SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0018
         (502 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_Q4JSC0 Cluster: Actin; n=13; Coelomata|Rep: Actin - Ano...   236   2e-61
UniRef50_O65314 Cluster: Actin; n=20; Eukaryota|Rep: Actin - Sch...   228   6e-59
UniRef50_P02581 Cluster: Actin-1; n=1852; Eukaryota|Rep: Actin-1...   208   5e-53
UniRef50_P14883 Cluster: Actin-2; n=75; Eukaryota|Rep: Actin-2 -...   203   2e-51
UniRef50_Q96483 Cluster: Actin-51; n=584; Eukaryota|Rep: Actin-5...   198   6e-50
UniRef50_Q0VHZ5 Cluster: Actin deviating protein; n=7; Eukaryota...   154   1e-36
UniRef50_Q7XB26 Cluster: Ubiquitin/actin fusion protein 4; n=1; ...   149   5e-35
UniRef50_A2DKQ5 Cluster: Actin 58, putative; n=2; Trichomonas va...   145   4e-34
UniRef50_UPI0000449751 Cluster: PREDICTED: similar to gamma-acti...   144   1e-33
UniRef50_UPI000065FC19 Cluster: Homolog of Homo sapiens "Actin, ...   142   5e-33
UniRef50_Q0VHZ6 Cluster: Actin deviating protein; n=2; Bolivina ...   140   2e-32
UniRef50_UPI0000605B09 Cluster: PREDICTED: similar to actin alph...   136   3e-31
UniRef50_UPI00001E426E Cluster: PREDICTED: similar to actin-12; ...   136   3e-31
UniRef50_Q9XZB9 Cluster: Actin; n=1; Sterkiella nova|Rep: Actin ...   136   3e-31
UniRef50_A4QNT8 Cluster: Si:ch211-241j12.3 protein; n=3; Danio r...   135   6e-31
UniRef50_P61163 Cluster: Alpha-centractin; n=356; root|Rep: Alph...   134   8e-31
UniRef50_A5E2K2 Cluster: Actin; n=5; Saccharomycetales|Rep: Acti...   130   2e-29
UniRef50_Q2GY63 Cluster: Putative uncharacterized protein; n=1; ...   129   4e-29
UniRef50_UPI0000F2D825 Cluster: PREDICTED: similar to actin; n=1...   127   1e-28
UniRef50_UPI0000F2D326 Cluster: PREDICTED: similar to actin; n=1...   124   1e-27
UniRef50_UPI0000588EB0 Cluster: PREDICTED: similar to actin; n=1...   123   2e-27
UniRef50_A2FRF9 Cluster: Actin family protein; n=1; Trichomonas ...   117   2e-25
UniRef50_Q4QG59 Cluster: Actin-like protein, putative; n=3; Leis...   115   7e-25
UniRef50_Q24C02 Cluster: Actin family protein; n=3; Oligohymenop...   115   7e-25
UniRef50_UPI00005864C8 Cluster: PREDICTED: similar to Actin; n=4...   114   1e-24
UniRef50_Q4CV94 Cluster: Actin 2, putative; n=2; Trypanosoma cru...   114   1e-24
UniRef50_UPI0000E23780 Cluster: PREDICTED: hypothetical protein ...   112   4e-24
UniRef50_O96819 Cluster: Actin-related protein; n=5; Trypanosoma...   110   2e-23
UniRef50_Q5KB93 Cluster: Actin binding protein, putative; n=3; F...   107   1e-22
UniRef50_Q0J646 Cluster: Os08g0369300 protein; n=2; Oryza sativa...   105   7e-22
UniRef50_A2YUL5 Cluster: Putative uncharacterized protein; n=1; ...   105   7e-22
UniRef50_Q4N681 Cluster: Actin, putative; n=3; Piroplasmida|Rep:...   103   3e-21
UniRef50_Q8TDY3 Cluster: Actin-related protein T2; n=26; Amniota...   102   4e-21
UniRef50_UPI00015B6274 Cluster: PREDICTED: similar to putative m...   102   5e-21
UniRef50_UPI0000D9A391 Cluster: PREDICTED: actin related protein...   102   5e-21
UniRef50_A7RPC3 Cluster: Predicted protein; n=3; Eumetazoa|Rep: ...   101   7e-21
UniRef50_UPI0001554F81 Cluster: PREDICTED: similar to actin; n=1...   100   2e-20
UniRef50_UPI00005A2ACF Cluster: PREDICTED: similar to cytoplasmi...   100   2e-20
UniRef50_Q9BYD9 Cluster: Actin-related protein M1; n=12; Theria|...   100   2e-20
UniRef50_UPI0000E466A7 Cluster: PREDICTED: similar to actin, alp...    98   1e-19
UniRef50_Q9Y615 Cluster: Actin-like protein 7A; n=11; Mammalia|R...    97   2e-19
UniRef50_P61160 Cluster: Actin-related protein 2; n=96; Eukaryot...    96   3e-19
UniRef50_Q55DS6 Cluster: Putative uncharacterized protein; n=1; ...    96   5e-19
UniRef50_Q54UQ7 Cluster: Actin-like protein 6A; n=1; Dictyosteli...    96   5e-19
UniRef50_UPI00006C1719 Cluster: PREDICTED: similar to actin, alp...    95   8e-19
UniRef50_A2DBN6 Cluster: Actin family protein; n=1; Trichomonas ...    94   1e-18
UniRef50_Q5C683 Cluster: SJCHGC08418 protein; n=1; Schistosoma j...    93   2e-18
UniRef50_Q38F20 Cluster: Actin-like protein 3, putative; n=1; Tr...    93   3e-18
UniRef50_A0E1S8 Cluster: Chromosome undetermined scaffold_73, wh...    89   5e-17
UniRef50_Q8LKR2 Cluster: Actin-related protein 4; n=7; core eudi...    89   7e-17
UniRef50_A7QKV4 Cluster: Chromosome chr8 scaffold_115, whole gen...    89   7e-17
UniRef50_A7S2B1 Cluster: Predicted protein; n=1; Nematostella ve...    88   9e-17
UniRef50_Q9Y614 Cluster: Actin-like protein 7B; n=12; Theria|Rep...    85   1e-15
UniRef50_Q55DY5 Cluster: Putative uncharacterized protein; n=1; ...    84   2e-15
UniRef50_UPI0000E47BC7 Cluster: PREDICTED: similar to ubiquitin/...    82   6e-15
UniRef50_A2FH22 Cluster: Actin family protein; n=1; Trichomonas ...    82   8e-15
UniRef50_A2ECQ8 Cluster: Actin family protein; n=1; Trichomonas ...    82   8e-15
UniRef50_Q6X960 Cluster: HSD21; n=13; Theria|Rep: HSD21 - Homo s...    81   1e-14
UniRef50_Q7M3B0 Cluster: Actin beta; n=1; Sus scrofa domestica|R...    81   2e-14
UniRef50_P61158 Cluster: Actin-related protein 3; n=107; Eukaryo...    81   2e-14
UniRef50_Q54JL1 Cluster: Putative uncharacterized protein; n=1; ...    79   4e-14
UniRef50_Q8MVN5 Cluster: Cardiac actin-like protein; n=1; Bolten...    79   6e-14
UniRef50_A0CQQ2 Cluster: Chromosome undetermined scaffold_24, wh...    79   6e-14
UniRef50_P32392 Cluster: Actin-related protein 3; n=27; Eukaryot...    78   1e-13
UniRef50_Q4DMP2 Cluster: Actin-related protein 2, putative; n=4;...    78   1e-13
UniRef50_Q6FRF2 Cluster: Similar to sp|P38696 Saccharomyces cere...    78   1e-13
UniRef50_Q4SGD5 Cluster: Chromosome 17 SCAF14597, whole genome s...    77   3e-13
UniRef50_A2VD47 Cluster: Zgc:158823 protein; n=3; Eukaryota|Rep:...    77   3e-13
UniRef50_UPI000049A548 Cluster: actin; n=1; Entamoeba histolytic...    76   5e-13
UniRef50_UPI0000F2DE11 Cluster: PREDICTED: similar to testis-spe...    75   9e-13
UniRef50_UPI0000EBF019 Cluster: PREDICTED: similar to ribosomal ...    75   1e-12
UniRef50_A4RW28 Cluster: Predicted protein; n=2; Ostreococcus|Re...    75   1e-12
UniRef50_Q8IS27 Cluster: Actin-related protein 2; n=5; Oligohyme...    75   1e-12
UniRef50_Q5CSX9 Cluster: Actin; n=2; Cryptosporidium|Rep: Actin ...    74   2e-12
UniRef50_A2DNQ0 Cluster: Actin family protein; n=1; Trichomonas ...    74   2e-12
UniRef50_Q6BG22 Cluster: Actin, putative; n=2; Paramecium tetrau...    73   4e-12
UniRef50_Q383R8 Cluster: Actin-like protein, putative; n=4; Tryp...    73   4e-12
UniRef50_UPI0000449ED3 Cluster: PREDICTED: similar to RIKEN cDNA...    72   8e-12
UniRef50_Q9DFB8 Cluster: Actin; n=1; Scomberomorus maculatus|Rep...    71   1e-11
UniRef50_UPI0000F2D272 Cluster: PREDICTED: similar to actin; n=1...    71   2e-11
UniRef50_Q9P7X7 Cluster: Actin-related protein 4; n=1; Schizosac...    70   3e-11
UniRef50_Q14BL3 Cluster: RIKEN cDNA 4921517D21 gene; n=7; Euther...    69   4e-11
UniRef50_Q8IIQ4 Cluster: Actin, putative; n=7; Apicomplexa|Rep: ...    67   2e-10
UniRef50_Q4N7N1 Cluster: Actin, putative; n=2; Theileria|Rep: Ac...    66   3e-10
UniRef50_O96019 Cluster: Actin-like protein 6A; n=63; Eumetazoa|...    66   6e-10
UniRef50_UPI00005A3B5D Cluster: PREDICTED: similar to Actin-5C; ...    65   7e-10
UniRef50_Q4Q187 Cluster: Actin-like protein, putative; n=3; Leis...    65   7e-10
UniRef50_Q4QF44 Cluster: Actin-related protein 3, putative; n=3;...    65   1e-09
UniRef50_Q9Y7X8 Cluster: Actin-like protein Arp5; n=1; Schizosac...    64   1e-09
UniRef50_Q19R56 Cluster: Actin-like protein 3; n=4; Trypanosoma ...    64   2e-09
UniRef50_A2DEE0 Cluster: Actin family protein; n=1; Trichomonas ...    64   2e-09
UniRef50_Q9SRK2 Cluster: Putative actin; n=1; Arabidopsis thalia...    62   5e-09
UniRef50_A2YQV6 Cluster: Putative uncharacterized protein; n=1; ...    62   5e-09
UniRef50_A5B4L4 Cluster: Putative uncharacterized protein; n=1; ...    62   7e-09
UniRef50_Q19R57 Cluster: Actin-like protein 1; n=2; Trypanosoma ...    61   2e-08
UniRef50_Q8LKR0 Cluster: Actin-related protein 6; n=26; Magnolio...    60   2e-08
UniRef50_UPI0000EC9F4D Cluster: HSD21.; n=2; Gallus gallus|Rep: ...    60   3e-08
UniRef50_Q6C061 Cluster: Actin-related protein 4; n=1; Yarrowia ...    60   4e-08
UniRef50_Q9H568 Cluster: Actin-like protein 8; n=10; Eutheria|Re...    59   5e-08
UniRef50_Q6C0A9 Cluster: Yarrowia lipolytica chromosome F of str...    59   6e-08
