 372 QGHLSKKSQKHKKWKTYFFLLNATEQHLYYFDNDARTKPRGLIDLGYASVYAVHES 427


>UniRef50_Q54W22 Cluster: Putative uncharacterized protein; n=1;
           Dictyostelium discoideum AX4|Rep: Putative
           uncharacterized protein - Dictyostelium discoideum AX4
          Length = 741

 Score = 36.3 bits (80), Expect = 0.21
 Identities = 16/31 (51%), Positives = 22/31 (70%)
 Frame = -3

Query: 256 RGHLYKRGALLKGWKQRWFVLDSIKHQLRYY 164
           +G + KRG   K WK+R+F+LD +K  LRYY
Sbjct: 546 QGWMKKRGTKNKSWKKRYFILD-MKKTLRYY 575


>UniRef50_A7RKJ9 Cluster: Predicted protein; n=1; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 367

 Score = 35.9 bits (79), Expect = 0.28
 Identities = 28/87 (32%), Positives = 41/87 (47%), Gaps = 5/87 (5%)
 Frame = -3

Query: 253 GHLYKRGALLK-GWKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDLA---EVIAVTQA-TP 89
           G+L+K G     GW +RWF LD    +L Y+D   D+  KG + +    E  ++T+  T 
Sbjct: 257 GYLHKTGPKSNDGWLKRWFTLDG--RRLLYFDKPMDAFGKGEVYIGSKEEGFSITEGITT 314

Query: 88  APGPPKKCDDRSFFDLRTSRRTYNFCA 8
              P  +C       L+T  R YN  A
Sbjct: 315 EHKPIGQC-----LTLKTPNRVYNLSA 336


>UniRef50_A0E6T7 Cluster: Chromosome undetermined scaffold_80, whole
           genome shotgun sequence; n=1; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_80,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 1072

 Score = 35.9 bits (79), Expect = 0.28
 Identities = 22/67 (32%), Positives = 41/67 (61%), Gaps = 3/67 (4%)
 Frame = -3

Query: 286 LVERRREQNARGHLYKRG-ALLKGWKQRWFVL-DSIKHQLRYY-DAMEDSHCKGFIDLAE 116
           L E ++    +G L K+  A+LKGW++R+F+L ++  ++L Y+ D   +S  KG  +++ 
Sbjct: 25  LNENKKNLKLQGWLKKKSPAILKGWQKRFFMLIENEGYKLVYFDDDKTNSKPKGAFEISN 84

Query: 115 VIAVTQA 95
            I + QA
Sbjct: 85  KIDIEQA 91


>UniRef50_Q9ULM0 Cluster: Pleckstrin homology domain-containing
           family H member 1; n=19; Euteleostomi|Rep: Pleckstrin
           homology domain-containing family H member 1 - Homo
           sapiens (Human)
          Length = 1403

 Score = 35.9 bits (79), Expect = 0.28
 Identities = 16/35 (45%), Positives = 23/35 (65%)
 Frame = -3

Query: 253 GHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMED 149
           G+L K G+ +K WK+RWFVL   + Q+ YY +  D
Sbjct: 622 GYLLKMGSQVKTWKRRWFVLR--QGQIMYYKSPSD 654


>UniRef50_Q6ZWC7 Cluster: CDNA FLJ41311 fis, clone BRAMY2042760;
           n=4; root|Rep: CDNA FLJ41311 fis, clone BRAMY2042760 -
           Homo sapiens (Human)
          Length = 269

 Score = 35.9 bits (79), Expect = 0.28
 Identities = 16/35 (45%), Positives = 23/35 (65%)
 Frame = -3

Query: 253 GHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMED 149
           G+L K G+ +K WK+RWFVL   + Q+ YY +  D
Sbjct: 98  GYLLKMGSQVKTWKRRWFVLR--QGQIMYYKSPSD 130


>UniRef50_Q4S175 Cluster: Chromosome 13 SCAF14769, whole genome
           shotgun sequence; n=5; Clupeocephala|Rep: Chromosome 13
           SCAF14769, whole genome shotgun sequence - Tetraodon
           nigroviridis (Green puffer)
          Length = 722

 Score = 35.5 bits (78), Expect = 0.37
 Identities = 32/112 (28%), Positives = 50/112 (44%)
 Frame = -3

Query: 340 HDSVGTATVFLSTIL*TVLVERRREQNARGHLYKRGALLKGWKQRWFVLDSIKHQLRYYD 161
           H S G     LS  +  V +E   +   +G++ K+G   K W +RWFVL      + YY 
Sbjct: 307 HFSKGLDKQALSMGINEVYLELILDVLKQGYMMKKGHRRKNWNERWFVLR--PDSMSYYV 364

Query: 160 AMEDSHCKGFIDLAEVIAVTQATPAPGPPKKCDDRSFFDLRTSRRTYNFCAS 5
           + + +  KG I L E     Q        KKC     F +R+S++++    S
Sbjct: 365 SEDLAEWKGDIFLDESSIPLQDKEG----KKC----LFIIRSSQKSFEISVS 408


>UniRef50_Q54U56 Cluster: Putative uncharacterized protein; n=1;
           Dictyostelium discoideum AX4|Rep: Putative
           uncharacterized protein - Dictyostelium discoideum AX4
          Length = 567

 Score = 35.5 bits (78), Expect = 0.37
 Identities = 17/50 (34%), Positives = 27/50 (54%)
 Frame = -3

Query: 253 GHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDLAEVIAV 104
           G L+K   L+K WK RWF L+  +  L YY    D   +G + + E+ ++
Sbjct: 461 GFLFKMNGLMKSWKTRWFSLE--RDVLFYYKYNNDPKPQGELIILEIKSI 508


>UniRef50_A1CE30 Cluster: RhoGAP domain protein; n=3;
           Aspergillus|Rep: RhoGAP domain protein - Aspergillus
           clavatus
          Length = 1289

 Score = 35.5 bits (78), Expect = 0.37
 Identities = 20/60 (33%), Positives = 30/60 (50%)
 Frame = -3

Query: 253 GHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDLAEVIAVTQATPAPGPP 74
           G+L KRG    GWK R+F+L     +L+Y+++    H  G I +       Q+   PG P
Sbjct: 689 GYLTKRGKNFGGWKARYFILHG--PELKYFESPGGPHL-GTIKIHSAQIGKQSQTTPGQP 745


>UniRef50_UPI00015B5EDD Cluster: PREDICTED: hypothetical protein;
           n=1; Nasonia vitripennis|Rep: PREDICTED: hypothetical
           protein - Nasonia vitripennis
          Length = 3820

 Score = 35.1 bits (77), Expect = 0.48
 Identities = 30/84 (35%), Positives = 41/84 (48%), Gaps = 1/84 (1%)
 Frame = -3

Query: 256 RGHLYKRGAL-LKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDLAEVIAVTQATPAPG 80
           +G L+K+G+  L  WK+RWFVL   ++ L YY   E+    G I L     VT   P   
Sbjct: 216 QGWLHKQGSEGLMLWKKRWFVLS--EYCLFYYKGPEEEKLLGSI-LLPSYRVTVCRPEDK 272

Query: 79  PPKKCDDRSFFDLRTSRRTYNFCA 8
             KK    +F     + RTY+F A
Sbjct: 273 INKKF---AFKAEHANMRTYHFAA 293


>UniRef50_UPI0000F1D7A0 Cluster: PREDICTED: similar to KIAA0799
            protein; n=3; Euteleostomi|Rep: PREDICTED: similar to
            KIAA0799 protein - Danio rerio
          Length = 2034

 Score = 35.1 bits (77), Expect = 0.48
 Identities = 21/66 (31%), Positives = 32/66 (48%), Gaps = 5/66 (7%)
 Frame = -3

Query: 274  RREQNARGHLYKRGA-----LLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDLAEVI 110
            R+E   +G L K+G        + W++RWFVL   K  L YY+   +   KG +D+ E  
Sbjct: 1186 RQEALKQGWLMKKGGGSSTLSRRNWRRRWFVLRQSK--LIYYENDTEERMKGMLDMHEAK 1243

Query: 109  AVTQAT 92
             +   T
Sbjct: 1244 EIIDVT 1249


>UniRef50_Q8IR23 Cluster: CG9209-PA, isoform A; n=6;
           Endopterygota|Rep: CG9209-PA, isoform A - Drosophila
           melanogaster (Fruit fly)
          Length = 954

 Score = 35.1 bits (77), Expect = 0.48
 Identities = 19/47 (40%), Positives = 26/47 (55%), Gaps = 2/47 (4%)
 Frame = -3

Query: 253 GHLYKRGALLKGWKQRWFVL--DSIKHQLRYYDAMEDSHCKGFIDLA 119
           GHL K+      WKQ +F L  D  + QL +YD  + +  KG IDL+
Sbjct: 385 GHLNKKSDKTTKWKQLYFALINDGSETQLCFYDNPKKTKPKGLIDLS 431


>UniRef50_Q54F88 Cluster: Putative uncharacterized protein; n=1;
           Dictyostelium discoideum AX4|Rep: Putative
           uncharacterized protein - Dictyostelium discoideum AX4
          Length = 963

 Score = 35.1 bits (77), Expect = 0.48
 Identities = 17/45 (37%), Positives = 26/45 (57%)
 Frame = -3

Query: 256 RGHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDL 122
           +G+L K G ++K WK+RWF+ +S  + L Y    + S   G I L
Sbjct: 734 QGYLTKIGEVVKNWKRRWFIFES--NYLFYLKNEQSSKVLGIIPL 776


>UniRef50_A7SJE8 Cluster: Predicted protein; n=1; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 645

 Score = 35.1 bits (77), Expect = 0.48
 Identities = 16/34 (47%), Positives = 20/34 (58%)
 Frame = -3

Query: 253 GHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAME 152
           G L K   ++KGW+ RWFVLD     L YY + E
Sbjct: 7   GPLSKWTNVVKGWQYRWFVLDDNTGLLSYYTSKE 40


>UniRef50_Q6C6P3 Cluster: Yarrowia lipolytica chromosome E of strain
           CLIB 122 of Yarrowia lipolytica; n=1; Yarrowia
           lipolytica|Rep: Yarrowia lipolytica chromosome E of
           strain CLIB 122 of Yarrowia lipolytica - Yarrowia
           lipolytica (Candida lipolytica)
          Length = 1162

 Score = 35.1 bits (77), Expect = 0.48
 Identities = 23/61 (37%), Positives = 27/61 (44%)
 Frame = -3

Query: 325 TATVFLSTIL*TVLVERRREQNARGHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDS 146
           T   FLST     L     +    G L KRG    GWK R+FVLD     L YY++    
Sbjct: 604 TLCEFLSTNTIDPLDVPDGDARKEGFLTKRGKSFGGWKLRYFVLDG--PMLNYYESPNGP 661

Query: 145 H 143
           H
Sbjct: 662 H 662


>UniRef50_P08567 Cluster: Pleckstrin; n=32; Euteleostomi|Rep:
           Pleckstrin - Homo sapiens (Human)
          Length = 350

 Score = 35.1 bits (77), Expect = 0.48
 Identities = 22/81 (27%), Positives = 37/81 (45%)
 Frame = -3

Query: 256 RGHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDLAEVIAVTQATPAPGP 77
           +G L K+G   K WK R F+L      L YYD        G I L   +  +  + + G 
Sbjct: 248 QGCLLKQGHRRKNWKVRKFILREDPAYLHYYDPAGAEDPLGAIHLRGCVVTSVESNSNG- 306

Query: 76  PKKCDDRSFFDLRTSRRTYNF 14
            +K ++ + F++ T+   + F
Sbjct: 307 -RKSEEENLFEIITADEVHYF 326



 Score = 33.5 bits (73), Expect = 1.5
 Identities = 15/44 (34%), Positives = 24/44 (54%)
 Frame = -3

Query: 253 GHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDL 122
           G+L K+G++   WK  W VL  ++  + +Y    D+  KG I L
Sbjct: 9   GYLVKKGSVFNTWKPMWVVL--LEDGIEFYKKKSDNSPKGMIPL 50