UniRef50_A6R1X8 Cluster: Putative uncharacterized protein; n=1; ...    58   8e-08
UniRef50_Q09849 Cluster: Uncharacterized protein C23D3.09; n=1; ...    58   8e-08
UniRef50_Q5C3R3 Cluster: SJCHGC08022 protein; n=1; Schistosoma j...    58   1e-07
UniRef50_A2EUM6 Cluster: Actin family protein; n=1; Trichomonas ...    58   1e-07
UniRef50_Q54E71 Cluster: Putative uncharacterized protein; n=1; ...    58   1e-07
UniRef50_Q7S6X6 Cluster: Actin-like protein arp-6; n=5; Pezizomy...    57   3e-07
UniRef50_UPI0000E4A0BF Cluster: PREDICTED: similar to Actin-rela...    56   3e-07
UniRef50_P80428 Cluster: Actin-related protein 4; n=4; Saccharom...    56   3e-07
UniRef50_A3BPG0 Cluster: Putative uncharacterized protein; n=3; ...    56   4e-07
UniRef50_UPI0000499930 Cluster: actin; n=1; Entamoeba histolytic...    56   6e-07
UniRef50_UPI0000498FDF Cluster: actin; n=1; Entamoeba histolytic...    54   2e-06
UniRef50_Q9LHH0 Cluster: Actin-like protein; n=11; Magnoliophyta...    54   2e-06
UniRef50_A0D9D5 Cluster: Chromosome undetermined scaffold_42, wh...    54   2e-06
UniRef50_Q0V0G6 Cluster: Putative uncharacterized protein; n=1; ...    54   2e-06
UniRef50_Q17GZ9 Cluster: Actin-related protein 5; n=4; Endoptery...    54   2e-06
UniRef50_Q54KZ7 Cluster: Putative uncharacterized protein; n=1; ...    53   3e-06
UniRef50_Q22WQ4 Cluster: Actin family protein; n=1; Tetrahymena ...    53   3e-06
UniRef50_Q6BIA3 Cluster: CA5059|IPF3691 Candida albicans IPF3691...    53   4e-06
UniRef50_A7TM96 Cluster: Putative uncharacterized protein; n=1; ...    53   4e-06
UniRef50_Q2H0E9 Cluster: Putative uncharacterized protein; n=1; ...    52   6e-06
UniRef50_A1C924 Cluster: Actin family protein; n=4; Eurotiomycet...    52   6e-06
UniRef50_UPI0000F2D271 Cluster: PREDICTED: similar to actin-like...    52   1e-05
UniRef50_UPI0000E80C06 Cluster: PREDICTED: hypothetical protein;...    52   1e-05
UniRef50_Q00UL2 Cluster: Alpha amylase 1; n=3; Ostreococcus|Rep:...    52   1e-05
UniRef50_Q5KAQ4 Cluster: Actin-like protein ARP6; n=1; Filobasid...    52   1e-05
UniRef50_Q9N4N4 Cluster: Putative uncharacterized protein; n=2; ...    51   1e-05
UniRef50_Q6CSB9 Cluster: Actin-related protein 4; n=1; Kluyverom...    51   1e-05
UniRef50_Q18PR4 Cluster: Actin-related protein; n=1; Porphyra ye...    51   2e-05
UniRef50_UPI0000498A93 Cluster: actin; n=1; Entamoeba histolytic...    50   2e-05
UniRef50_Q5CKL2 Cluster: BRG1/brm-associated factor 53A; n=2; Cr...    50   2e-05
UniRef50_Q75JT2 Cluster: Similar to Drosophila melanogaster (Fru...    50   3e-05
UniRef50_Q4WA13 Cluster: Chromatin remodeling complex subunit (A...    50   4e-05
UniRef50_Q12406 Cluster: Actin-related protein 7; n=2; Saccharom...    50   4e-05
UniRef50_Q6BXN0 Cluster: Actin-related protein 4; n=7; Saccharom...    49   5e-05
UniRef50_Q7QA11 Cluster: ENSANGP00000003921; n=1; Anopheles gamb...    49   7e-05
UniRef50_Q5AXH1 Cluster: Actin-like protein arp6; n=5; Trichocom...    48   9e-05
UniRef50_UPI00004987CF Cluster: actin; n=2; Entamoeba histolytic...    48   2e-04
UniRef50_Q9VEC3 Cluster: Actin-related protein 5; n=1; Drosophil...    48   2e-04
UniRef50_Q7SHR0 Cluster: Actin-related protein 4; n=16; Pezizomy...    48   2e-04
UniRef50_Q6CF37 Cluster: Similar to sp|P53946 Saccharomyces cere...    47   2e-04
UniRef50_A7TST0 Cluster: Putative uncharacterized protein; n=1; ...    46   4e-04
UniRef50_Q09443 Cluster: Actin-like protein C08B11.6; n=2; Caeno...    46   6e-04
UniRef50_A7QZ13 Cluster: Chromosome undetermined scaffold_261, w...    45   0.001
UniRef50_Q7SXV8 Cluster: ARP5 actin-related protein 5 homolog; n...    44   0.001
UniRef50_Q9LZY1 Cluster: Actin-like protein; n=4; core eudicotyl...    44   0.002
UniRef50_Q6C982 Cluster: Actin-like protein ARP6; n=1; Yarrowia ...    44   0.002
UniRef50_P53946 Cluster: Actin-related protein 5; n=7; Saccharom...    44   0.002
UniRef50_A4S826 Cluster: Predicted protein; n=1; Ostreococcus lu...    44   0.003
UniRef50_Q6BG23 Cluster: Actin, putative; n=1; Paramecium tetrau...    44   0.003
UniRef50_Q5KLG9 Cluster: 53 kDa brg1-associated factor b (Actin-...    44   0.003
UniRef50_A6RD01 Cluster: Putative uncharacterized protein; n=1; ...    44   0.003
UniRef50_A5E5Q2 Cluster: Putative uncharacterized protein; n=1; ...    43   0.003
UniRef50_Q10CH7 Cluster: Actin-related protein 7, putative, expr...    43   0.004
UniRef50_P45890 Cluster: Actin-like protein 13E; n=8; Eumetazoa|...    42   0.006
UniRef50_Q293V2 Cluster: Actin-related protein 5; n=2; Drosophil...    42   0.006
UniRef50_Q4P303 Cluster: Putative uncharacterized protein; n=1; ...    42   0.008
UniRef50_Q7M3Y5 Cluster: Actin; n=1; Aplysia californica|Rep: Ac...    42   0.010
UniRef50_Q6BML9 Cluster: Actin-like protein ARP6; n=3; Saccharom...    41   0.014
UniRef50_Q4P2E8 Cluster: Actin-related protein 4; n=1; Ustilago ...    41   0.014
UniRef50_A7AS14 Cluster: Actin, putative; n=1; Babesia bovis|Rep...    41   0.018
UniRef50_Q6FMT7 Cluster: Similar to sp|Q12406 Saccharomyces cere...    41   0.018
UniRef50_Q0IFH2 Cluster: Actin; n=4; Endopterygota|Rep: Actin - ...    40   0.024
UniRef50_Q0H7S7 Cluster: Actin; n=29; Sordariomycetes|Rep: Actin...    40   0.042
UniRef50_UPI00006CC3F4 Cluster: Actin family protein; n=1; Tetra...    39   0.055
UniRef50_Q3M0X0 Cluster: Actin6-2; n=3; Paramecium tetraurelia|R...    39   0.055
UniRef50_Q75BT7 Cluster: ACR184Cp; n=1; Eremothecium gossypii|Re...    39   0.055
UniRef50_Q9NZ32 Cluster: Actin-related protein 10; n=40; Eumetaz...    39   0.073
UniRef50_A3M088 Cluster: Vacuolar targeting, actin-related prote...    38   0.096
UniRef50_A3FQE6 Cluster: Putative uncharacterized protein; n=2; ...    38   0.13 
UniRef50_Q9H9F9 Cluster: Actin-related protein 5; n=19; Euteleos...    38   0.17 
UniRef50_Q19R70 Cluster: Actin-like protein 3; n=4; Leishmania|R...    37   0.22 
UniRef50_A7AQU0 Cluster: Actin-related, putative; n=1; Babesia b...    37   0.22 
UniRef50_Q4UGT7 Cluster: Actin-related protein, putative; n=2; T...    37   0.29 
UniRef50_Q22XS7 Cluster: Actin family protein; n=1; Tetrahymena ...    36   0.39 
UniRef50_Q19R52 Cluster: ALP5; n=6; Trypanosomatidae|Rep: ALP5 -...    36   0.39 
UniRef50_UPI0000E46266 Cluster: PREDICTED: similar to actin; n=1...    36   0.51 
UniRef50_Q5AP59 Cluster: Actin-like protein ARP6; n=2; Saccharom...    36   0.51 
UniRef50_Q8I450 Cluster: Actin-related protein, putative; n=5; P...    35   1.2  
UniRef50_Q7RR61 Cluster: Actin-like 6; n=3; Plasmodium (Vinckeia...    34   1.6  
UniRef50_Q9GZN1 Cluster: Actin-related protein 6; n=26; Chordata...    34   1.6  
UniRef50_Q7QV72 Cluster: GLP_438_30160_28841; n=1; Giardia lambl...    34   2.1  
UniRef50_A2DVJ3 Cluster: Actin family protein; n=1; Trichomonas ...    34   2.1  
UniRef50_UPI0000E477BD Cluster: PREDICTED: similar to uncharacte...    33   2.7  
UniRef50_A5KAY0 Cluster: Actin-related protein, putative; n=1; P...    33   2.7  
UniRef50_UPI000065E8AF Cluster: bromo adjacent homology domain c...    33   3.6  
UniRef50_Q8SRZ3 Cluster: ACTIN-RELATED PROTEIN; n=1; Encephalito...    33   3.6  
UniRef50_Q7S2J0 Cluster: Predicted protein; n=1; Neurospora cras...    33   3.6  
UniRef50_UPI0000E254E7 Cluster: PREDICTED: similar to putative c...    33   4.8  
UniRef50_A7DFE1 Cluster: Prophage LambdaW4, terminase large subu...    33   4.8  
UniRef50_Q8ILM5 Cluster: Actin, putative; n=1; Plasmodium falcip...    33   4.8  
UniRef50_Q8AXX1 Cluster: Putative gag protein; n=1; Danio rerio|...    32   6.3  
UniRef50_Q5BXM4 Cluster: SJCHGC05761 protein; n=1; Schistosoma j...    32   6.3  
UniRef50_Q2PE20 Cluster: CG10067-PB, isoform B; n=1; Drosophila ...    32   6.3  
UniRef50_Q16HG2 Cluster: PAF acetylhydrolase 45 kDa subunit, put...    32   6.3  
UniRef50_Q0W6D4 Cluster: Putative uncharacterized protein; n=1; ...    32   6.3  
UniRef50_Q9C073 Cluster: Protein FAM117A; n=17; Amniota|Rep: Pro...    32   6.3  
UniRef50_UPI00015B86FC Cluster: UPI00015B86FC related cluster; n...    32   8.3  
UniRef50_A2PZD1 Cluster: Putative uncharacterized protein EZY20;...    32   8.3  
UniRef50_Q6V7P1 Cluster: Gp51; n=1; Burkholderia phage Bcep22|Re...    32   8.3  
UniRef50_A2FYS8 Cluster: Actin family protein; n=1; Trichomonas ...    32   8.3  
UniRef50_Q4P230 Cluster: Putative uncharacterized protein; n=1; ...    32   8.3  

>UniRef50_Q4JSC0 Cluster: Actin; n=13; Coelomata|Rep: Actin -
           Anopheles gambiae (African malaria mosquito)
          Length = 376

 Score =  236 bits (578), Expect = 2e-61
 Identities = 104/115 (90%), Positives = 110/115 (95%)
 Frame = +2

Query: 83  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHK 262
           MCD++  ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMG KD+YVGD  +
Sbjct: 1   MCDDDAGALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGNKDAYVGDEAQ 60

Query: 263 SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           SKRGILTLKYPIEHGI+TNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPK+
Sbjct: 61  SKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKS 115


>UniRef50_O65314 Cluster: Actin; n=20; Eukaryota|Rep: Actin -
           Scherffelia dubia
          Length = 378

 Score =  228 bits (557), Expect = 6e-59
 Identities = 103/113 (91%), Positives = 108/113 (95%)
 Frame = +2

Query: 89  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHKSK 268
           D EV+ALV DNGSGM KAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKD+YVGD  +SK
Sbjct: 5   DGEVSALVCDNGSGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDEAQSK 64

Query: 269 RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           RGILTLKYPIEHG+V+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA
Sbjct: 65  RGILTLKYPIEHGVVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 117


>UniRef50_P02581 Cluster: Actin-1; n=1852; Eukaryota|Rep: Actin-1 -
           Glycine max (Soybean)
          Length = 377

 Score =  208 bits (508), Expect = 5e-53
 Identities = 93/111 (83%), Positives = 101/111 (90%)
 Frame = +2

Query: 92  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHKSKR 271
           E++  LV DNG+GM KAG AGDDAPRAVFPSIVGRPRH  V+VGMGQKD+YVGD  + +R
Sbjct: 5   EDIQPLVCDNGTGMVKAGLAGDDAPRAVFPSIVGRPRHTXVVVGMGQKDAYVGDEAQVQR 64

Query: 272 GILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPK 424
           GILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPK
Sbjct: 65  GILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPK 115


>UniRef50_P14883 Cluster: Actin-2; n=75; Eukaryota|Rep: Actin-2 -
           Plasmodium falciparum
          Length = 376

 Score =  203 bits (496), Expect = 2e-51
 Identities = 90/111 (81%), Positives = 99/111 (89%)
 Frame = +2

Query: 92  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHKSKR 271
           EE  ALVVDNGSGM K+G AGDDAP+ VFPSIVGRP+   +M+GM QK+ YVGD  ++KR
Sbjct: 3   EEAVALVVDNGSGMVKSGLAGDDAPKCVFPSIVGRPKMPNIMIGMEQKECYVGDEAQNKR 62

Query: 272 GILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPK 424
           GILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRV+PEEHPVLLTEAPLNPK
Sbjct: 63  GILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVSPEEHPVLLTEAPLNPK 113


>UniRef50_Q96483 Cluster: Actin-51; n=584; Eukaryota|Rep: Actin-51 -
           Solanum lycopersicum (Tomato) (Lycopersicon esculentum)
          Length = 336

 Score =  198 bits (483), Expect = 6e-50
 Identities = 89/96 (92%), Positives = 92/96 (95%)
 Frame = +2

Query: 140 AGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHKSKRGILTLKYPIEHGIVTN 319
           AGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKD+Y GD  +SKRGILTLKYPIEHGIV+N
Sbjct: 1   AGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYDGDEAQSKRGILTLKYPIEHGIVSN 60

Query: 320 WDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           WDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA
Sbjct: 61  WDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 96


>UniRef50_Q0VHZ5 Cluster: Actin deviating protein; n=7;
           Eukaryota|Rep: Actin deviating protein - Bolivina sp.
           isolate 615
          Length = 360

 Score =  154 bits (373), Expect = 1e-36
 Identities = 66/96 (68%), Positives = 81/96 (84%)
 Frame = +2

Query: 152 GDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHKSKRGILTLKYPIEHGIVTNWDDM 331
           GDDAPRAVFP+I GR R  GVMVGM QK+ YVGD  +SKRGIL+L++PI HGI T+WDD+
Sbjct: 1   GDDAPRAVFPAITGRRRRNGVMVGMAQKNCYVGDEAQSKRGILSLRWPIVHGISTSWDDV 60

Query: 332 EKIWHHTFYNELRVAPEEHPVLLTEAPLNPKALQRR 439
           E+IW HTFY ELR+ PEEHP+L+TE PLNPKA +++
Sbjct: 61  EEIWRHTFYQELRIQPEEHPILMTEPPLNPKANRQK 96


>UniRef50_Q7XB26 Cluster: Ubiquitin/actin fusion protein 4; n=1;
           Bigelowiella natans|Rep: Ubiquitin/actin fusion protein
           4 - Bigelowiella natans (Pedinomonas minutissima)
           (Chlorarachnion sp.(strain CCMP 621))
          Length = 234

 Score =  149 bits (360), Expect = 5e-35
 Identities = 73/112 (65%), Positives = 83/112 (74%)
 Frame = +2

Query: 92  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHKSKR 271
           EE   LVVDNGS M KAGFAGD APR  FPS+   PR +  M G  ++D Y+G  + +KR
Sbjct: 78  EECQPLVVDNGSDMIKAGFAGDGAPRTAFPSVFKVPRVRNTMTG--KQDVYIGSVN-AKR 134

Query: 272 GILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           G+L  KY IEHGIVT+WD M KIW HTF NEL+VAPEEHPVLLTE PLNPKA
Sbjct: 135 GVLINKYAIEHGIVTDWDAMLKIWDHTFLNELKVAPEEHPVLLTEPPLNPKA 186


>UniRef50_A2DKQ5 Cluster: Actin 58, putative; n=2; Trichomonas
           vaginalis G3|Rep: Actin 58, putative - Trichomonas
           vaginalis G3
          Length = 373

 Score =  145 bits (352), Expect = 4e-34
 Identities = 61/112 (54%), Positives = 85/112 (75%)
 Frame = +2