>UniRef50_UPI000155439F Cluster: PREDICTED: similar to jerky; n=1;
           Ornithorhynchus anatinus|Rep: PREDICTED: similar to
           jerky - Ornithorhynchus anatinus
          Length = 545

 Score = 34.7 bits (76), Expect = 0.64
 Identities = 19/67 (28%), Positives = 34/67 (50%), Gaps = 4/67 (5%)
 Frame = -3

Query: 250 HLYKRGALLKGWKQRW---FVLDSIKHQLRYYD-AMEDSHCKGFIDLAEVIAVTQATPAP 83
           HL K G L + W Q W    V+D+   +    + A+++S  + +++    +  TQA P P
Sbjct: 381 HLVKSGTLRRAWTQVWPNPTVVDASSDEDGSGERALQESEIREWVEADGEVEATQAVPGP 440

Query: 82  GPPKKCD 62
           G  K+ +
Sbjct: 441 GTTKRSE 447


>UniRef50_UPI0000F1F040 Cluster: PREDICTED: similar to RIKEN cDNA
           2610034M16 gene, partial; n=3; Danio rerio|Rep:
           PREDICTED: similar to RIKEN cDNA 2610034M16 gene,
           partial - Danio rerio
          Length = 1083

 Score = 34.7 bits (76), Expect = 0.64
 Identities = 14/23 (60%), Positives = 19/23 (82%), Gaps = 2/23 (8%)
 Frame = -3

Query: 256 RGHLYKR--GALLKGWKQRWFVL 194
           RG+L+KR   + LKGW++RWFVL
Sbjct: 841 RGYLHKRTQSSFLKGWRKRWFVL 863


>UniRef50_UPI00004989C6 Cluster: PH domain protein; n=1; Entamoeba
           histolytica HM-1:IMSS|Rep: PH domain protein - Entamoeba
           histolytica HM-1:IMSS
          Length = 785

 Score = 34.7 bits (76), Expect = 0.64
 Identities = 21/57 (36%), Positives = 30/57 (52%)
 Frame = -3

Query: 292 TVLVERRREQNARGHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDL 122
           TV V   +     G   K+G   K WK+R+FVL   K  L Y+++   +  KG+IDL
Sbjct: 7   TVSVASLQPAQFTGWGTKQGGSWKSWKRRFFVLKDRK--LWYFESENSTTAKGWIDL 61


>UniRef50_Q00IB7 Cluster: Max1; n=3; Danio rerio|Rep: Max1 - Danio
           rerio (Zebrafish) (Brachydanio rerio)
          Length = 1433

 Score = 34.7 bits (76), Expect = 0.64
 Identities = 14/35 (40%), Positives = 23/35 (65%)
 Frame = -3

Query: 253 GHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMED 149
           G+L K G+ +K WK+RWF+L +   ++ YY +  D
Sbjct: 648 GYLLKMGSQVKAWKRRWFILRN--GEILYYKSPSD 680


>UniRef50_Q8BGR1 Cluster: RIKEN cDNA 2610034M16 gene; n=13;
            Eutheria|Rep: RIKEN cDNA 2610034M16 gene - Mus musculus
            (Mouse)
          Length = 1238

 Score = 34.7 bits (76), Expect = 0.64
 Identities = 19/40 (47%), Positives = 25/40 (62%), Gaps = 4/40 (10%)
 Frame = -3

Query: 256  RGHLYKR--GALLKGWKQRWFVLDSIKHQ--LRYYDAMED 149
            RG+L+KR     +KGW++RWFVL   KH   L YY   +D
Sbjct: 996  RGYLHKRTHSGFVKGWRKRWFVL---KHDGFLLYYKHRKD 1032


>UniRef50_Q8VYJ6 Cluster: At2g30880/F7F1.9; n=6; Magnoliophyta|Rep:
           At2g30880/F7F1.9 - Arabidopsis thaliana (Mouse-ear
           cress)
          Length = 504

 Score = 34.7 bits (76), Expect = 0.64
 Identities = 14/43 (32%), Positives = 22/43 (51%)
 Frame = -3

Query: 256 RGHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFI 128
           +G L+KR   L+ W +RW +LD    ++ Y     +   KG I
Sbjct: 35  QGPLFKRSETLRKWNERWVILDPTTGKMEYKTRRNEPTIKGTI 77


>UniRef50_Q552G3 Cluster: Putative uncharacterized protein; n=2;
           Dictyostelium discoideum|Rep: Putative uncharacterized
           protein - Dictyostelium discoideum AX4
          Length = 634

 Score = 34.7 bits (76), Expect = 0.64
 Identities = 15/53 (28%), Positives = 27/53 (50%)
 Frame = -3

Query: 253 GHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDLAEVIAVTQA 95
           G+L K G  +K W +RW  ++     ++YY   +    KG I + ++I +  A
Sbjct: 27  GYLVKLGKYVKSWNKRWVCIEG--DSIKYYSQQDKQVIKGSILIKDIIEIKLA 77


>UniRef50_Q552E4 Cluster: Actin binding protein; n=2; Dictyostelium
           discoideum|Rep: Actin binding protein - Dictyostelium
           discoideum AX4
          Length = 1503

 Score = 34.7 bits (76), Expect = 0.64
 Identities = 23/74 (31%), Positives = 35/74 (47%)
 Frame = -3

Query: 226 LKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDLAEVIAVTQATPAPGPPKKCDDRSFF 47
           LK W +RW+ L   K++L Y+ +  DS   G I +  V  V   T     P K   +  F
Sbjct: 209 LKNWNKRWYSLR--KNKLLYFKSKSDSTEMGCILMKTVQTVRPCTEVADIPSKY-SKMCF 265

Query: 46  DLRTSRRTYNFCAS 5
           ++ T  RT+   A+
Sbjct: 266 EIVTPARTFVMLAN 279


>UniRef50_Q17FY6 Cluster: Putative uncharacterized protein; n=1;
           Aedes aegypti|Rep: Putative uncharacterized protein -
           Aedes aegypti (Yellowfever mosquito)
          Length = 3192

 Score = 34.7 bits (76), Expect = 0.64
 Identities = 18/43 (41%), Positives = 27/43 (62%), Gaps = 1/43 (2%)
 Frame = -3

Query: 253 GHLYKRGAL-LKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFI 128
           G LYK+G+  LK W++RWFVL   ++ L YY + E+    G +
Sbjct: 404 GWLYKQGSDGLKVWRRRWFVL--AEYVLYYYKSQEEEKLLGTV 444


>UniRef50_Q9UPU7 Cluster: TBC1 domain family member 2B; n=36;
           Eumetazoa|Rep: TBC1 domain family member 2B - Homo
           sapiens (Human)
          Length = 868

 Score = 34.7 bits (76), Expect = 0.64
 Identities = 13/37 (35%), Positives = 25/37 (67%)
 Frame = -3

Query: 226 LKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDLAE 116
           L+G++ RWFV D+ +  L Y+ + +D+   G +D+A+
Sbjct: 4   LRGYRSRWFVFDARRCYLYYFKSPQDALPLGHLDIAD 40


>UniRef50_Q4WNH0 Cluster: Rho GTPase activator (Bem3), putative; n=2;
            Trichocomaceae|Rep: Rho GTPase activator (Bem3), putative
            - Aspergillus fumigatus (Sartorya fumigata)
          Length = 1508

 Score = 34.7 bits (76), Expect = 0.64
 Identities = 22/68 (32%), Positives = 34/68 (50%)
 Frame = -3

Query: 289  VLVERRREQNARGHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDLAEVI 110
            VL  + R+    G+L KRG    GWK R+F+L     +L+Y+++    H  G I +    
Sbjct: 842  VLPGQDRKPQKEGYLAKRGKNFGGWKTRYFIL--YGPELKYFESPGGPHL-GTIKIFNAQ 898

Query: 109  AVTQATPA 86
               Q+ PA
Sbjct: 899  IGKQSQPA 906


>UniRef50_Q1DQZ7 Cluster: Putative uncharacterized protein; n=1;
           Coccidioides immitis|Rep: Putative uncharacterized
           protein - Coccidioides immitis
          Length = 1472

 Score = 34.7 bits (76), Expect = 0.64
 Identities = 16/37 (43%), Positives = 23/37 (62%)
 Frame = -3

Query: 253 GHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSH 143
           G+L KRG    GWK R+FVL+    +L+YY++    H
Sbjct: 887 GYLTKRGKNFGGWKSRYFVLNG--PELKYYESPGGPH 921


>UniRef50_Q0CFX3 Cluster: Putative uncharacterized protein; n=2;
            Trichocomaceae|Rep: Putative uncharacterized protein -
            Aspergillus terreus (strain NIH 2624)
          Length = 1409

 Score = 34.7 bits (76), Expect = 0.64
 Identities = 21/67 (31%), Positives = 33/67 (49%)
 Frame = -3

Query: 253  GHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDLAEVIAVTQATPAPGPP 74
            G+L KRG    GWK R+FVL     +L+Y+++   +H  G I +       Q+      P
Sbjct: 815  GYLTKRGKNFGGWKARYFVLHG--PELKYFESPGGAHL-GTIKIYNAQIGKQSQATNDSP 871

Query: 73   KKCDDRS 53
             + +D S
Sbjct: 872  SRSEDDS 878


>UniRef50_UPI0000DA27B8 Cluster: PREDICTED: similar to TBC1 domain
           family member 2 (Prostate antigen recognized and
           indentified by SEREX) (PARIS-1); n=1; Rattus
           norvegicus|Rep: PREDICTED: similar to TBC1 domain family
           member 2 (Prostate antigen recognized and indentified by
           SEREX) (PARIS-1) - Rattus norvegicus
          Length = 925

 Score = 34.3 bits (75), Expect = 0.85
 Identities = 19/47 (40%), Positives = 25/47 (53%), Gaps = 2/47 (4%)
 Frame = -3

Query: 253 GHLYKRGAL--LKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDLA 119
           G+L K G    +KGWK RWF  D  K  L Y    +D++    IDL+
Sbjct: 47  GYLSKFGGKGPIKGWKCRWFFYDERKCHLYYSRTAQDANPLDSIDLS 93


>UniRef50_Q7PX66 Cluster: ENSANGP00000009854; n=11; Eumetazoa|Rep:
           ENSANGP00000009854 - Anopheles gambiae str. PEST
          Length = 911

 Score = 34.3 bits (75), Expect = 0.85
 Identities = 21/62 (33%), Positives = 31/62 (50%), Gaps = 2/62 (3%)
 Frame = -3

Query: 253 GHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDLAEVIA--VTQATPAPG 80
           G+L+KR +    W+ RWFVL   ++ L YY++ + S   G I L       +  A    G
Sbjct: 1   GYLHKRTSDNNKWQMRWFVL--YQNLLFYYESEQSSRPSGLIFLEGCYCERLVSAPSISG 58

Query: 79  PP 74
           PP
Sbjct: 59  PP 60


>UniRef50_Q618J0 Cluster: Putative uncharacterized protein CBG14641;
            n=1; Caenorhabditis briggsae|Rep: Putative
            uncharacterized protein CBG14641 - Caenorhabditis
            briggsae
          Length = 1690

 Score = 34.3 bits (75), Expect = 0.85
 Identities = 21/50 (42%), Positives = 28/50 (56%), Gaps = 4/50 (8%)
 Frame = -3

Query: 253  GHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMED----SHCKGFIDLAE 116
            G+L KRGA LK W  R+FVL     ++ YY+ +E+        G IDL E
Sbjct: 1594 GYLSKRGAKLKLWVPRFFVLYRDTPKVYYYEDLENWKNAEKPSGSIDLTE 1643


>UniRef50_Q5D8E7 Cluster: SJCHGC04408 protein; n=1; Schistosoma
           japonicum|Rep: SJCHGC04408 protein - Schistosoma
           japonicum (Blood fluke)
          Length = 219

 Score = 34.3 bits (75), Expect = 0.85
 Identities = 20/47 (42%), Positives = 27/47 (57%), Gaps = 2/47 (4%)
 Frame = -3

Query: 253 GHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMED--SHCKGFIDLA 119
           G L K    L GW+QR+F+LD     L YY + E+  S CKG + L+
Sbjct: 3   GVLLKWTNYLSGWQQRYFILDD--GVLSYYRSKEEMNSGCKGSVKLS 47