Query: 107 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHKSKRGILTL 286
           +V+DNG+G+ KAGFAG +AP++VFP+I+G P+    MVG   KD +VG     K  +L L
Sbjct: 6   IVIDNGTGLTKAGFAGAEAPKSVFPTIIGSPKSNMQMVGGQNKDFFVGFEAVQKSDLLVL 65

Query: 287 KYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKALQRRR 442
           + PIE+G ++NWDD+EKIWHHTFYNEL VAPEEHPV+L E P++P+  + ++
Sbjct: 66  RQPIENGTISNWDDIEKIWHHTFYNELLVAPEEHPVILAEKPMSPRMNREKK 117


>UniRef50_UPI0000449751 Cluster: PREDICTED: similar to gamma-actin;
           n=3; Amniota|Rep: PREDICTED: similar to gamma-actin -
           Gallus gallus
          Length = 377

 Score =  144 bits (348), Expect = 1e-33
 Identities = 63/105 (60%), Positives = 82/105 (78%)
 Frame = +2

Query: 107 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHKSKRGILTL 286
           +V DNGSG CKAG +G+ APR+V P+IVG P+   VM+GM  +D YVG+  +SKRGIL+L
Sbjct: 12  VVFDNGSGQCKAGLSGEQAPRSVIPTIVGYPKFTFVMIGMEHRDWYVGEEAQSKRGILSL 71

Query: 287 KYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNP 421
            YP+E+G+VT+WD+MEKIW + + +EL V P E PVLLTE PLNP
Sbjct: 72  TYPMENGVVTSWDNMEKIWRYLYEHELGVKPSEGPVLLTETPLNP 116


>UniRef50_UPI000065FC19 Cluster: Homolog of Homo sapiens "Actin,
           cytoplasmic 2; n=1; Takifugu rubripes|Rep: Homolog of
           Homo sapiens "Actin, cytoplasmic 2 - Takifugu rubripes
          Length = 396

 Score =  142 bits (343), Expect = 5e-33
 Identities = 59/111 (53%), Positives = 85/111 (76%)
 Frame = +2

Query: 107 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHKSKRGILTL 286
           +V+D GSG  KAGFA +D P  VFP+I+G P+++ +M G  ++++Y+G   +  RG+L L
Sbjct: 2   IVLDTGSGFMKAGFADEDLPNVVFPTIIGMPKYEEIMNGRAERETYIGHEAQHMRGVLAL 61

Query: 287 KYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKALQRR 439
           K+PI++GI+ NWD+MEKIWHHTF  ++RV PE+HPVLLTEA +NP   +RR
Sbjct: 62  KHPIKNGIIQNWDEMEKIWHHTFL-QMRVDPEDHPVLLTEAAMNPLENRRR 111


>UniRef50_Q0VHZ6 Cluster: Actin deviating protein; n=2; Bolivina sp.
           isolate 615|Rep: Actin deviating protein - Bolivina sp.
           isolate 615
          Length = 387

 Score =  140 bits (338), Expect = 2e-32
 Identities = 62/101 (61%), Positives = 77/101 (76%)
 Frame = +2

Query: 152 GDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHKSKRGILTLKYPIEHGIVTNWDDM 331
           G DAPRAVFP+IVG  +H+G+ VGM QK  YVGD  +SKRGIL L +P++ G+V NWDDM
Sbjct: 1   GVDAPRAVFPTIVGTLKHRGIFVGMAQKSYYVGDEAQSKRGILKLMHPMQRGVVKNWDDM 60

Query: 332 EKIWHHTFYNELRVAPEEHPVLLTEAPLNPKALQRRR*PQI 454
           EKIWHHT Y+ELRV PEEHP+L+T+ P   K + R +  QI
Sbjct: 61  EKIWHHTLYHELRVQPEEHPILMTDTPFASK-MDREKMAQI 100


>UniRef50_UPI0000605B09 Cluster: PREDICTED: similar to actin alpha 1
           skeletal muscle protein; n=1; Mus musculus|Rep:
           PREDICTED: similar to actin alpha 1 skeletal muscle
           protein - Mus musculus
          Length = 255

 Score =  136 bits (329), Expect = 3e-31
 Identities = 56/115 (48%), Positives = 83/115 (72%)
 Frame = +2

Query: 95  EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHKSKRG 274
           E   LV D GSG  K GF+G  AP+AVFP+I+G+ +H  V+ G+G++D ++G   ++ R 
Sbjct: 2   EKTPLVCDYGSGFSKVGFSGTQAPQAVFPTILGKMKHTNVLEGLGEQDWFIGAETQTNRT 61

Query: 275 ILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKALQRR 439
            L + YPI  G +TNWD++EKIWH++FY+ L++APE+HP+L+TEAPL  K  + R
Sbjct: 62  ELNMYYPISRGAITNWDNVEKIWHYSFYHSLQIAPEQHPILITEAPLTSKEAKSR 116


>UniRef50_UPI00001E426E Cluster: PREDICTED: similar to actin-12;
           n=11; Eutheria|Rep: PREDICTED: similar to actin-12 - Mus
           musculus
          Length = 372

 Score =  136 bits (329), Expect = 3e-31
 Identities = 56/115 (48%), Positives = 83/115 (72%)
 Frame = +2

Query: 95  EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHKSKRG 274
           E   LV D GSG  K GF+G  AP+AVFP+I+G+ +H  V+ G+G++D ++G   ++ R 
Sbjct: 2   EKTPLVCDYGSGFSKVGFSGTQAPQAVFPTILGKMKHTNVLEGLGEQDWFIGAETQTNRT 61

Query: 275 ILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKALQRR 439
            L + YPI  G +TNWD++EKIWH++FY+ L++APE+HP+L+TEAPL  K  + R
Sbjct: 62  ELNMYYPISRGAITNWDNVEKIWHYSFYHSLQIAPEQHPILITEAPLTSKEAKSR 116


>UniRef50_Q9XZB9 Cluster: Actin; n=1; Sterkiella nova|Rep: Actin -
           Oxytricha nova
          Length = 374

 Score =  136 bits (329), Expect = 3e-31
 Identities = 53/116 (45%), Positives = 81/116 (69%)
 Frame = +2

Query: 92  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHKSKR 271
           E    +V+DNGSG  KAGF G+D P  V  ++VGRP++Q  ++G+  KD ++G+    KR
Sbjct: 2   ESSKTIVIDNGSGFVKAGFVGEDGPSVVLRNLVGRPKNQNAIIGVEAKDEFIGEDAYLKR 61

Query: 272 GILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKALQRR 439
           G+L   YP++HGI+ +WDDMEK+W+H F  EL+V   EHP L++E+PL P+ ++ +
Sbjct: 62  GVLKFSYPVQHGIIKDWDDMEKVWNHLFSYELKVDSSEHPFLISESPLTPEFIREQ 117


>UniRef50_A4QNT8 Cluster: Si:ch211-241j12.3 protein; n=3; Danio
           rerio|Rep: Si:ch211-241j12.3 protein - Danio rerio
           (Zebrafish) (Brachydanio rerio)
          Length = 389

 Score =  135 bits (326), Expect = 6e-31
 Identities = 61/112 (54%), Positives = 82/112 (73%)
 Frame = +2

Query: 107 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHKSKRGILTL 286
           +V+D+GSG+ KAGFA  D P AVFP+++GRP+++ VM     ++ YVG   +  RG+LTL
Sbjct: 25  IVLDSGSGLMKAGFADQDLPAAVFPTVIGRPKYEEVMNSCVDRELYVGHDAQHMRGVLTL 84

Query: 287 KYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKALQRRR 442
           +YPI HG+V+NWD+ME +W H F   L  APE+HPVLLTEA LNP  LQ R+
Sbjct: 85  RYPIRHGVVSNWDEMEMLWTHAF-QLLSAAPEDHPVLLTEAALNP--LQNRQ 133


>UniRef50_P61163 Cluster: Alpha-centractin; n=356; root|Rep:
           Alpha-centractin - Homo sapiens (Human)
          Length = 376

 Score =  134 bits (325), Expect = 8e-31
 Identities = 58/112 (51%), Positives = 83/112 (74%), Gaps = 1/112 (0%)
 Frame = +2

Query: 107 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHKSKRGILTL 286
           +V+DNGSG+ KAGFAGD  P+  FP+ VGRP+H  VM G  + D ++G   +  RG+L++
Sbjct: 12  VVIDNGSGVIKAGFAGDQIPKYCFPNYVGRPKHVRVMAGALEGDIFIGPKAEEHRGLLSI 71

Query: 287 KYPIEHGIVTNWDDMEKIWHHTF-YNELRVAPEEHPVLLTEAPLNPKALQRR 439
           +YP+EHGIV +W+DME+IW + +  ++L+   EEHPVLLTEAPLNP+  + R
Sbjct: 72  RYPMEHGIVKDWNDMERIWQYVYSKDQLQTFSEEHPVLLTEAPLNPRKNRER 123


>UniRef50_A5E2K2 Cluster: Actin; n=5; Saccharomycetales|Rep: Actin -
           Lodderomyces elongisporus (Yeast) (Saccharomyces
           elongisporus)
          Length = 417

 Score =  130 bits (313), Expect = 2e-29
 Identities = 59/118 (50%), Positives = 78/118 (66%), Gaps = 11/118 (9%)
 Frame = +2

Query: 107 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGM-----------GQKDSYVGD 253
           +VVDNG G  KAGFAG++ PR    SI+GRP++Q +M G               D +VGD
Sbjct: 10  VVVDNGLGTLKAGFAGEEKPRTYASSIIGRPKYQKLMAGSLTSSTSGSTIASDTDLFVGD 69

Query: 254 GHKSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
             +  RG+L L YP+EHGIVT W DME IW H F  +L++ PE+HP+L+TEAPLNP++
Sbjct: 70  AAQKNRGLLRLNYPVEHGIVTKWSDMEIIWDHMFTQDLKIKPEDHPLLITEAPLNPRS 127


>UniRef50_Q2GY63 Cluster: Putative uncharacterized protein; n=1;
           Chaetomium globosum|Rep: Putative uncharacterized
           protein - Chaetomium globosum (Soil fungus)
          Length = 350

 Score =  129 bits (311), Expect = 4e-29
 Identities = 57/109 (52%), Positives = 82/109 (75%), Gaps = 1/109 (0%)
 Frame = +2

Query: 104 ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHKSK-RGIL 280
           A+V+DNGSG  +AG++G+  P+  FPS VGRP+H  V+ G  + + +VG    ++ RG+L
Sbjct: 9   AVVLDNGSGNIRAGYSGESEPKVNFPSWVGRPKHLRVLAGALEGEVFVGKKAAAELRGLL 68

Query: 281 TLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
            ++YP+EHGIVT+WDDMEKIW H  Y+EL+   E+HP+LLTE PLNP++
Sbjct: 69  KIRYPLEHGIVTDWDDMEKIWSHV-YSELKCDAEQHPLLLTEPPLNPRS 116


>UniRef50_UPI0000F2D825 Cluster: PREDICTED: similar to actin; n=1;
           Monodelphis domestica|Rep: PREDICTED: similar to actin -
           Monodelphis domestica
          Length = 416

 Score =  127 bits (307), Expect = 1e-28
 Identities = 56/111 (50%), Positives = 74/111 (66%)
 Frame = +2

Query: 95  EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHKSKRG 274
           E   ++ D GS   K G+ G+ +PR VFPS +G  R Q +  GM  +D+++G+    K  
Sbjct: 48  ESLPVIFDGGSRYFKVGYGGEYSPRFVFPSAIGHYRWQNIKSGMDLRDTFIGNEVIEKWA 107

Query: 275 ILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
            L +KYPIEHGI+ NWDDMEKIWHH+FYN L V PE+HP+L+TE    PKA
Sbjct: 108 NLLVKYPIEHGIIVNWDDMEKIWHHSFYNVLHVDPEKHPLLVTEHLFTPKA 158


>UniRef50_UPI0000F2D326 Cluster: PREDICTED: similar to actin; n=1;
           Monodelphis domestica|Rep: PREDICTED: similar to actin -
           Monodelphis domestica
          Length = 378

 Score =  124 bits (299), Expect = 1e-27
 Identities = 52/109 (47%), Positives = 74/109 (67%)
 Frame = +2

Query: 95  EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHKSKRG 274
           ++ + + DNGSG+CK G +G+  PR +  +++G P+    M    QK  YVG   +  R 
Sbjct: 8   KIPSAIFDNGSGLCKVGISGEQNPRFIQATVLGYPQSINSMANTWQKAYYVGQEAQDNRS 67

Query: 275 ILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNP 421
           ILTL +P++HG+VT+WDDMEKIW H + + LR  P++ PVLLTEAPLNP
Sbjct: 68  ILTLNHPMQHGVVTSWDDMEKIWEHLYKDGLRETPKQRPVLLTEAPLNP 116


>UniRef50_UPI0000588EB0 Cluster: PREDICTED: similar to actin; n=1;
           Strongylocentrotus purpuratus|Rep: PREDICTED: similar to
           actin - Strongylocentrotus purpuratus
          Length = 386

 Score =  123 bits (297), Expect = 2e-27
 Identities = 57/110 (51%), Positives = 79/110 (71%), Gaps = 4/110 (3%)
 Frame = +2

Query: 107 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQK----DSYVGDGHKSKRG 274
           +V+D+GS   +AGFA +D PR VF SIVGRPRHQ V+  +  K    DSYVG+  +++RG
Sbjct: 14  MVIDHGSFEIQAGFAEEDCPRTVFQSIVGRPRHQEVLDDLTTKLNFRDSYVGEEAQNRRG 73

Query: 275 ILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPK 424
           +LTL YPIE GI+T WDDME +W HTF +E++  P++   +L++ P NPK
Sbjct: 74  VLTLTYPIERGIITKWDDMEAVWSHTF-SEIKFNPQDEGAVLSQIPNNPK 122


>UniRef50_A2FRF9 Cluster: Actin family protein; n=1; Trichomonas
           vaginalis G3|Rep: Actin family protein - Trichomonas
           vaginalis G3
          Length = 543

 Score =  117 bits (281), Expect = 2e-25
 Identities = 46/100 (46%), Positives = 70/100 (70%)
 Frame = +2

Query: 107 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHKSKRGILTL 286
           +V+D GSG  K GFAG   P+  FP++VG P+    ++G    D +VG+   +K  ++ +
Sbjct: 6   VVIDTGSGFTKVGFAGYYEPKVEFPTVVGVPKDSTALIGGKNVDFFVGNEVFTKSDLVDI 65

Query: 287 KYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE 406
             PIE+G++ NWDD+EK+WHHT+YNEL V P++HPV++TE
Sbjct: 66  SKPIENGVIVNWDDIEKVWHHTYYNELLVVPDQHPVIITE 105


>UniRef50_Q4QG59 Cluster: Actin-like protein, putative; n=3;
           Leishmania|Rep: Actin-like protein, putative -
           Leishmania major
          Length = 483

 Score =  115 bits (276), Expect = 7e-25
 Identities = 52/114 (45%), Positives = 75/114 (65%)
 Frame = +2

Query: 101 AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHKSKRGIL 280
           AA+V+D GS   +AGF G+  PR   P++VG PRH+ + +  G  +  VG+    K+GIL
Sbjct: 8   AAVVLDCGSFHSRAGFGGEKGPRLDVPTLVGYPRHRSIAMAAGMNEQEVGEEALLKQGIL 67

Query: 281 TLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKALQRRR 442
            + +PI +G + +W D+EK+W H F+NELRV+PE H  LLT+ P+N  A QR R
Sbjct: 68  DVHHPIRNGFINDWGDVEKLWSHLFFNELRVSPETHCFLLTQ-PVNTPAAQRER 120


>UniRef50_Q24C02 Cluster: Actin family protein; n=3;
           Oligohymenophorea|Rep: Actin family protein -
           Tetrahymena thermophila SB210
          Length = 398

 Score =  115 bits (276), Expect = 7e-25
 Identities = 50/105 (47%), Positives = 76/105 (72%)
 Frame = +2

Query: 107 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHKSKRGILTL 286
           +V+DNGSG+ +AG AG+D  +  F S +GRP+++ V+    Q D Y+G+    +RG+L L
Sbjct: 13  VVIDNGSGIIRAGIAGEDKAKLQFDSYIGRPKYKMVLPTNTQSDYYLGNISDEQRGLLKL 72

Query: 287 KYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNP 421
           +YPI HGI+ NW+DM+ IW +  Y+EL+V+ +E+PVLLTE  +NP
Sbjct: 73  QYPINHGIIQNWNDMDLIWKYC-YSELKVSAKEYPVLLTEPAINP 116


>UniRef50_UPI00005864C8 Cluster: PREDICTED: similar to Actin; n=4;
           Strongylocentrotus purpuratus|Rep: PREDICTED: similar to
           Actin - Strongylocentrotus purpuratus
          Length = 383

 Score =  114 bits (274), Expect = 1e-24
 Identities = 54/111 (48%), Positives = 73/111 (65%)
 Frame = +2

Query: 89  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHKSK 268
           D+    +VVDNGSG  +AGFAG    RA FPS +GR +   V    G++++++G+     
Sbjct: 6   DDGPDPVVVDNGSGTIQAGFAGGKTCRATFPSCIGRSKKSHVD---GKREAFIGEAIYKH 62

Query: 269 RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNP 421
           R +L + YPIEHGIV +W+DMEKIWH+ F  +L V   EHPVL+TE P NP
Sbjct: 63  REVLGINYPIEHGIVKDWEDMEKIWHYLFDVDLMVDTTEHPVLMTEPPGNP 113


>UniRef50_Q4CV94 Cluster: Actin 2, putative; n=2; Trypanosoma
           cruzi|Rep: Actin 2, putative - Trypanosoma cruzi
          Length = 392

 Score =  114 bits (274), Expect = 1e-24
 Identities = 55/110 (50%), Positives = 71/110 (64%)
 Frame = +2

Query: 92  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHKSKR 271
           +E  A+V+DNGSG  K GFAG++ PR VFPS+ G   +         +  YVGD    ++
Sbjct: 7   DEEPAVVLDNGSGNIKCGFAGEEIPRCVFPSVTGVSMNTRSSGSSSSQRVYVGDEALQEK 66

Query: 272 GILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNP 421
           G L   YP+EHGIV++WD ME++W H  Y +LRV PE   VLLTEAPLNP
Sbjct: 67  G-LRYFYPMEHGIVSDWDQMERVWRHA-YEQLRVPPERQAVLLTEAPLNP 114


>UniRef50_UPI0000E23780 Cluster: PREDICTED: hypothetical protein
           isoform 2; n=2; Amniota|Rep: PREDICTED: hypothetical
           protein isoform 2 - Pan troglodytes
          Length = 179

 Score =  112 bits (270), Expect = 4e-24
 Identities = 55/110 (50%), Positives = 73/110 (66%)
 Frame = -1

Query: 400 KQDGVFLGGDTQLIVEGMMPNLLHVIPVSDDSVFDGVFEGQDTSFALVPISYIRVLLSHT 221
           +QDGV LG  TQL+VEG++P+LLHV+PV DD+V  GV +GQD S AL  I++I + L H 
Sbjct: 69  QQDGVLLGSHTQLVVEGVVPDLLHVVPVGDDAVLHGVLQGQDASLALGLIAHIGLHLMHA 128