>UniRef50_Q5CRP7 Cluster: AtPH1 like protein with a pleckstrin
           homology (PH) domain; n=2; Cryptosporidium|Rep: AtPH1
           like protein with a pleckstrin homology (PH) domain -
           Cryptosporidium parvum Iowa II
          Length = 123

 Score = 34.3 bits (75), Expect = 0.85
 Identities = 14/28 (50%), Positives = 19/28 (67%)
 Frame = -3

Query: 277 RRREQNARGHLYKRGALLKGWKQRWFVL 194
           R+ E   +G LYK+   LK W++RWFVL
Sbjct: 14  RQDEIVKQGWLYKQSRFLKDWRRRWFVL 41


>UniRef50_Q54PT8 Cluster: Putative uncharacterized protein; n=1;
           Dictyostelium discoideum AX4|Rep: Putative
           uncharacterized protein - Dictyostelium discoideum AX4
          Length = 1272

 Score = 34.3 bits (75), Expect = 0.85
 Identities = 18/51 (35%), Positives = 30/51 (58%), Gaps = 6/51 (11%)
 Frame = -3

Query: 256 RGHLYKRG--ALLKG----WKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDL 122
           +G+L+K+G  +LL      WK+RWF L++    L+Y+    D   KG I++
Sbjct: 14  QGYLFKKGNSSLLSSSSTLWKKRWFSLENGSTTLKYFKNSSDESPKGSINI 64


>UniRef50_A6RIY7 Cluster: Putative uncharacterized protein; n=1;
            Botryotinia fuckeliana B05.10|Rep: Putative
            uncharacterized protein - Botryotinia fuckeliana B05.10
          Length = 1493

 Score = 34.3 bits (75), Expect = 0.85
 Identities = 25/68 (36%), Positives = 36/68 (52%), Gaps = 3/68 (4%)
 Frame = -3

Query: 253  GHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDL--AEVIAVTQAT-PAP 83
            G+L K+G    GWK R+FVLD      +YY++    H  G I L  A++   +Q T P+P
Sbjct: 910  GYLTKKGKNFGGWKARFFVLDG--PVFKYYESPGGPHL-GTIKLQGAQIGKQSQQTDPSP 966

Query: 82   GPPKKCDD 59
                + DD
Sbjct: 967  SSRGEGDD 974


>UniRef50_UPI0000660806 Cluster: Homolog of Homo sapiens "Myosin X;
           n=1; Takifugu rubripes|Rep: Homolog of Homo sapiens
           "Myosin X - Takifugu rubripes
          Length = 683

 Score = 33.9 bits (74), Expect = 1.1
 Identities = 22/66 (33%), Positives = 35/66 (53%), Gaps = 8/66 (12%)
 Frame = -3

Query: 274 RREQNARGHLYKRGA-----LLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDL---A 119
           ++E   +G L+K+G        + WK+RWFVL   K  L Y++   +   KG +D+    
Sbjct: 491 KQEALKQGWLHKKGGGSSTLSRRNWKRRWFVLRQSK--LMYFENDSEDKMKGVLDMHVAK 548

Query: 118 EVIAVT 101
           E+I VT
Sbjct: 549 EIIDVT 554


>UniRef50_Q4RQM4 Cluster: Chromosome 2 SCAF15004, whole genome shotgun
            sequence; n=1; Tetraodon nigroviridis|Rep: Chromosome 2
            SCAF15004, whole genome shotgun sequence - Tetraodon
            nigroviridis (Green puffer)
          Length = 1946

 Score = 33.9 bits (74), Expect = 1.1
 Identities = 19/49 (38%), Positives = 26/49 (53%), Gaps = 5/49 (10%)
 Frame = -3

Query: 253  GHLYKRGALL-----KGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDL 122
            G LYK+G  +     + WK RWFVL   K  L Y++   +   KG ID+
Sbjct: 1190 GWLYKKGGGMSTLSRRNWKMRWFVLRDSK--LMYFENDSEEKLKGTIDI 1236


>UniRef50_Q55AN8 Cluster: Pleckstrin homology (PH) domain-containing
           protein; n=2; Dictyostelium discoideum|Rep: Pleckstrin
           homology (PH) domain-containing protein - Dictyostelium
           discoideum AX4
          Length = 1167

 Score = 33.9 bits (74), Expect = 1.1
 Identities = 15/36 (41%), Positives = 21/36 (58%)
 Frame = -3

Query: 223 KGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDLAE 116
           KGWK RW  L  ++H L YY + +D    G ++L E
Sbjct: 179 KGWKVRWMKL--LEHSLVYYKSSKDKEPLGIVNLNE 212


>UniRef50_A7RZW1 Cluster: Predicted protein; n=1; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 727

 Score = 33.9 bits (74), Expect = 1.1
 Identities = 16/39 (41%), Positives = 23/39 (58%)
 Frame = -3

Query: 253 GHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCK 137
           G+L K G  +K WK+RWFVL   K  L Y+    +++ K
Sbjct: 3   GYLTKLGGRIKNWKKRWFVLQDGK--LYYFKTPNETNRK 39


>UniRef50_A7EGQ4 Cluster: Putative uncharacterized protein; n=1;
            Sclerotinia sclerotiorum 1980|Rep: Putative
            uncharacterized protein - Sclerotinia sclerotiorum 1980
          Length = 1497

 Score = 33.9 bits (74), Expect = 1.1
 Identities = 22/65 (33%), Positives = 29/65 (44%), Gaps = 1/65 (1%)
 Frame = -3

Query: 253  GHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDLAEV-IAVTQATPAPGP 77
            G+L K+G    GWK R+FVLD      +YY++    H  G I L    I        P P
Sbjct: 915  GYLTKKGKNFGGWKARFFVLDG--PVFKYYESPGGQHL-GSIKLQSAQIGKQSQQSEPSP 971

Query: 76   PKKCD 62
              + D
Sbjct: 972  SSRAD 976


>UniRef50_P42331 Cluster: Rho GTPase-activating protein 25; n=37;
           Amniota|Rep: Rho GTPase-activating protein 25 - Homo
           sapiens (Human)
          Length = 638

 Score = 33.9 bits (74), Expect = 1.1
 Identities = 17/40 (42%), Positives = 26/40 (65%)
 Frame = -3

Query: 253 GHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKG 134
           G L K+ +++K W+QR+FVL +   QL YY   ED+  +G
Sbjct: 44  GWLKKQRSIVKNWQQRYFVLRA--QQLYYYKDEEDTKPQG 81


>UniRef50_O74653 Cluster: Protein pob1; n=1; Schizosaccharomyces
           pombe|Rep: Protein pob1 - Schizosaccharomyces pombe
           (Fission yeast)
          Length = 871

 Score = 33.9 bits (74), Expect = 1.1
 Identities = 18/53 (33%), Positives = 27/53 (50%)
 Frame = -3

Query: 280 ERRREQNARGHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDL 122
           E  +  +  G + KR      WK R+FVL   +  L YY ++ D+  KG ID+
Sbjct: 694 EAIKTADCHGWMRKRSDRYGVWKSRYFVLKGTR--LSYYHSLNDASEKGLIDM 744


>UniRef50_UPI0000DB6DED Cluster: PREDICTED: similar to CG1513-PA;
           n=2; Apocrita|Rep: PREDICTED: similar to CG1513-PA -
           Apis mellifera
          Length = 719

 Score = 33.5 bits (73), Expect = 1.5
 Identities = 15/34 (44%), Positives = 19/34 (55%)
 Frame = -3

Query: 253 GHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAME 152
           G L K   ++ GW+ RWFVLD     L YY + E
Sbjct: 6   GSLSKWTNVVNGWQYRWFVLDDNAGLLSYYTSKE 39


>UniRef50_UPI0000DB6D31 Cluster: PREDICTED: similar to pleckstrin
            homology-like domain, family B, member 2; n=1; Apis
            mellifera|Rep: PREDICTED: similar to pleckstrin
            homology-like domain, family B, member 2 - Apis mellifera
          Length = 1435

 Score = 33.5 bits (73), Expect = 1.5
 Identities = 22/84 (26%), Positives = 31/84 (36%), Gaps = 2/84 (2%)
 Frame = -3

Query: 253  GHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKG--FIDLAEVIAVTQATPAPG 80
            G+L K       W +RWFV D  +  L YY        +G  +    E + V        
Sbjct: 1329 GYLSKMSKKFHHWNKRWFVFDRKRKTLSYYSDSTSRKARGVIYFQSIEEVYVDHMNTVRS 1388

Query: 79   PPKKCDDRSFFDLRTSRRTYNFCA 8
            P         F ++TS R Y+  A
Sbjct: 1389 PQPSLT----FIIKTSTRLYHLMA 1408


>UniRef50_UPI000058428B Cluster: PREDICTED: similar to Pleckstrin;
           n=1; Strongylocentrotus purpuratus|Rep: PREDICTED:
           similar to Pleckstrin - Strongylocentrotus purpuratus
          Length = 375

 Score = 33.5 bits (73), Expect = 1.5
 Identities = 18/44 (40%), Positives = 22/44 (50%)
 Frame = -3

Query: 253 GHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDL 122
           G L K+G     W+ RWFVL   +  L YY    DS   G I+L
Sbjct: 11  GFLVKKGHKRTNWRTRWFVL--TEDSLAYYKQTTDSLPAGVIEL 52


>UniRef50_UPI000023DDD0 Cluster: hypothetical protein FG04718.1; n=2;
            Gibberella zeae PH-1|Rep: hypothetical protein FG04718.1
            - Gibberella zeae PH-1
          Length = 2163

 Score = 33.5 bits (73), Expect = 1.5
 Identities = 21/62 (33%), Positives = 31/62 (50%), Gaps = 1/62 (1%)
 Frame = -3

Query: 214  KQRWFVLDSIKHQLRYYDA-MEDSHCKGFIDLAEVIAVTQATPAPGPPKKCDDRSFFDLR 38
            K R   +++     +Y DA +++  C G +    V+A +  TP P  P   D RS FDL 
Sbjct: 1342 KVRLLGIETSSAPYQYIDAGLKELTCFGNMVEGPVLAFSVVTPKPSTPSPIDLRSGFDLL 1401

Query: 37   TS 32
            TS
Sbjct: 1402 TS 1403


>UniRef50_Q4SG69 Cluster: Chromosome 17 SCAF14597, whole genome
           shotgun sequence; n=2; Tetraodontidae|Rep: Chromosome 17
           SCAF14597, whole genome shotgun sequence - Tetraodon
           nigroviridis (Green puffer)
          Length = 209

 Score = 33.5 bits (73), Expect = 1.5
 Identities = 15/35 (42%), Positives = 22/35 (62%)
 Frame = -3

Query: 253 GHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMED 149
           G LYK    + GW+ RWFVL++    + YYD+ +D
Sbjct: 3   GILYKWTNYMTGWQPRWFVLEN--GVISYYDSEDD 35


>UniRef50_Q8IGC7 Cluster: RH55218p; n=5; Diptera|Rep: RH55218p -
           Drosophila melanogaster (Fruit fly)
          Length = 285

 Score = 33.5 bits (73), Expect = 1.5
 Identities = 13/30 (43%), Positives = 18/30 (60%)
 Frame = -3

Query: 253 GHLYKRGALLKGWKQRWFVLDSIKHQLRYY 164
           G L K   ++KGW+ RWF +D+    L YY
Sbjct: 80  GQLSKYTNVMKGWQYRWFTVDAKTGSLSYY 109


>UniRef50_Q24CH5 Cluster: PH domain containing protein; n=1;
            Tetrahymena thermophila SB210|Rep: PH domain containing
            protein - Tetrahymena thermophila SB210
          Length = 1351

 Score = 33.5 bits (73), Expect = 1.5
 Identities = 17/44 (38%), Positives = 26/44 (59%), Gaps = 1/44 (2%)
 Frame = -3