Query: 220 DHHALMAGPSHDRGKHCARSIISCEAGLAHTGAIVYYQRGNFFVAHLELV 71
            HHAL+ G  HD  +     II+C+AGLAH  A+V    G   + H EL+
Sbjct: 129 PHHALVPGAPHDGREDSPGGIITCKAGLAHARAVVNDGHGGIII-HGELI 177


>UniRef50_O96819 Cluster: Actin-related protein; n=5;
           Trypanosoma|Rep: Actin-related protein - Trypanosoma
           brucei
          Length = 433

 Score =  110 bits (264), Expect = 2e-23
 Identities = 52/121 (42%), Positives = 78/121 (64%), Gaps = 1/121 (0%)
 Frame = +2

Query: 83  MCDEEVAALVV-DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGH 259
           +C  E A +V+ D GS   +AG+A D APR   P++VG PR++GV V  G  +  +GD  
Sbjct: 2   VCSTERAPVVILDGGSHHLRAGYASDGAPRLDIPALVGHPRNRGVAVAAGMNEYEIGDVA 61

Query: 260 KSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKALQRR 439
            +KRG+LT+  PIE G V +W++MEK+W H  Y+ELRV PE H  ++ ++ +N  A Q+ 
Sbjct: 62  LAKRGMLTVSSPIESGRVVSWENMEKLWGHVMYSELRVRPESHCFIVPQS-VNTPASQKE 120

Query: 440 R 442
           +
Sbjct: 121 K 121


>UniRef50_Q5KB93 Cluster: Actin binding protein, putative; n=3;
           Filobasidiella neoformans|Rep: Actin binding protein,
           putative - Cryptococcus neoformans (Filobasidiella
           neoformans)
          Length = 390

 Score =  107 bits (257), Expect = 1e-22
 Identities = 51/113 (45%), Positives = 72/113 (63%), Gaps = 2/113 (1%)
 Frame = +2

Query: 107 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGV-MVGMGQ-KDSYVGDGHKSKRGIL 280
           LVVDNG+G  K G+AG + P  VFPSIVGRP  +    +G  Q KD  +GD     R  L
Sbjct: 7   LVVDNGTGFVKCGWAGSNFPDYVFPSIVGRPILRAEERLGTSQLKDIMIGDEAAENRSYL 66

Query: 281 TLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKALQRR 439
            + +P+EHG+V NW+DM  +W +TF  ++ + P    +LLTE P+NPKA +++
Sbjct: 67  QVTHPMEHGVVKNWEDMRHLWDYTFNEKMHMDPRGKKILLTEPPMNPKANRQK 119


>UniRef50_Q0J646 Cluster: Os08g0369300 protein; n=2; Oryza sativa
           (japonica cultivar-group)|Rep: Os08g0369300 protein -
           Oryza sativa subsp. japonica (Rice)
          Length = 495

 Score =  105 bits (251), Expect = 7e-22
 Identities = 50/107 (46%), Positives = 67/107 (62%), Gaps = 2/107 (1%)
 Frame = +2

Query: 107 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRP--RHQGVMVGMGQKDSYVGDGHKSKRGIL 280
           +V DNG+G  K GFAG++ P +VFP +VGRP  R++  +      D  VG      R  L
Sbjct: 7   VVCDNGTGYVKCGFAGENFPTSVFPCVVGRPLLRYEESLQEQELTDIVVGAACADLRHQL 66

Query: 281 TLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNP 421
            + YP+ +GIV +WDDM  IW H FY+EL+V P E  +LLT+ PLNP
Sbjct: 67  DVSYPVTNGIVQSWDDMGHIWDHAFYSELKVDPSECKILLTDPPLNP 113


>UniRef50_A2YUL5 Cluster: Putative uncharacterized protein; n=1;
           Oryza sativa (indica cultivar-group)|Rep: Putative
           uncharacterized protein - Oryza sativa subsp. indica
           (Rice)
          Length = 367

 Score =  105 bits (251), Expect = 7e-22
 Identities = 50/107 (46%), Positives = 67/107 (62%), Gaps = 2/107 (1%)
 Frame = +2

Query: 107 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRP--RHQGVMVGMGQKDSYVGDGHKSKRGIL 280
           +V DNG+G  K GFAG++ P +VFP +VGRP  R++  +      D  VG      R  L
Sbjct: 7   VVCDNGTGYVKCGFAGENFPTSVFPCVVGRPLLRYEESLQEQELTDIVVGAACADLRHQL 66

Query: 281 TLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNP 421
            + YP+ +GIV +WDDM  IW H FY+EL+V P E  +LLT+ PLNP
Sbjct: 67  DVSYPVTNGIVQSWDDMGHIWDHAFYSELKVDPSECKILLTDPPLNP 113


>UniRef50_Q4N681 Cluster: Actin, putative; n=3; Piroplasmida|Rep:
           Actin, putative - Theileria parva
          Length = 380

 Score =  103 bits (246), Expect = 3e-21
 Identities = 49/116 (42%), Positives = 68/116 (58%), Gaps = 5/116 (4%)
 Frame = +2

Query: 92  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIV---GRPRHQGVMVGMG--QKDSYVGDG 256
           +E  AL++D GS + KAGFAG + P+  FP++V   G       +VG G  +K   +   
Sbjct: 3   DETLALIIDTGSAVTKAGFAGSETPKVRFPTLVAIDGNQESDDPLVGNGVLEKLDKLNSN 62

Query: 257 HKSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPK 424
              +     +  P++HGIV NW   E +W HTF NEL+++ EEHPVLLTE PL PK
Sbjct: 63  KSQELASFEVYRPVQHGIVRNWALAESVWRHTFTNELKISQEEHPVLLTEPPLTPK 118


>UniRef50_Q8TDY3 Cluster: Actin-related protein T2; n=26;
           Amniota|Rep: Actin-related protein T2 - Homo sapiens
           (Human)
          Length = 377

 Score =  102 bits (245), Expect = 4e-21
 Identities = 47/107 (43%), Positives = 64/107 (59%)
 Frame = +2

Query: 104 ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHKSKRGILT 283
           A++ DNGSG CKAG +G+  PR +  SIVG  + Q       QK  +VG+    K+  L 
Sbjct: 11  AVIFDNGSGFCKAGLSGEFGPRHMVSSIVGHLKFQAPSAEANQKKYFVGEEALYKQEALQ 70

Query: 284 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPK 424
           L  P E G++T WDD+E++W H F  EL V P + P+L TE  LNP+
Sbjct: 71  LHSPFERGLITGWDDVERLWKHLFEWELGVKPSDQPLLATEPSLNPR 117


>UniRef50_UPI00015B6274 Cluster: PREDICTED: similar to putative mRNA
           splicing factor; n=1; Nasonia vitripennis|Rep:
           PREDICTED: similar to putative mRNA splicing factor -
           Nasonia vitripennis
          Length = 515

 Score =  102 bits (244), Expect = 5e-21
 Identities = 52/116 (44%), Positives = 76/116 (65%), Gaps = 10/116 (8%)
 Frame = -1

Query: 400 KQDGVFLGGDTQLIVEGMMPNLLHVIPVSDDSVFDGVFEGQDTSFALVPISYIRVLLSHT 221
           +++G+FL GD QL+VEG+MP+LLHVIPV D SV D +F  +DT+  L  ++Y+ VLL+H 
Sbjct: 395 EENGMFLWGDAQLVVEGVMPDLLHVIPVGDYSVLDRIFNREDTALGLGLVAYVGVLLAHA 454

Query: 220 DHHA----------LMAGPSHDRGKHCARSIISCEAGLAHTGAIVYYQRGNFFVAH 83
           DH A          L+AGP+ D  K  +R +++ E  LAH+ +IV ++ G   VAH
Sbjct: 455 DHDALWIKSMVDTHLIAGPADDGWKDGSRRVVAGETSLAHSRSIVNHESGYVVVAH 510


>UniRef50_UPI0000D9A391 Cluster: PREDICTED: actin related protein M1
           isoform 1; n=1; Macaca mulatta|Rep: PREDICTED: actin
           related protein M1 isoform 1 - Macaca mulatta
          Length = 319

 Score =  102 bits (244), Expect = 5e-21
 Identities = 46/107 (42%), Positives = 69/107 (64%)
 Frame = +2

Query: 107 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHKSKRGILTL 286
           +V+DNGSG+ KAG AG   P+ ++P+I+GR + Q      G  +  VGD  +  R  L++
Sbjct: 71  VVIDNGSGVIKAGLAGSREPQFIYPNIIGRAKGQS-RAAPGGLELCVGDQAQDWRSSLSI 129

Query: 287 KYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
            YP+E G++T+WDDME +W H +   L++ P + PVL+TE  LNP A
Sbjct: 130 SYPVERGLITSWDDMEIMWKHIYDYNLKLKPCDGPVLITEPALNPLA 176


>UniRef50_A7RPC3 Cluster: Predicted protein; n=3; Eumetazoa|Rep:
           Predicted protein - Nematostella vectensis
          Length = 64

 Score =  101 bits (243), Expect = 7e-21
 Identities = 49/64 (76%), Positives = 52/64 (81%)
 Frame = +2

Query: 104 ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHKSKRGILT 283
           ALV+D GS M K GFAGDDAP+ VFP IVGRPRHQGVMVGMGQKDSYVG    SKRGIL+
Sbjct: 1   ALVIDVGSHMWKVGFAGDDAPKGVFPPIVGRPRHQGVMVGMGQKDSYVGWEAHSKRGILS 60

Query: 284 LKYP 295
           L  P
Sbjct: 61  LSTP 64


>UniRef50_UPI0001554F81 Cluster: PREDICTED: similar to actin; n=1;
           Ornithorhynchus anatinus|Rep: PREDICTED: similar to
           actin - Ornithorhynchus anatinus
          Length = 376

 Score =  100 bits (240), Expect = 2e-20
 Identities = 48/116 (41%), Positives = 72/116 (62%), Gaps = 6/116 (5%)
 Frame = +2

Query: 98  VAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHKSKRGI 277
           +  LV+DNG+G+CKAGFAGD+AP+ V P+ VG       M   G ++  +  G ++ R +
Sbjct: 1   MTTLVIDNGTGLCKAGFAGDNAPKLVVPTAVGIQISPDNMTASGLQNRNILTGWETSRSL 60

Query: 278 ------LTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
                 L L +P+  G+VT+WD+ME++W + F  +L   P +HPVLLTE+P N  A
Sbjct: 61  LEPGPTLALTFPVTRGVVTDWDEMERLWGYVF-QKLHARPTKHPVLLTESPKNRAA 115


>UniRef50_UPI00005A2ACF Cluster: PREDICTED: similar to cytoplasmic
           beta-actin; n=1; Canis lupus familiaris|Rep: PREDICTED:
           similar to cytoplasmic beta-actin - Canis familiaris
          Length = 268

 Score =  100 bits (240), Expect = 2e-20
 Identities = 49/72 (68%), Positives = 56/72 (77%)
 Frame = +2

Query: 212 VMVGMGQKDSYVGDGHKSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHP 391
           +MVGMGQKDSY+ +  + K GILT KY IEHGIV NWDDME I HH FYN+L +APEE  
Sbjct: 97  IMVGMGQKDSYIRNEAQRKWGILTFKYCIEHGIVINWDDME-IQHHNFYNKLCMAPEELY 155

Query: 392 VLLTEAPLNPKA 427
           +LLTE PLN KA
Sbjct: 156 ILLTEIPLNLKA 167


>UniRef50_Q9BYD9 Cluster: Actin-related protein M1; n=12;
           Theria|Rep: Actin-related protein M1 - Homo sapiens
           (Human)
          Length = 372

 Score =  100 bits (239), Expect = 2e-20
 Identities = 46/107 (42%), Positives = 68/107 (63%)
 Frame = +2

Query: 107 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHKSKRGILTL 286
           +V+DNGSGM KAG AG   P+ ++P+I+GR + Q      G  +  VGD  +  R  L +
Sbjct: 8   VVIDNGSGMIKAGVAGCREPQFIYPNIIGRAKGQS-RAAQGGLELCVGDQAQDWRSSLFI 66

Query: 287 KYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
            YP+E G++T+W+DME +W H +   L++ P + PVL+TE  LNP A
Sbjct: 67  SYPVERGLITSWEDMEIMWKHIYDYNLKLKPCDGPVLITEPALNPLA 113


>UniRef50_UPI0000E466A7 Cluster: PREDICTED: similar to actin, alpha
           1, skeletal muscle; n=1; Strongylocentrotus
           purpuratus|Rep: PREDICTED: similar to actin, alpha 1,
           skeletal muscle - Strongylocentrotus purpuratus
          Length = 258

 Score = 97.9 bits (233), Expect = 1e-19
 Identities = 42/76 (55%), Positives = 55/76 (72%)
 Frame = +2

Query: 212 VMVGMGQKDSYVGDGHKSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHP 391
           +   M  +D +VGD  + KRG+L++KYPIE GIVTNW+DME IWHHTFYNELRV P+E  
Sbjct: 2   IPTSMITRDHFVGDEAQRKRGLLSIKYPIERGIVTNWEDMETIWHHTFYNELRVDPKELL 61

Query: 392 VLLTEAPLNPKALQRR 439
           V  T+ P + KA + +
Sbjct: 62  VFFTDVPKSTKASREK 77


>UniRef50_Q9Y615 Cluster: Actin-like protein 7A; n=11; Mammalia|Rep:
           Actin-like protein 7A - Homo sapiens (Human)
          Length = 435

 Score = 97.1 bits (231), Expect = 2e-19
 Identities = 43/110 (39%), Positives = 66/110 (60%)
 Frame = +2

Query: 92  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHKSKR 271
           E   A+VVD G+G CK GFAG   P     + VG+P  +    G  +K+++VG    +  
Sbjct: 67  EVTKAVVVDLGTGYCKCGFAGLPRPTHKISTTVGKPYMETAKTGDNRKETFVGQELNNTN 126

Query: 272 GILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNP 421
             L L  P+ HGI+ +WD ++ IW + F  E+++APEEH VL+++ PL+P
Sbjct: 127 VHLKLVNPLRHGIIVDWDTVQDIWEYLFRQEMKIAPEEHAVLVSDPPLSP 176


>UniRef50_P61160 Cluster: Actin-related protein 2; n=96;
           Eukaryota|Rep: Actin-related protein 2 - Homo sapiens
           (Human)
          Length = 394

 Score = 96.3 bits (229), Expect = 3e-19
 Identities = 47/108 (43%), Positives = 66/108 (61%), Gaps = 3/108 (2%)
 Frame = +2

Query: 107 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRP--RHQGVMVGMGQKDSYVGDGHKSKRGIL 280
           +V DNG+G  K G+AG + P  +FP++VGRP  R    +  +  KD  VGD     R +L
Sbjct: 9   VVCDNGTGFVKCGYAGSNFPEHIFPALVGRPIIRSTTKVGNIEIKDLMVGDEASELRSML 68

Query: 281 TLKYPIEHGIVTNWDDMEKIWHHTFYNE-LRVAPEEHPVLLTEAPLNP 421
            + YP+E+GIV NWDDM+ +W +TF  E L +      +LLTE P+NP
Sbjct: 69  EVNYPMENGIVRNWDDMKHLWDYTFGPEKLNIDTRNCKILLTEPPMNP 116


>UniRef50_Q55DS6 Cluster: Putative uncharacterized protein; n=1;
           Dictyostelium discoideum AX4|Rep: Putative
           uncharacterized protein - Dictyostelium discoideum AX4
          Length = 392

 Score = 95.9 bits (228), Expect = 5e-19
 Identities = 44/125 (35%), Positives = 84/125 (67%), Gaps = 3/125 (2%)
 Frame = +2

Query: 89  DEEVA-ALVVDNGSGMCKAGFAGDD-APRAVFPSIVGRPRHQGVMVGM-GQKDSYVGDGH 259
           +EE+  ++++D GSG  K GF+ ++  PR  FP+I+GR ++  V+ G   +K  + G   
Sbjct: 8   NEEIRNSVIIDCGSGFTKVGFSNEELTPRNEFPTIIGRTKYYEVLYGAPNKKVIFAGHEV 67

Query: 260 KSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKALQRR 439
           ++++  +++K+PIE G + NWDDMEK+ +++F+  L ++ +E+P+L+T++P N K + R 
Sbjct: 68  ETQKTNISIKHPIERGSIINWDDMEKLLNYSFHQVLNISCDEYPILITDSPFNSK-MNRE 126

Query: 440 R*PQI 454
           R  Q+
Sbjct: 127 RLTQL 131


>UniRef50_Q54UQ7 Cluster: Actin-like protein 6A; n=1; Dictyostelium
           discoideum AX4|Rep: Actin-like protein 6A -
           Dictyostelium discoideum AX4
          Length = 440

 Score = 95.9 bits (228), Expect = 5e-19
 Identities = 49/130 (37%), Positives = 80/130 (61%), Gaps = 14/130 (10%)
 Frame = +2

Query: 92  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVG---RPRHQGVMVG---MGQKDS---- 241
           ++V+A+V+D G+   K G+AG+D+P+AVFP+ +G   +  ++ V  G   MG+KD     
Sbjct: 5   DDVSAIVIDVGTFSTKGGYAGEDSPKAVFPTDIGVVYKNENETVGTGDSEMGEKDDSEPK 64

Query: 242 ---YVG-DGHKSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEA 409
              Y G +G   +R  + +  P+  G++ NWD ME+IW+HTFY  L + P EHP+LL E 
Sbjct: 65  RTYYCGTNGITYRRPHMEIINPLSDGLIKNWDAMEQIWNHTFYERLHINPIEHPILLAEP 124

Query: 410 PLNPKALQRR 439
             N +A++ +
Sbjct: 125 TYNTRAIREK 134


>UniRef50_UPI00006C1719 Cluster: PREDICTED: similar to actin, alpha
           2, smooth muscle, aorta; n=3; Homo/Pan/Gorilla
           group|Rep: PREDICTED: similar to actin, alpha 2, smooth
           muscle, aorta - Homo sapiens
          Length = 183

 Score = 95.1 bits (226), Expect = 8e-19
 Identities = 42/52 (80%), Positives = 46/52 (88%)
 Frame = +2

Query: 224 MGQKDSYVGDGHKSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAP 379
           MGQKDSYVGD  +SK GILTLKYPIE G+VTN DDMEKIWHHTFYN+LR+ P
Sbjct: 1   MGQKDSYVGDEAQSKYGILTLKYPIEQGMVTNRDDMEKIWHHTFYNKLRLHP 52


>UniRef50_A2DBN6 Cluster: Actin family protein; n=1; Trichomonas
           vaginalis G3|Rep: Actin family protein - Trichomonas
           vaginalis G3
          Length = 373

 Score = 94.3 bits (224), Expect = 1e-18
 Identities = 43/116 (37%), Positives = 67/116 (57%), Gaps = 1/116 (0%)
 Frame = +2

Query: 95  EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRH-QGVMVGMGQKDSYVGDGHKSKR 271
           EV+ +V+D G+   +AGF GD  P+ + P+++GR +  Q     +  KD YVG     + 
Sbjct: 2   EVSTIVIDTGAYSTRAGFGGDSDPQCILPTVIGRLKSPQDKAAAIATKDIYVGSEVFEQS 61