Query: 253  GHLYKRG-ALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFID 125
            G LYK+  ++ KGWK R+FVL + K  + YY   +    +G I+
Sbjct: 1041 GWLYKKSPSIFKGWKMRYFVLTTSK--ICYYKEAQKKRIRGCIN 1082


>UniRef50_Q22NV8 Cluster: Putative uncharacterized protein; n=1;
           Tetrahymena thermophila SB210|Rep: Putative
           uncharacterized protein - Tetrahymena thermophila SB210
          Length = 862

 Score = 33.5 bits (73), Expect = 1.5
 Identities = 17/51 (33%), Positives = 29/51 (56%), Gaps = 1/51 (1%)
 Frame = -3

Query: 247 LYKRGA-LLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDLAEVIAVTQ 98
           + KR + +L GW++RW VL + K  L+Y+     +H +G ID + +    Q
Sbjct: 552 IQKRSSNILVGWQKRWLVLKNKK--LQYFKTDSSAHYQGCIDFSILTCTVQ 600


>UniRef50_Q17GN5 Cluster: Putative uncharacterized protein; n=3;
           Endopterygota|Rep: Putative uncharacterized protein -
           Aedes aegypti (Yellowfever mosquito)
          Length = 289

 Score = 33.5 bits (73), Expect = 1.5
 Identities = 18/44 (40%), Positives = 24/44 (54%)
 Frame = -3

Query: 253 GHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDL 122
           G L KRG + K W++RWFVL    + L Y++   D    G I L
Sbjct: 22  GWLNKRGEINKSWQRRWFVLKG--NLLFYFERKGDREPLGMIIL 63


>UniRef50_A2F3V7 Cluster: PH domain containing protein; n=1;
           Trichomonas vaginalis G3|Rep: PH domain containing
           protein - Trichomonas vaginalis G3
          Length = 436

 Score = 33.5 bits (73), Expect = 1.5
 Identities = 14/31 (45%), Positives = 21/31 (67%)
 Frame = -3

Query: 253 GHLYKRGALLKGWKQRWFVLDSIKHQLRYYD 161
           G L K G ++K WK+RWFVL   K  ++Y++
Sbjct: 13  GWLLKEGHIIKSWKRRWFVLG--KGIVKYFE 41


>UniRef50_Q5VSM6 Cluster: Oxysterol-binding protein; n=40;
           Coelomata|Rep: Oxysterol-binding protein - Homo sapiens
           (Human)
          Length = 752

 Score = 33.5 bits (73), Expect = 1.5
 Identities = 15/34 (44%), Positives = 20/34 (58%)
 Frame = -3

Query: 253 GHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAME 152
           G L K   ++KGW+ RWFVLD     L YY + +
Sbjct: 13  GPLSKWTNVMKGWQYRWFVLDYNAGLLSYYTSKD 46


>UniRef50_Q5KBD9 Cluster: Oxysterol-binding protein, putative; n=2;
           Filobasidiella neoformans|Rep: Oxysterol-binding
           protein, putative - Cryptococcus neoformans
           (Filobasidiella neoformans)
          Length = 1249

 Score = 33.5 bits (73), Expect = 1.5
 Identities = 21/53 (39%), Positives = 27/53 (50%), Gaps = 2/53 (3%)
 Frame = -3

Query: 271 REQNARGHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDS--HCKGFIDLA 119
           R  + RG L K      GW+ RWFVL++    L YY   ED    C+G I +A
Sbjct: 285 RPPDHRGFLSKWVNYRSGWRTRWFVLEN--GVLSYYRDREDEAVACRGSIAMA 335


>UniRef50_A5DS35 Cluster: Putative uncharacterized protein; n=1;
           Lodderomyces elongisporus NRRL YB-4239|Rep: Putative
           uncharacterized protein - Lodderomyces elongisporus
           (Yeast) (Saccharomyces elongisporus)
          Length = 1113

 Score = 33.5 bits (73), Expect = 1.5
 Identities = 16/53 (30%), Positives = 26/53 (49%)
 Frame = -3

Query: 280 ERRREQNARGHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDL 122
           E  +  N  G++ KR      W+ R+F L   +  L Y+ + +D   KG ID+
Sbjct: 733 EATKTANYSGYMAKRSGNTVSWRSRYFTLHGTR--LSYFTSFKDKKEKGLIDI 783


>UniRef50_Q9UH65 Cluster: Switch-associated protein 70; n=33;
           Euteleostomi|Rep: Switch-associated protein 70 - Homo
           sapiens (Human)
          Length = 585

 Score = 33.5 bits (73), Expect = 1.5
 Identities = 22/64 (34%), Positives = 31/64 (48%)
 Frame = -3

Query: 256 RGHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDLAEVIAVTQATPAPGP 77
           +G++ K+G   K W +RWFVL    + + YY + +    KG I L E   V       G 
Sbjct: 214 QGYMMKKGHRRKNWTERWFVLK--PNIISYYVSEDLKDKKGDILLDENCCVESLPDKDG- 270

Query: 76  PKKC 65
            KKC
Sbjct: 271 -KKC 273


>UniRef50_Q9HB19 Cluster: Pleckstrin homology domain-containing
           family A member 2; n=17; Mammalia|Rep: Pleckstrin
           homology domain-containing family A member 2 - Homo
           sapiens (Human)
          Length = 425

 Score = 33.5 bits (73), Expect = 1.5
 Identities = 22/78 (28%), Positives = 37/78 (47%)
 Frame = -3

Query: 253 GHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDLAEVIAVTQATPAPGPP 74
           G+  K+G + K WK+R+F LD     + Y+   +D      I L +V+   +     G  
Sbjct: 203 GYCVKQGNVRKSWKRRFFALDDF--TICYFKCEQDREPLRTIFLKDVLKTHECLVKSGDL 260

Query: 73  KKCDDRSFFDLRTSRRTY 20
              D  + F++ TS RT+
Sbjct: 261 LMRD--NLFEIITSSRTF 276


>UniRef50_Q96SU4 Cluster: Oxysterol-binding protein-related protein
           9; n=38; Bilateria|Rep: Oxysterol-binding
           protein-related protein 9 - Homo sapiens (Human)
          Length = 736

 Score = 33.5 bits (73), Expect = 1.5
 Identities = 15/34 (44%), Positives = 20/34 (58%)
 Frame = -3

Query: 253 GHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAME 152
           G L K   ++KGW+ RWFVLD     L YY + +
Sbjct: 7   GPLSKWTNVMKGWQYRWFVLDYNAGLLSYYTSKD 40


>UniRef50_UPI00005872F3 Cluster: PREDICTED: hypothetical protein,
           partial; n=1; Strongylocentrotus purpuratus|Rep:
           PREDICTED: hypothetical protein, partial -
           Strongylocentrotus purpuratus
          Length = 454

 Score = 33.1 bits (72), Expect = 2.0
 Identities = 13/25 (52%), Positives = 15/25 (60%)
 Frame = -3

Query: 268 EQNARGHLYKRGALLKGWKQRWFVL 194
           E    GHL K+G  +  WK RWFVL
Sbjct: 206 EVEKMGHLKKKGHKVTNWKDRWFVL 230


>UniRef50_UPI00004992E5 Cluster: PH domain protein; n=1; Entamoeba
           histolytica HM-1:IMSS|Rep: PH domain protein - Entamoeba
           histolytica HM-1:IMSS
          Length = 461

 Score = 33.1 bits (72), Expect = 2.0
 Identities = 14/40 (35%), Positives = 25/40 (62%)
 Frame = -3

Query: 241 KRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDL 122
           K G  ++ WK+R+FVL     ++ Y+ + +D   KG+ID+
Sbjct: 17  KVGGSIRTWKKRYFVLKD--RRIWYFSSCKDKAAKGYIDV 54


>UniRef50_Q5W7F2 Cluster: ARF-GAP; n=5; Magnoliophyta|Rep: ARF-GAP -
           Arabidopsis thaliana (Mouse-ear cress)
          Length = 827

 Score = 33.1 bits (72), Expect = 2.0
 Identities = 17/32 (53%), Positives = 24/32 (75%), Gaps = 1/32 (3%)
 Frame = -3

Query: 256 RGHLYKRGALLKG-WKQRWFVLDSIKHQLRYY 164
           +G+L KR + L+G WK+R+FVLDS +  L YY
Sbjct: 296 QGYLSKRSSNLRGDWKRRFFVLDS-RGMLYYY 326


>UniRef50_A7QT71 Cluster: Chromosome chr1 scaffold_166, whole genome
           shotgun sequence; n=4; core eudicotyledons|Rep:
           Chromosome chr1 scaffold_166, whole genome shotgun
           sequence - Vitis vinifera (Grape)
          Length = 832

 Score = 33.1 bits (72), Expect = 2.0
 Identities = 17/32 (53%), Positives = 24/32 (75%), Gaps = 1/32 (3%)
 Frame = -3

Query: 256 RGHLYKRGALLKG-WKQRWFVLDSIKHQLRYY 164
           +G+L KR + L+G WK+R+FVLDS +  L YY
Sbjct: 296 QGYLSKRSSNLRGDWKRRFFVLDS-RGMLYYY 326


>UniRef50_Q9TXP3 Cluster: Mtm (Myotubularin) family protein 5; n=1;
            Caenorhabditis elegans|Rep: Mtm (Myotubularin) family
            protein 5 - Caenorhabditis elegans
          Length = 1744

 Score = 33.1 bits (72), Expect = 2.0
 Identities = 16/35 (45%), Positives = 22/35 (62%)
 Frame = -3

Query: 253  GHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMED 149
            G+L KRGA LK W  R+FVL     ++ YY+  E+
Sbjct: 1648 GYLSKRGAKLKLWVPRFFVLYPDSPKVYYYEDFEN 1682


>UniRef50_A2DL64 Cluster: PH domain containing protein; n=1;
           Trichomonas vaginalis G3|Rep: PH domain containing
           protein - Trichomonas vaginalis G3
          Length = 138

 Score = 33.1 bits (72), Expect = 2.0
 Identities = 18/46 (39%), Positives = 25/46 (54%)
 Frame = -3

Query: 253 GHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDLAE 116
           G   K G L+K  K+RWF+LD   + L YY    +   KG I ++E
Sbjct: 8   GWCSKEGGLIKSVKRRWFILDG--NVLHYYTKDREKE-KGSIQISE 50


>UniRef50_Q8X0U9 Cluster: Related to budding protein BOI2; n=4;
           Sordariomycetes|Rep: Related to budding protein BOI2 -
           Neurospora crassa
          Length = 945

 Score = 33.1 bits (72), Expect = 2.0
 Identities = 20/55 (36%), Positives = 30/55 (54%), Gaps = 1/55 (1%)
 Frame = -3

Query: 280 ERRREQNARGHLYKRGA-LLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDLA 119
           E  ++ +  G + KR A L+  WK R FVL     +L YY + +D   KG ID++
Sbjct: 697 ESIKDADYSGWMKKRSANLMTTWKPRLFVLKG--RRLAYYYSEDDQEEKGLIDIS 749


>UniRef50_Q8IVE3 Cluster: Pleckstrin homology domain-containing
           family H member 2; n=30; Tetrapoda|Rep: Pleckstrin
           homology domain-containing family H member 2 - Homo
           sapiens (Human)
          Length = 1493

 Score = 33.1 bits (72), Expect = 2.0
 Identities = 15/35 (42%), Positives = 20/35 (57%)
 Frame = -3

Query: 253 GHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMED 149
           G+L K    +K WK+RWFVL     +L YY +  D
Sbjct: 708 GYLLKMSGKVKSWKRRWFVLKG--GELLYYKSPSD 740


>UniRef50_Q8INB9 Cluster: RAC serine/threonine-protein kinase; n=8;
           Bilateria|Rep: RAC serine/threonine-protein kinase -
           Drosophila melanogaster (Fruit fly)
          Length = 611

 Score = 33.1 bits (72), Expect = 2.0
 Identities = 16/36 (44%), Positives = 20/36 (55%)
 Frame = -3

Query: 253 GHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDS 146
           G L KRG  +K W+QR+FVL S    + Y     DS
Sbjct: 111 GWLMKRGEHIKNWRQRYFVLHSDGRLMGYRSKPADS 146


>UniRef50_UPI0000DA2FA4 Cluster: PREDICTED: similar to Guanine
           nucleotide-releasing protein (GNRP) (P140 Ras-GRF); n=1;
           Rattus norvegicus|Rep: PREDICTED: similar to Guanine
           nucleotide-releasing protein (GNRP) (P140 Ras-GRF) -
           Rattus norvegicus
          Length = 1245

 Score = 32.7 bits (71), Expect = 2.6
 Identities = 19/73 (26%), Positives = 34/73 (46%)
 Frame = -3

Query: 274 RREQNARGHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDLAEVIAVTQA 95
           +R+   +G+L KR +    W+ +WF L  +++ L Y+++   S   G   L   I     
Sbjct: 20  QRDGTRKGYLSKRSSDNPKWQTKWFAL--LQNLLFYFESDSSSRPSGLYLLEGSICKRMP 77

Query: 94  TPAPGPPKKCDDR 56
           +P  G   K  D+
Sbjct: 78  SPKRGTSSKESDK 90


>UniRef50_UPI00004D9442 Cluster: pleckstrin homology domain
           containing, family A member 2; n=2; Xenopus
           tropicalis|Rep: pleckstrin homology domain containing,
           family A member 2 - Xenopus tropicalis
          Length = 1007

 Score = 32.7 bits (71), Expect = 2.6
 Identities = 26/84 (30%), Positives = 41/84 (48%), Gaps = 1/84 (1%)
 Frame = -3

Query: 256 RGHLYKR-GALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDLAEVIAVTQATPAPG 80
           RG L+K+  + +K WK+RWF+L    + L YY   ++    G I L   + ++   P   
Sbjct: 107 RGWLHKQDSSAMKLWKRRWFLLSD--YCLFYYKDHQEETVLGSIPLLSYV-ISPVGPEDR 163

Query: 79  PPKKCDDRSFFDLRTSRRTYNFCA 8
             +K    SF   ++  RTY F A
Sbjct: 164 VSRK---YSFKQDQSGMRTYFFSA 184


>UniRef50_Q8BUL6-2 Cluster: Isoform 2 of Q8BUL6 ; n=6; Mammalia|Rep:
           Isoform 2 of Q8BUL6 - Mus musculus (Mouse)
          Length = 356

 Score = 32.7 bits (71), Expect = 2.6
 Identities = 17/52 (32%), Positives = 30/52 (57%)
 Frame = -3

Query: 253 GHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDLAEVIAVTQ 98
           G+  K+GA++K WK+R+F LD  ++ + Y+ +  +      I L EV  V +
Sbjct: 148 GYCVKQGAVMKNWKRRYFQLD--ENTIGYFKSELEKEPLRVIPLKEVHKVQE 197


>UniRef50_Q4SM04 Cluster: Chromosome 13 SCAF14555, whole genome
           shotgun sequence; n=2; Tetraodontidae|Rep: Chromosome 13
           SCAF14555, whole genome shotgun sequence - Tetraodon
           nigroviridis (Green puffer)
          Length = 1057

 Score = 32.7 bits (71), Expect = 2.6
 Identities = 14/37 (37%), Positives = 22/37 (59%)
 Frame = -3

Query: 226 LKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDLAE 116
           L+G+K RWFV D  K  L Y+   +D+   G I++ +
Sbjct: 50  LRGYKPRWFVYDPRKCYLYYFKTPQDALPLGHIEIGD 86


>UniRef50_Q9FIT8 Cluster: GCN4-complementing protein homolog; n=2;
           core eudicotyledons|Rep: GCN4-complementing protein
           homolog - Arabidopsis thaliana (Mouse-ear cress)
          Length = 768

 Score = 32.7 bits (71), Expect = 2.6
 Identities = 16/32 (50%), Positives = 24/32 (75%), Gaps = 1/32 (3%)
 Frame = -3

Query: 256 RGHLYKRGALLKG-WKQRWFVLDSIKHQLRYY 164
           +G+L KR + L+G WK+R+F+LDS +  L YY
Sbjct: 259 QGYLSKRSSNLRGDWKRRFFILDS-RGMLYYY 289


>UniRef50_Q5BXS4 Cluster: SJCHGC05290 protein; n=1; Schistosoma
           japonicum|Rep: SJCHGC05290 protein - Schistosoma
           japonicum (Blood fluke)
          Length = 163

 Score = 32.7 bits (71), Expect = 2.6
 Identities = 12/35 (34%), Positives = 21/35 (60%)
 Frame = -3

Query: 265 QNARGHLYKRGALLKGWKQRWFVLDSIKHQLRYYD 161
           +   G L K   ++KG++ RWFV+D    ++ YY+
Sbjct: 30  KRTEGQLLKFTNVMKGYQYRWFVIDPDSGRMEYYE 64


>UniRef50_Q2H559 Cluster: Putative uncharacterized protein; n=1;
           Chaetomium globosum|Rep: Putative uncharacterized
           protein - Chaetomium globosum (Soil fungus)
          Length = 899

 Score = 32.7 bits (71), Expect = 2.6
 Identities = 19/53 (35%), Positives = 29/53 (54%), Gaps = 2/53 (3%)
 Frame = -3

Query: 274 RREQNARGHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMED--SHCKGFIDL 122
           R  +  +G+L K     KG++ RWFVL+     L YY   +D  S C+G I++
Sbjct: 357 REAREMKGYLKKWTNYRKGYQLRWFVLED--GVLSYYKHQDDAGSACRGAINM 407


>UniRef50_A7TSE3 Cluster: Putative uncharacterized protein; n=1;
           Vanderwaltozyma polyspora DSM 70294|Rep: Putative
           uncharacterized protein - Vanderwaltozyma polyspora DSM
           70294
          Length = 976

 Score = 32.7 bits (71), Expect = 2.6
 Identities = 18/44 (40%), Positives = 27/44 (61%), Gaps = 1/44 (2%)
 Frame = -3

Query: 256 RGHLYK-RGALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFI 128
           +G+LYK R   L+G+K+R+F LD     L YY   ++  C+G I
Sbjct: 243 QGYLYKKRRKKLQGFKKRFFSLDFKYGTLSYYVNEQNQTCRGEI 286


>UniRef50_Q8BUL6 Cluster: Pleckstrin homology domain-containing
           family A member 1; n=26; Euteleostomi|Rep: Pleckstrin
           homology domain-containing family A member 1 - Mus
           musculus (Mouse)
          Length = 383

 Score = 32.7 bits (71), Expect = 2.6
 Identities = 17/52 (32%), Positives = 30/52 (57%)
 Frame = -3

Query: 253 GHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDLAEVIAVTQ 98
           G+  K+GA++K WK+R+F LD  ++ + Y+ +  +      I L EV  V +
Sbjct: 196 GYCVKQGAVMKNWKRRYFQLD--ENTIGYFKSELEKEPLRVIPLKEVHKVQE 245


>UniRef50_Q9HB21 Cluster: Pleckstrin homology domain-containing
           family A member 1; n=14; Euteleostomi|Rep: Pleckstrin
           homology domain-containing family A member 1 - Homo
           sapiens (Human)
          Length = 404

 Score = 32.7 bits (71), Expect = 2.6
 Identities = 17/52 (32%), Positives = 30/52 (57%)
 Frame = -3

Query: 253 GHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDLAEVIAVTQ 98
           G+  K+GA++K WK+R+F LD  ++ + Y+ +  +      I L EV  V +
Sbjct: 196 GYCVKQGAVMKNWKRRYFQLD--ENTIGYFKSELEKEPLRVIPLKEVHKVQE 245


>UniRef50_P28818 Cluster: Guanine nucleotide-releasing protein;
           n=24; Euteleostomi|Rep: Guanine nucleotide-releasing
           protein - Rattus norvegicus (Rat)
          Length = 1244

 Score = 32.7 bits (71), Expect = 2.6
 Identities = 19/73 (26%), Positives = 34/73 (46%)
 Frame = -3

Query: 274 RREQNARGHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDLAEVIAVTQA 95
           +R+   +G+L KR +    W+ +WF L  +++ L Y+++   S   G   L   I     
Sbjct: 20  QRDGTRKGYLSKRSSDNPKWQTKWFAL--LQNLLFYFESDSSSRPSGLYLLEGSICKRMP 77

Query: 94  TPAPGPPKKCDDR 56
           +P  G   K  D+
Sbjct: 78  SPKRGTSSKESDK 90


>UniRef50_Q5M7E8 Cluster: LOC496220 protein; n=3; Tetrapoda|Rep:
           LOC496220 protein - Xenopus laevis (African clawed frog)
          Length = 411

 Score = 32.3 bits (70), Expect = 3.4
 Identities = 22/78 (28%), Positives = 36/78 (46%)
 Frame = -3

Query: 253 GHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDLAEVIAVTQATPAPGPP 74
           G+  K+G + K WK+R+FVLD     + Y+    D      I L E++   +     G  
Sbjct: 204 GYCVKQGNVRKNWKRRFFVLDVF--SISYFKCSTDREPLRRILLREILKTHECLVKSGDL 261

Query: 73  KKCDDRSFFDLRTSRRTY 20
              D  + F++ T  RT+
Sbjct: 262 LLRD--NLFEIITGPRTF 277


>UniRef50_Q4SQC0 Cluster: Chromosome 4 SCAF14533, whole genome
           shotgun sequence; n=2; Tetraodontidae|Rep: Chromosome 4
           SCAF14533, whole genome shotgun sequence - Tetraodon
           nigroviridis (Green puffer)
          Length = 999

 Score = 32.3 bits (70), Expect = 3.4
 Identities = 18/44 (40%), Positives = 24/44 (54%)
 Frame = -3

Query: 253 GHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDL 122
           G L K+G  +K W  RWFVL +   +L YY   E++   G I L
Sbjct: 30  GWLRKQGGFVKTWHSRWFVLRA--DRLYYYKDEEETKPLGAIFL 71


>UniRef50_Q6ZPK1 Cluster: MKIAA1686 protein; n=13; Euteleostomi|Rep:
           MKIAA1686 protein - Mus musculus (Mouse)
          Length = 1205

 Score = 32.3 bits (70), Expect = 3.4
 Identities = 27/83 (32%), Positives = 38/83 (45%), Gaps = 1/83 (1%)
 Frame = -3

Query: 256 RGHLYKRGAL-LKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDLAEVIAVTQATPAPG 80
           RG LYK+ +  +K WK+RWFVL  +   L YY   ++    G I L     +   T    
Sbjct: 110 RGWLYKQDSTGMKLWKKRWFVLSDL--CLFYYRDEKEEGILGSI-LLPSFQIAMLTAEDH 166

Query: 79  PPKKCDDRSFFDLRTSRRTYNFC 11
             +K    +F     + RTY FC
Sbjct: 167 INRK---YAFKAAHPNMRTYYFC 186


>UniRef50_Q9C6C3 Cluster: GCN4-complementing protein, putative;
           3111-9506; n=7; Magnoliophyta|Rep: GCN4-complementing
           protein, putative; 3111-9506 - Arabidopsis thaliana
           (Mouse-ear cress)
          Length = 776

 Score = 32.3 bits (70), Expect = 3.4
 Identities = 17/37 (45%), Positives = 24/37 (64%), Gaps = 1/37 (2%)
 Frame = -3

Query: 271 REQNARGHLYKRGALLKG-WKQRWFVLDSIKHQLRYY 164
           +E   +G+L KR A L+  WK+R+FVLD+  H   YY
Sbjct: 289 KEVTKQGYLLKRSASLRADWKRRFFVLDN--HGSLYY 323


>UniRef50_Q5N891 Cluster: Pleckstrin homology (PH) domain-containing
           protein-like; n=1; Oryza sativa (japonica
           cultivar-group)|Rep: Pleckstrin homology (PH)
           domain-containing protein-like - Oryza sativa subsp.
           japonica (Rice)
          Length = 148

 Score = 32.3 bits (70), Expect = 3.4
 Identities = 14/30 (46%), Positives = 18/30 (60%)
 Frame = -3

Query: 283 VERRREQNARGHLYKRGALLKGWKQRWFVL 194
           VE  R     G L K+G  +K W++RWFVL
Sbjct: 25  VEFWRSPERAGWLTKQGEYIKTWRRRWFVL 54


>UniRef50_Q010V7 Cluster: Pleckstrin homology; n=2;
           Ostreococcus|Rep: Pleckstrin homology - Ostreococcus
           tauri
          Length = 458

 Score = 32.3 bits (70), Expect = 3.4
 Identities = 12/20 (60%), Positives = 16/20 (80%)
 Frame = -3

Query: 253 GHLYKRGALLKGWKQRWFVL 194
           G L K+G +LK W++RWFVL
Sbjct: 207 GWLTKQGEMLKTWRKRWFVL 226


>UniRef50_Q55FY1 Cluster: Putative uncharacterized protein; n=1;
           Dictyostelium discoideum AX4|Rep: Putative
           uncharacterized protein - Dictyostelium discoideum AX4
          Length = 961

 Score = 32.3 bits (70), Expect = 3.4
 Identities = 26/80 (32%), Positives = 36/80 (45%)
 Frame = -3

Query: 253 GHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDLAEVIAVTQATPAPGPP 74
           GHL K G +    K+RWF + S  + L +Y    D   +G + L +        P PG  
Sbjct: 440 GHLLKDGQINVMSKKRWFTIKS--YFLFWYLEQSDLSPQGMVCLIDF----GCAPKPGQK 493

Query: 73  KKCDDRSFFDLRTSRRTYNF 14
            K      F L+T  RT+NF
Sbjct: 494 VK------FQLQTKDRTFNF 507



 Score = 31.5 bits (68), Expect = 6.0
 Identities = 18/43 (41%), Positives = 21/43 (48%)
 Frame = -3

Query: 253 GHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFID 125
           G LYK G L K WK+R+F +      L Y    E    KG ID
Sbjct: 601 GFLYKMGQLNKEWKKRFFFIQGT--NLYYATLKESDFEKGTID 641


>UniRef50_Q0V184 Cluster: Putative uncharacterized protein; n=1;
           Phaeosphaeria nodorum|Rep: Putative uncharacterized
           protein - Phaeosphaeria nodorum (Septoria nodorum)
          Length = 1222

 Score = 32.3 bits (70), Expect = 3.4
 Identities = 18/53 (33%), Positives = 28/53 (52%), Gaps = 2/53 (3%)
 Frame = -3

Query: 274 RREQNARGHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMED--SHCKGFIDL 122
           +  +  +G+L K      G+K RWFVL+     L YY   +D  S C+G I++
Sbjct: 385 KESREMKGYLKKWTNYTSGYKLRWFVLED--GALSYYKHQDDIGSACRGAINM 435


>UniRef50_A1D9C3 Cluster: Oxysterol binding protein (Osh1),
           putative; n=27; Pezizomycotina|Rep: Oxysterol binding
           protein (Osh1), putative - Neosartorya fischeri (strain
           ATCC 1020 / DSM 3700 / NRRL 181)(Aspergillus
           fischerianus (strain ATCC 1020 / DSM 3700 / NRRL 181))
          Length = 1271

 Score = 32.3 bits (70), Expect = 3.4
 Identities = 19/47 (40%), Positives = 26/47 (55%), Gaps = 2/47 (4%)
 Frame = -3

Query: 256 RGHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMED--SHCKGFIDL 122
           RG+L K      G+K RWFVL+     L YY   +D  S C+G I++
Sbjct: 399 RGYLKKWTNYTSGYKLRWFVLED--GVLSYYKHQDDAGSACRGAINM 443


>UniRef50_Q9H4M7 Cluster: Pleckstrin homology domain-containing
           family A member 4; n=19; Mammalia|Rep: Pleckstrin
           homology domain-containing family A member 4 - Homo
           sapiens (Human)
          Length = 779

 Score = 32.3 bits (70), Expect = 3.4
 Identities = 19/39 (48%), Positives = 26/39 (66%), Gaps = 2/39 (5%)
 Frame = -3

Query: 256 RGHLYKRGAL-LKGWKQRWFVLDSIKHQLRYY-DAMEDS 146
           RG L+K+ +  L+ WK+RWFVL    H L YY D+ E+S
Sbjct: 58  RGWLHKQDSSGLRLWKRRWFVLSG--HCLFYYKDSREES 94


>UniRef50_UPI0000498916 Cluster: PH domain protein; n=1; Entamoeba
           histolytica HM-1:IMSS|Rep: PH domain protein - Entamoeba
           histolytica HM-1:IMSS
          Length = 553

 Score = 31.9 bits (69), Expect = 4.5
 Identities = 17/40 (42%), Positives = 22/40 (55%)
 Frame = -3

Query: 241 KRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDL 122
           K G   K WK+R+FVL   K  L Y+D  +    KG I+L
Sbjct: 20  KEGGGYKNWKKRYFVLKDKK--LWYFDNKDSVSAKGCIEL 57


>UniRef50_Q4SAW8 Cluster: Chromosome 3 SCAF14679, whole genome
           shotgun sequence; n=1; Tetraodon nigroviridis|Rep:
           Chromosome 3 SCAF14679, whole genome shotgun sequence -
           Tetraodon nigroviridis (Green puffer)
          Length = 398

 Score = 31.9 bits (69), Expect = 4.5
 Identities = 14/30 (46%), Positives = 18/30 (60%), Gaps = 1/30 (3%)
 Frame = -3

Query: 253 GHLYKRGALLKGWKQRWFVL-DSIKHQLRY 167
           G L K G  +K WK+RWF+L DS  +   Y
Sbjct: 253 GWLLKMGGRVKTWKRRWFILTDSCLYYFEY 282


>UniRef50_A0ZJ84 Cluster: Putative uncharacterized protein; n=1;
           Nodularia spumigena CCY 9414|Rep: Putative
           uncharacterized protein - Nodularia spumigena CCY 9414
          Length = 418

 Score = 31.9 bits (69), Expect = 4.5
 Identities = 16/43 (37%), Positives = 28/43 (65%), Gaps = 3/43 (6%)
 Frame = -3

Query: 175 LRYYDAMEDSH-CKGFIDLAEVIAVTQATPAPGP--PKKCDDR 56
           LR+ ++M D+H  + +++ A   AV +A P+P P  P +CDD+
Sbjct: 311 LRFDESMFDNHNSRKYVEYAINNAVEKAKPSPRPITPSRCDDK 353


>UniRef50_Q9VC05 Cluster: Oxysterol-binding protein; n=15;
           Endopterygota|Rep: Oxysterol-binding protein -
           Drosophila melanogaster (Fruit fly)
          Length = 784

 Score = 31.9 bits (69), Expect = 4.5
 Identities = 20/47 (42%), Positives = 28/47 (59%), Gaps = 2/47 (4%)
 Frame = -3

Query: 256 RGHLYKRGALLKGWKQRWFVLDSIKHQLRYY-DAMEDSH-CKGFIDL 122
           +G L K    +KG+++RWFVL   K  L YY +  E +H C+G I L
Sbjct: 18  KGWLLKWTNYIKGYQRRWFVLS--KGVLSYYRNQSEINHTCRGTISL 62


>UniRef50_A7S8R7 Cluster: Predicted protein; n=2; Eumetazoa|Rep:
           Predicted protein - Nematostella vectensis
          Length = 130

 Score = 31.9 bits (69), Expect = 4.5
 Identities = 15/30 (50%), Positives = 21/30 (70%)
 Frame = -3

Query: 253 GHLYKRGALLKGWKQRWFVLDSIKHQLRYY 164
           G+L K+G L +G+++RWFVL   K  L YY
Sbjct: 22  GYLNKKGELNRGYQRRWFVL---KGNLLYY 48


>UniRef50_A2DYR8 Cluster: PH domain containing protein; n=1;
           Trichomonas vaginalis G3|Rep: PH domain containing
           protein - Trichomonas vaginalis G3
          Length = 101

 Score = 31.9 bits (69), Expect = 4.5
 Identities = 16/40 (40%), Positives = 23/40 (57%)
 Frame = -3

Query: 241 KRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDL 122
           K G+ +K WK+RWFVL S    LRY++       KG+  +
Sbjct: 12  KLGSRVKNWKRRWFVLLS-DGSLRYFEDKITFSEKGYYQI 50


>UniRef50_A2DGQ9 Cluster: ARF GAP-like zinc finger-containing
           protein; n=1; Trichomonas vaginalis G3|Rep: ARF GAP-like
           zinc finger-containing protein - Trichomonas vaginalis
           G3
          Length = 751

 Score = 31.9 bits (69), Expect = 4.5
 Identities = 25/89 (28%), Positives = 46/89 (51%), Gaps = 1/89 (1%)
 Frame = -3

Query: 271 REQNARGHLYKR-GALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDLAEVIAVTQA 95
           + +N +G+L+K+ G L   WK+R+F++ +    L Y  ++ED   K   D++ + +  + 
Sbjct: 262 QSRNMQGYLWKKCGRLAVSWKRRFFIISNC--ILTYSKSVEDIDRKP-QDISLLYSSVRP 318

Query: 94  TPAPGPPKKCDDRSFFDLRTSRRTYNFCA 8
            P    P  C     F ++T  R+Y F A
Sbjct: 319 DPNAARP-HC-----FTIQTKERSYTFQA 341


>UniRef50_Q6BNF1 Cluster: Debaryomyces hansenii chromosome E of
           strain CBS767 of Debaryomyces hansenii; n=2;
           Saccharomycetaceae|Rep: Debaryomyces hansenii chromosome
           E of strain CBS767 of Debaryomyces hansenii -
           Debaryomyces hansenii (Yeast) (Torulaspora hansenii)
          Length = 323

 Score = 31.9 bits (69), Expect = 4.5
 Identities = 23/85 (27%), Positives = 38/85 (44%), Gaps = 1/85 (1%)
 Frame = -3

Query: 256 RGHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMED-SHCKGFIDLAEVIAVTQATPAPG 80
           +G+LYK       W++ +F+L +    L  Y   +D SH   F  + ++I V +  P   
Sbjct: 223 QGYLYKLRKRYNQWRKFYFILSN--RSLYVYKHRDDISHVHKFFPIDDIIDVIELDPVSK 280

Query: 79  PPKKCDDRSFFDLRTSRRTYNFCAS 5
             + C     F + T  +   FCAS
Sbjct: 281 TKQWC-----FLIITPLKRMKFCAS 300


>UniRef50_Q9NYT0 Cluster: Pleckstrin-2; n=22; Euteleostomi|Rep:
           Pleckstrin-2 - Homo sapiens (Human)
          Length = 353

 Score = 31.9 bits (69), Expect = 4.5
 Identities = 14/30 (46%), Positives = 19/30 (63%)
 Frame = -3

Query: 253 GHLYKRGALLKGWKQRWFVLDSIKHQLRYY 164
           G L KRG ++  WK RWF+L   ++ L YY
Sbjct: 9   GFLVKRGHIVHNWKARWFILR--QNTLVYY 36



 Score = 31.1 bits (67), Expect = 7.9
 Identities = 15/38 (39%), Positives = 21/38 (55%)
 Frame = -3

Query: 256 RGHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSH 143
           +G+L K+G   K WK R FVL      L YYD  ++ +
Sbjct: 251 QGYLAKQGHKRKNWKVRRFVLRKDPAFLHYYDPSKEEN 288


>UniRef50_P54644 Cluster: RAC family serine/threonine-protein kinase
           homolog; n=2; Dictyostelium discoideum|Rep: RAC family
           serine/threonine-protein kinase homolog - Dictyostelium
           discoideum (Slime mold)
          Length = 444

 Score = 31.9 bits (69), Expect = 4.5
 Identities = 25/82 (30%), Positives = 36/82 (43%)
 Frame = -3

Query: 253 GHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDLAEVIAVTQATPAPGPP 74
           G L K G   K WK+RWF+L      L YY        KG +    VI +  +       
Sbjct: 10  GFLTKEGGGFKSWKKRWFILKG--GDLSYYKT------KGELVPLGVIHLNTSGHIKNSD 61

Query: 73  KKCDDRSFFDLRTSRRTYNFCA 8
           +K    + F+++T  RTY  C+
Sbjct: 62  RK-KRVNGFEVQTPSRTYFLCS 82


>UniRef50_UPI00015B5B5D Cluster: PREDICTED: similar to conserved
           hypothetical protein; n=1; Nasonia vitripennis|Rep:
           PREDICTED: similar to conserved hypothetical protein -
           Nasonia vitripennis
          Length = 1557

 Score = 31.5 bits (68), Expect = 6.0
 Identities = 30/91 (32%), Positives = 43/91 (47%), Gaps = 3/91 (3%)
 Frame = -3

Query: 268 EQNARGHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDLAEVIAVTQATP 89
           + +A G+L+KR A    W+ RWFVL   ++ L YY+    S   G I L E     +   
Sbjct: 27  DHSAAGYLHKRTADSAKWQLRWFVL--YQNILFYYENEACSRPSGVI-LLEGCYCDRLIT 83

Query: 88  APGPPKKCDDRSFFDL---RTSRRTYNFCAS 5
           A G  K  D +  F +   R ++R Y   AS
Sbjct: 84  AKG--KDSDKQICFAISYRRENQRQYELKAS 112


>UniRef50_UPI0000E47083 Cluster: PREDICTED: similar to
           phosphoinositol 4-phosphate adaptor protein-2; n=3;
           Strongylocentrotus purpuratus|Rep: PREDICTED: similar to
           phosphoinositol 4-phosphate adaptor protein-2 -
           Strongylocentrotus purpuratus
          Length = 511

 Score = 31.5 bits (68), Expect = 6.0
 Identities = 16/38 (42%), Positives = 22/38 (57%), Gaps = 2/38 (5%)
 Frame = -3

Query: 226 LKGWKQRWFVLDSIKHQLRYYDAMEDSH--CKGFIDLA 119
           L  W+ RWFVLD  K  L YY + ++    CKG + +A
Sbjct: 3   LISWQPRWFVLD--KGILTYYKSQDEMQQGCKGSVKMA 38


>UniRef50_Q4SBF8 Cluster: Chromosome 11 SCAF14674, whole genome
           shotgun sequence; n=1; Tetraodon nigroviridis|Rep:
           Chromosome 11 SCAF14674, whole genome shotgun sequence -
           Tetraodon nigroviridis (Green puffer)
          Length = 240

 Score = 31.5 bits (68), Expect = 6.0
 Identities = 16/32 (50%), Positives = 18/32 (56%)
 Frame = -3

Query: 256 RGHLYKRGALLKGWKQRWFVLDSIKHQLRYYD 161
           RG L K+G   K WK R FVL S    L Y+D
Sbjct: 206 RGFLLKQGHRRKNWKVRLFVLRSEPAFLHYFD 237


>UniRef50_Q4RT07 Cluster: Oxysterol-binding protein; n=5;
           Euteleostomi|Rep: Oxysterol-binding protein - Tetraodon
           nigroviridis (Green puffer)
          Length = 835

 Score = 31.5 bits (68), Expect = 6.0
 Identities = 18/53 (33%), Positives = 29/53 (54%)
 Frame = -3

Query: 256 RGHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDLAEVIAVTQ 98
           +G L+K    LKG+++RWFVL +    L YY A E S     + ++    +T+
Sbjct: 24  KGWLFKWTNYLKGYQRRWFVLSN--GLLSYYRAEEISRSLALLIISAFTLLTR 74


>UniRef50_Q4RNH3 Cluster: Chromosome undetermined SCAF15013, whole
           genome shotgun sequence; n=1; Tetraodon
           nigroviridis|Rep: Chromosome undetermined SCAF15013,
           whole genome shotgun sequence - Tetraodon nigroviridis
           (Green puffer)
          Length = 548

 Score = 31.5 bits (68), Expect = 6.0
 Identities = 15/52 (28%), Positives = 31/52 (59%)
 Frame = -3

Query: 253 GHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDLAEVIAVTQ 98
           G+  K+GA+++ WK+R+F+L+  ++ + Y+ +  +      I L EV  V +
Sbjct: 250 GYCVKQGAVMRNWKRRYFLLE--ENAMSYFKSDSEKEPLRKIPLKEVHKVQE 299


>UniRef50_Q552C1 Cluster: Pleckstrin homology (PH) domain-containing
           protein; n=1; Dictyostelium discoideum AX4|Rep:
           Pleckstrin homology (PH) domain-containing protein -
           Dictyostelium discoideum AX4
          Length = 1555

 Score = 31.5 bits (68), Expect = 6.0
 Identities = 14/30 (46%), Positives = 19/30 (63%)
 Frame = -3

Query: 253 GHLYKRGALLKGWKQRWFVLDSIKHQLRYY 164
           G+L K+G  ++ WK RWFVL   +  L YY
Sbjct: 63  GYLTKQGGRIQNWKIRWFVLK--RGTLSYY 90


>UniRef50_Q23ND4 Cluster: Putative uncharacterized protein; n=1;
           Tetrahymena thermophila SB210|Rep: Putative
           uncharacterized protein - Tetrahymena thermophila SB210
          Length = 1615

 Score = 31.5 bits (68), Expect = 6.0
 Identities = 16/48 (33%), Positives = 25/48 (52%)
 Frame = -3

Query: 265 QNARGHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDL 122
           QN +G   K+G   K   QR+F ++S  +QL YY        +G ++L
Sbjct: 20  QNDKGRFLKQGKTFKMISQRYFTINS--NQLVYYKEKTSQKIRGIVNL 65


>UniRef50_Q1RLE3 Cluster: Zinc finger protein; n=1; Ciona
           intestinalis|Rep: Zinc finger protein - Ciona
           intestinalis (Transparent sea squirt)
          Length = 1330

 Score = 31.5 bits (68), Expect = 6.0
 Identities = 25/88 (28%), Positives = 47/88 (53%), Gaps = 2/88 (2%)
 Frame = -3

Query: 259 ARGHLYKRGALLKG-WKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDLAEVIAVTQATPAP 83
           ARG    + AL +G +++R  VL++  +  +YYD  + +  K  ++ +++I++    P  
Sbjct: 501 ARGLTLIKSALQQGEFQKRMCVLEN--NCFKYYDPDKTNILKDEVECSDLISIGICQPEQ 558

Query: 82  GPPKKCDDRSFFDL-RTSRRTYNFCASR 2
               K   +  F++ R + RTY FCA R
Sbjct: 559 AT--KAGFQHCFEVSRNTGRTYLFCADR 584


>UniRef50_A7SUD4 Cluster: Predicted protein; n=1; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 488

 Score = 31.5 bits (68), Expect = 6.0
 Identities = 18/50 (36%), Positives = 29/50 (58%), Gaps = 2/50 (4%)
 Frame = -3

Query: 259 ARGHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDS--HCKGFIDLAE 116
           ++G+L K    L GW++RW VL   +  L YY +  D+   C+G I +A+
Sbjct: 28  SQGYLSKWTNYLHGWQERWVVLR--EGTLSYYKSEFDTAFGCRGSISMAK 75


>UniRef50_A2FS37 Cluster: PH domain containing protein; n=1;
           Trichomonas vaginalis G3|Rep: PH domain containing
           protein - Trichomonas vaginalis G3
          Length = 107

 Score = 31.5 bits (68), Expect = 6.0
 Identities = 15/30 (50%), Positives = 18/30 (60%)
 Frame = -3

Query: 253 GHLYKRGALLKGWKQRWFVLDSIKHQLRYY 164
           G   K G  +K WK+RWFVL    H LRY+
Sbjct: 12  GWAVKLGQRVKSWKRRWFVLLGNGH-LRYF 40


>UniRef50_A1Z814 Cluster: Oxysterol-binding protein; n=3;
           Diptera|Rep: Oxysterol-binding protein - Drosophila
           melanogaster (Fruit fly)
          Length = 779

 Score = 31.5 bits (68), Expect = 6.0
 Identities = 17/40 (42%), Positives = 23/40 (57%)
 Frame = -3

Query: 253 GHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKG 134
           G L K   ++KGW+ R+FVLD     L YY + +D   KG
Sbjct: 26  GTLSKWTNVMKGWQYRFFVLDENAGLLSYYTS-KDKMIKG 64


>UniRef50_Q6NSF8 Cluster: PLEKHA5 protein; n=18; Euteleostomi|Rep:
           PLEKHA5 protein - Homo sapiens (Human)
          Length = 320

 Score = 31.5 bits (68), Expect = 6.0
 Identities = 27/83 (32%), Positives = 38/83 (45%), Gaps = 1/83 (1%)
 Frame = -3

Query: 256 RGHLYKRGAL-LKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDLAEVIAVTQATPAPG 80
           RG LYK+ +  +K WK+RWFVL  +   L YY   ++    G I L     +   T    
Sbjct: 173 RGWLYKQDSTGMKLWKKRWFVLSDL--CLFYYRDEKEEGILGSI-LLPSFQIALLTSEDH 229

Query: 79  PPKKCDDRSFFDLRTSRRTYNFC 11
             +K    +F     + RTY FC
Sbjct: 230 INRK---YAFKAAHPNMRTYYFC 249


>UniRef50_Q5KA89 Cluster: Signal transducer, putative; n=1;
           Filobasidiella neoformans|Rep: Signal transducer,
           putative - Cryptococcus neoformans (Filobasidiella
           neoformans)
          Length = 1151

 Score = 31.5 bits (68), Expect = 6.0
 Identities = 14/40 (35%), Positives = 23/40 (57%)
 Frame = -3

Query: 277 RRREQNARGHLYKRGALLKGWKQRWFVLDSIKHQLRYYDA 158
           +R +    G+L K+G    GWK R+FVL+     + YY++
Sbjct: 519 KRSDARKEGYLTKKGKNFGGWKTRYFVLNG--PVMEYYES 556


>UniRef50_A3M0F7 Cluster: RHO protein signal transduction; n=1;
           Pichia stipitis|Rep: RHO protein signal transduction -
           Pichia stipitis (Yeast)
          Length = 936

 Score = 31.5 bits (68), Expect = 6.0
 Identities = 15/50 (30%), Positives = 25/50 (50%)
 Frame = -3

Query: 271 REQNARGHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDL 122
           +  N  G + KR +    W+ R+F L   +  L Y+ ++ D   KG ID+
Sbjct: 602 KSANYSGWMSKRSSNTLAWRSRYFTLHGTR--LSYFASLRDKKEKGLIDI 649


>UniRef50_Q9HAU0 Cluster: Pleckstrin homology domain-containing
           family A member 5; n=6; Eutheria|Rep: Pleckstrin
           homology domain-containing family A member 5 - Homo
           sapiens (Human)
          Length = 1116

 Score = 31.5 bits (68), Expect = 6.0
 Identities = 27/83 (32%), Positives = 38/83 (45%), Gaps = 1/83 (1%)
 Frame = -3

Query: 256 RGHLYKRGAL-LKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDLAEVIAVTQATPAPG 80
           RG LYK+ +  +K WK+RWFVL  +   L YY   ++    G I L     +   T    
Sbjct: 173 RGWLYKQDSTGMKLWKKRWFVLSDL--CLFYYRDEKEEGILGSI-LLPSFQIALLTSEDH 229

Query: 79  PPKKCDDRSFFDLRTSRRTYNFC 11
             +K    +F     + RTY FC
Sbjct: 230 INRK---YAFKAAHPNMRTYYFC 249


>UniRef50_Q15027 Cluster: Centaurin-beta 1; n=12; Eutheria|Rep:
           Centaurin-beta 1 - Homo sapiens (Human)
          Length = 740

 Score = 31.5 bits (68), Expect = 6.0
 Identities = 14/34 (41%), Positives = 21/34 (61%), Gaps = 3/34 (8%)
 Frame = -3

Query: 253 GHLYKRGA-LLKGWKQRWFVLDS--IKHQLRYYD 161
           GHL+KR +   K W +RWF + S  + +Q +Y D
Sbjct: 270 GHLFKRASNAFKTWSRRWFTIQSNQLVYQKKYKD 303


>UniRef50_UPI0000F2B0A5 Cluster: PREDICTED: hypothetical protein;
           n=2; Mammalia|Rep: PREDICTED: hypothetical protein -
           Monodelphis domestica
          Length = 487

 Score = 31.1 bits (67), Expect = 7.9
 Identities = 10/38 (26%), Positives = 21/38 (55%)
 Frame = -3

Query: 217 WKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDLAEVIAV 104
           WK R+F+L   +         +D HC+G I++ ++ ++
Sbjct: 58  WKSRYFILSKNEENCYSLQYFKDHHCRGSIEVDQISSI 95


>UniRef50_UPI0000D5747C Cluster: PREDICTED: similar to CG14366-PA;
           n=1; Tribolium castaneum|Rep: PREDICTED: similar to
           CG14366-PA - Tribolium castaneum
          Length = 723

 Score = 31.1 bits (67), Expect = 7.9
 Identities = 18/44 (40%), Positives = 27/44 (61%), Gaps = 1/44 (2%)
 Frame = -3

Query: 256 RGHLYKRGAL-LKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFI 128
           +G L+K+G+  L  WK+RWFVL   ++ L YY + E+    G I
Sbjct: 149 QGWLHKQGSEGLMLWKKRWFVLS--EYCLFYYKSPEEEKLLGSI 190


>UniRef50_UPI000065DF70 Cluster: Pleckstrin homology
           domain-containing family A member 2 (Tandem PH
           domain-containing protein 2) (TAPP-2).; n=1; Takifugu
           rubripes|Rep: Pleckstrin homology domain-containing
           family A member 2 (Tandem PH domain-containing protein
           2) (TAPP-2). - Takifugu rubripes
          Length = 413

 Score = 31.1 bits (67), Expect = 7.9
 Identities = 22/74 (29%), Positives = 36/74 (48%)
 Frame = -3

Query: 241 KRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDLAEVIAVTQATPAPGPPKKCD 62
           K+G + K WK+R+F LD   + + YY +  D      I L ++  V +     G     D
Sbjct: 207 KQGNVRKSWKRRFFTLDD--NAVSYYKSDMDKEPLRSIPLRDIQKVHECLVKSGDLLLRD 264

Query: 61  DRSFFDLRTSRRTY 20
             + F++ TS RT+
Sbjct: 265 --NLFEIITSFRTF 276


>UniRef50_Q96CS7-2 Cluster: Isoform 2 of Q96CS7 ; n=2; Homo
           sapiens|Rep: Isoform 2 of Q96CS7 - Homo sapiens (Human)
          Length = 309

 Score = 31.1 bits (67), Expect = 7.9
 Identities = 15/31 (48%), Positives = 19/31 (61%)
 Frame = -3

Query: 253 GHLYKRGALLKGWKQRWFVLDSIKHQLRYYD 161
           G L ++  +LK WK+ WF L S  H L YYD
Sbjct: 7   GWLLRQSTILKRWKKNWFDLWSDGH-LIYYD 36


>UniRef50_Q4SRG8 Cluster: Chromosome undetermined SCAF14526, whole
           genome shotgun sequence; n=2; Tetraodontidae|Rep:
           Chromosome undetermined SCAF14526, whole genome shotgun
           sequence - Tetraodon nigroviridis (Green puffer)
          Length = 1388

 Score = 31.1 bits (67), Expect = 7.9
 Identities = 27/82 (32%), Positives = 39/82 (47%), Gaps = 1/82 (1%)
 Frame = -3

Query: 253 GHLYKR-GALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDLAEVIAVTQATPAPGP 77
           G LYK+  A +K WK+RWFVL  +   L YY   ++ +  G I L     ++  +     
Sbjct: 311 GWLYKQDSAGMKLWKKRWFVLSDL--CLFYYRDEKEDNILGSI-LLPSFHISMLSVDDHI 367

Query: 76  PKKCDDRSFFDLRTSRRTYNFC 11
            KK    +F     + RTY FC
Sbjct: 368 SKK---YAFKATHPNMRTYYFC 386


>UniRef50_Q4SNI4 Cluster: Chromosome 15 SCAF14542, whole genome
            shotgun sequence; n=4; Eumetazoa|Rep: Chromosome 15
            SCAF14542, whole genome shotgun sequence - Tetraodon
            nigroviridis (Green puffer)
          Length = 2203

 Score = 31.1 bits (67), Expect = 7.9
 Identities = 19/66 (28%), Positives = 33/66 (50%), Gaps = 5/66 (7%)
 Frame = -3

Query: 274  RREQNARGHLYKRGA-----LLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDLAEVI 110
            ++E   +G L K+G        + WK+RWFVL   + +L Y++   +   KG +D+    
Sbjct: 1319 KQEALKQGWLLKKGGGSSTLSRRNWKRRWFVLR--QSRLMYFENDGEEKMKGVLDVHAAR 1376

Query: 109  AVTQAT 92
             +  AT
Sbjct: 1377 DIVDAT 1382


>UniRef50_Q4SN92 Cluster: Chromosome 8 SCAF14543, whole genome
           shotgun sequence; n=11; Euteleostomi|Rep: Chromosome 8
           SCAF14543, whole genome shotgun sequence - Tetraodon
           nigroviridis (Green puffer)
          Length = 487

 Score = 31.1 bits (67), Expect = 7.9
 Identities = 14/40 (35%), Positives = 22/40 (55%)
 Frame = -3

Query: 241 KRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDL 122
           + G  +K WK+RWF+L    + L Y++   D   +G I L
Sbjct: 297 RSGGRVKTWKRRWFILTD--NCLYYFEYTTDKEPRGIIPL 334


>UniRef50_Q0VPC9 Cluster: ATP-dependent helicase HrpA; n=1;
           Alcanivorax borkumensis SK2|Rep: ATP-dependent helicase
           HrpA - Alcanivorax borkumensis (strain SK2 / ATCC 700651
           / DSM 11573)
          Length = 1316

 Score = 31.1 bits (67), Expect = 7.9
 Identities = 13/45 (28%), Positives = 25/45 (55%)
 Frame = -3

Query: 271 REQNARGHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCK 137
           RE    GHL++    +K  ++R+  L+ ++H+LR  D + D   +
Sbjct: 770 REGLVMGHLHREPPFVKANRERFETLEDMEHKLRRRDILVDEEAR 814


>UniRef50_A2X7I4 Cluster: Putative uncharacterized protein; n=2;
           Oryza sativa|Rep: Putative uncharacterized protein -
           Oryza sativa subsp. indica (Rice)
          Length = 711

 Score = 31.1 bits (67), Expect = 7.9
 Identities = 12/23 (52%), Positives = 18/23 (78%)
 Frame = -3

Query: 256 RGHLYKRGALLKGWKQRWFVLDS 188
           +G+L+KR    + WK+R+FVLDS
Sbjct: 244 QGYLFKRSENSREWKRRFFVLDS 266


>UniRef50_Q9VFR7 Cluster: CG14366-PA; n=1; Drosophila
           melanogaster|Rep: CG14366-PA - Drosophila melanogaster
           (Fruit fly)
          Length = 776

 Score = 31.1 bits (67), Expect = 7.9
 Identities = 17/43 (39%), Positives = 26/43 (60%), Gaps = 1/43 (2%)
 Frame = -3

Query: 253 GHLYKRGAL-LKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFI 128
           G L+K+G+  LK W++RWFVL   ++ L YY   E+    G +
Sbjct: 376 GWLHKQGSDGLKVWRKRWFVL--AEYCLYYYKGPEEEKLLGSV 416


>UniRef50_A7SJB4 Cluster: Predicted protein; n=1; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 681

 Score = 31.1 bits (67), Expect = 7.9
 Identities = 15/55 (27%), Positives = 33/55 (60%)
 Frame = -3

Query: 286 LVERRREQNARGHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDL 122
           ++   ++ + RG+L K+G   K WK+ + VLD+ + +L +++  + +  K  +DL
Sbjct: 113 IINTSQQASKRGYLVKKGHRNK-WKRMFCVLDADEQRLSFFENEKRTKPKMLLDL 166


>UniRef50_A2FLX7 Cluster: AGC family protein kinase; n=4;
           Trichomonas vaginalis G3|Rep: AGC family protein kinase
           - Trichomonas vaginalis G3
          Length = 469

 Score = 31.1 bits (67), Expect = 7.9
 Identities = 17/46 (36%), Positives = 23/46 (50%)
 Frame = -3

Query: 241 KRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDLAEVIAV 104
           K GA+ K W+ RWFVL         Y   + S   G I+L++V  V
Sbjct: 48  KLGAIFKTWRYRWFVLTQTSLS---YSKTKTSAPNGIINLSQVSEV 90


>UniRef50_A0D2Y6 Cluster: Chromosome undetermined scaffold_36, whole
           genome shotgun sequence; n=4; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_36,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 865

 Score = 31.1 bits (67), Expect = 7.9
 Identities = 12/28 (42%), Positives = 17/28 (60%)
 Frame = -3

Query: 244 YKRGALLKGWKQRWFVLDSIKHQLRYYD 161
           +K   +LKGW +R  + D I+  LRY D
Sbjct: 15  FKESGVLKGWGERLLIYDLIQQILRYID 42


>UniRef50_Q756M9 Cluster: AER225Wp; n=1; Eremothecium gossypii|Rep:
           AER225Wp - Ashbya gossypii (Yeast) (Eremothecium
           gossypii)
          Length = 1299

 Score = 31.1 bits (67), Expect = 7.9
 Identities = 16/48 (33%), Positives = 28/48 (58%), Gaps = 2/48 (4%)
 Frame = -3

Query: 256 RGHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMED--SHCKGFIDLA 119
           +G+L K     +G+K RWF+L S    L YY   +D  + C+G ++++
Sbjct: 294 KGYLRKWTNFAQGYKLRWFIL-STDGTLSYYKDQDDTANACRGSLNMS 340


>UniRef50_P20936 Cluster: Ras GTPase-activating protein 1; n=50;
           Euteleostomi|Rep: Ras GTPase-activating protein 1 - Homo
           sapiens (Human)
          Length = 1047

 Score = 31.1 bits (67), Expect = 7.9
 Identities = 17/47 (36%), Positives = 28/47 (59%), Gaps = 1/47 (2%)
 Frame = -3

Query: 256 RGHLYKRGALLKGWKQRWFVLDSIKHQLRYYDA-MEDSHCKGFIDLA 119
           +G+L K+G   K WK  +F+L+    QL Y+++    +  KG IDL+
Sbjct: 478 KGYLLKKGKG-KRWKNLYFILEGSDAQLIYFESEKRATKPKGLIDLS 523


>UniRef50_Q96CS7 Cluster: Pleckstrin homology domain-containing
           family B member 2; n=40; Euteleostomi|Rep: Pleckstrin
           homology domain-containing family B member 2 - Homo
           sapiens (Human)
          Length = 222

 Score = 31.1 bits (67), Expect = 7.9
 Identities = 15/31 (48%), Positives = 19/31 (61%)
 Frame = -3

Query: 253 GHLYKRGALLKGWKQRWFVLDSIKHQLRYYD 161
           G L ++  +LK WK+ WF L S  H L YYD
Sbjct: 7   GWLLRQSTILKRWKKNWFDLWSDGH-LIYYD 36


>UniRef50_Q27421 Cluster: Protein outspread; n=5; Sophophora|Rep:
           Protein outspread - Drosophila melanogaster (Fruit fly)
          Length = 1553

 Score = 31.1 bits (67), Expect = 7.9
 Identities = 15/50 (30%), Positives = 24/50 (48%)
 Frame = -3

Query: 223 KGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDLAEVIAVTQATPAPGPP 74
           K W++RWFVL          D   ++  +  +D+ +V+ VT A    G P
Sbjct: 94  KRWQRRWFVLYDDGELTYSVDDYPETIPQACVDMTKVLEVTSAVEVTGHP 143


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 322,917,284
Number of Sequences: 1657284
Number of extensions: 5554374
Number of successful extensions: 16871
Number of sequences better than 10.0: 218
Number of HSP's better than 10.0 without gapping: 16475
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 16856
length of database: 575,637,011
effective HSP length: 92
effective length of database: 423,166,883
effective search space used: 16080341554
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).