Query: 272 GILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKALQRR 439
             L LK PI   +++N D++E  W H F  EL +   EHPVL+TE+P N K ++ +
Sbjct: 62  KNLNLKCPISDRVISNIDEIEVFWQHIFSKELNINTSEHPVLMTESPQNTKIMREK 117


>UniRef50_Q5C683 Cluster: SJCHGC08418 protein; n=1; Schistosoma
           japonicum|Rep: SJCHGC08418 protein - Schistosoma
           japonicum (Blood fluke)
          Length = 106

 Score = 93.5 bits (222), Expect = 2e-18
 Identities = 45/103 (43%), Positives = 64/103 (62%)
 Frame = +2

Query: 107 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHKSKRGILTL 286
           +VVDNG+G  KAG+AGD  PR + P ++GRP+           D +VG+   + R  L L
Sbjct: 9   IVVDNGAGHLKAGYAGDGGPRILVPMLIGRPKKCSKYT-----DWFVGEHANAIRNELIL 63

Query: 287 KYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPL 415
             PI +GIVT+ D +  +W++ F  ELR +PE HPVL++E PL
Sbjct: 64  NCPIANGIVTDIDGLSLVWYYMFMKELRTSPENHPVLISEYPL 106


>UniRef50_Q38F20 Cluster: Actin-like protein 3, putative; n=1;
           Trypanosoma brucei|Rep: Actin-like protein 3, putative -
           Trypanosoma brucei
          Length = 416

 Score = 93.1 bits (221), Expect = 3e-18
 Identities = 47/110 (42%), Positives = 62/110 (56%), Gaps = 5/110 (4%)
 Frame = +2

Query: 107 LVVDNGSGMCKAGFAGDDAPRAVFPSI-----VGRPRHQGVMVGMGQKDSYVGDGHKSKR 271
           +V+DNG+G  K G+AG++ P  + P+        R R   V   +   D YVGD   +  
Sbjct: 6   VVIDNGTGYTKMGYAGNEEPTYIIPTAYADNEASRRRSHDVFSDL---DFYVGDEALAHS 62

Query: 272 GILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNP 421
               L +PI+HGIV +WD ME+IW H  Y  LRV PEEH  +LTE P NP
Sbjct: 63  SSCNLYHPIKHGIVEDWDKMERIWQHCVYKYLRVDPEEHGFILTEPPANP 112


>UniRef50_A0E1S8 Cluster: Chromosome undetermined scaffold_73, whole
           genome shotgun sequence; n=1; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_73,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 383

 Score = 89.0 bits (211), Expect = 5e-17
 Identities = 45/108 (41%), Positives = 64/108 (59%), Gaps = 1/108 (0%)
 Frame = +2

Query: 107 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHKSKRGILTL 286
           +V+DNGS   KAGF G  AP    P++VGRP+ +        +D Y G+   +K   L+L
Sbjct: 11  IVIDNGSYELKAGFQGHYAPSCRIPTVVGRPKLENSDEDF--EDQYFGEEAMAKANALSL 68

Query: 287 KYPIEHGIVTNWDDMEKIWHHTFYNELRVAPE-EHPVLLTEAPLNPKA 427
           KYPI+ GI+ +WD +  I     +N+  +  E EHP+LLTE P+NP A
Sbjct: 69  KYPIQRGIINDWDGIIYINMILIWNQFGIMQESEHPILLTEVPINPNA 116


>UniRef50_Q8LKR2 Cluster: Actin-related protein 4; n=7; core
           eudicotyledons|Rep: Actin-related protein 4 -
           Arabidopsis thaliana (Mouse-ear cress)
          Length = 442

 Score = 88.6 bits (210), Expect = 7e-17
 Identities = 54/131 (41%), Positives = 73/131 (55%), Gaps = 22/131 (16%)
 Frame = +2

Query: 92  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVM--------VGMGQKDSYV 247
           +EV+A+VVD GS  CKAG+AG+DAP+AVFPS++G       M             +DS  
Sbjct: 6   DEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSVIGAVDGVEAMDVDVDSTKTNSNSEDSKT 65

Query: 248 -GDGHKSKR----GILTLKY---------PIEHGIVTNWDDMEKIWHHTFYNELRVAPEE 385
             +  KSKR    G   + Y         PI+ GIV++WD ++ IW H F + L + P E
Sbjct: 66  ESEKEKSKRKLYVGSQAMSYRRDHMEVLSPIKDGIVSDWDLVDNIWEHAFKSCLMIDPTE 125

Query: 386 HPVLLTEAPLN 418
           HP+LL E PLN
Sbjct: 126 HPMLLAEPPLN 136


>UniRef50_A7QKV4 Cluster: Chromosome chr8 scaffold_115, whole genome
           shotgun sequence; n=1; Vitis vinifera|Rep: Chromosome
           chr8 scaffold_115, whole genome shotgun sequence - Vitis
           vinifera (Grape)
          Length = 431

 Score = 88.6 bits (210), Expect = 7e-17
 Identities = 44/66 (66%), Positives = 49/66 (74%), Gaps = 1/66 (1%)
 Frame = +2

Query: 230 QKDSYVGDGHKSKRGILTLKYPIEHGIVTNWDDMEK-IWHHTFYNELRVAPEEHPVLLTE 406
           QKD+YV D  +SK+ +LTLKYP + GIV NWDD  K IWHHTFY EL VAPE H VLLTE
Sbjct: 21  QKDAYVEDEAQSKKDMLTLKYPTKSGIVGNWDDKGKTIWHHTFYIELCVAPEAHLVLLTE 80

Query: 407 APLNPK 424
             LN K
Sbjct: 81  VLLNLK 86


>UniRef50_A7S2B1 Cluster: Predicted protein; n=1; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 265

 Score = 88.2 bits (209), Expect = 9e-17
 Identities = 42/111 (37%), Positives = 65/111 (58%), Gaps = 4/111 (3%)
 Frame = +2

Query: 104 ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVG--MGQKD-SYVGDGHKSKRG 274
           A+V+DNG G+ K GFAGD  PR + P++VG P+   +++G  +  KD    GD   +K G
Sbjct: 1   AIVLDNGCGISKIGFAGDRVPRIIQPAVVGNPQRFSMLIGDNVNVKDYKKYGDAAVAKSG 60

Query: 275 ILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLN-PK 424
           ++ L YP+    +  W D+  +W +  Y+EL +   EHP ++TE   N PK
Sbjct: 61  VMHLSYPMHADKLETWTDVVDLWEYLLYDELDIGEGEHPFIVTEIAKNHPK 111


>UniRef50_Q9Y614 Cluster: Actin-like protein 7B; n=12; Theria|Rep:
           Actin-like protein 7B - Homo sapiens (Human)
          Length = 415

 Score = 84.6 bits (200), Expect = 1e-15
 Identities = 38/111 (34%), Positives = 64/111 (57%)
 Frame = +2

Query: 95  EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHKSKRG 274
           ++ A+++D GS  CK G+AG+  P     S VG+   +    G  +K + VG    +   
Sbjct: 48  KIKAVIIDLGSQYCKCGYAGEPRPTYFISSTVGKRCPEAADAGDTRKWTLVGHELLNTEA 107

Query: 275 ILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
            L L  P++HGIV +WD ++ IW + F   +++ PEEH VL+++ PL+P +
Sbjct: 108 PLKLVNPLKHGIVVDWDCVQDIWEYIFRTAMKILPEEHAVLVSDPPLSPSS 158


>UniRef50_Q55DY5 Cluster: Putative uncharacterized protein; n=1;
           Dictyostelium discoideum AX4|Rep: Putative
           uncharacterized protein - Dictyostelium discoideum AX4
          Length = 355

 Score = 83.8 bits (198), Expect = 2e-15
 Identities = 44/106 (41%), Positives = 59/106 (55%)
 Frame = +2

Query: 107 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHKSKRGILTL 286
           +++D GSG  K GF G+  P     +IVG P  QG          + G    ++     L
Sbjct: 6   IIIDFGSGWTKCGFEGEVTPSVECLTIVGHPNKQG------DTKLFYGKEAVARFSTSKL 59

Query: 287 KYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPK 424
            YPI++GIV NW+DMEK   +TFY +LRV P+ H VLLTE  +N K
Sbjct: 60  VYPIKNGIVCNWEDMEKFIENTFYYKLRVEPQYHSVLLTETTMNTK 105


>UniRef50_UPI0000E47BC7 Cluster: PREDICTED: similar to ubiquitin/actin
            fusion protein; n=1; Strongylocentrotus purpuratus|Rep:
            PREDICTED: similar to ubiquitin/actin fusion protein -
            Strongylocentrotus purpuratus
          Length = 1608

 Score = 82.2 bits (194), Expect = 6e-15
 Identities = 46/120 (38%), Positives = 66/120 (55%), Gaps = 9/120 (7%)
 Frame = +2

Query: 107  LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHKSKRGILT- 283
            +++DNGS M +AG A   AP    P++VGR + + +     +KD YVG+    K G+LT 
Sbjct: 1236 IILDNGSSMLRAGLADGVAPSVTMPTVVGRLK-KDIESYRNRKDVYVGNELTKKYGLLTY 1294

Query: 284  --------LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKALQRR 439
                    L+Y    G+V NW ++E IW H   +EL V  E+HP+LLTE    PK  + R
Sbjct: 1295 QIILNNSPLRYLPIGGVVDNWAELEHIWDHVVSHELNVKWEDHPILLTELASAPKRQRER 1354


>UniRef50_A2FH22 Cluster: Actin family protein; n=1; Trichomonas
           vaginalis G3|Rep: Actin family protein - Trichomonas
           vaginalis G3
          Length = 390

 Score = 81.8 bits (193), Expect = 8e-15
 Identities = 44/108 (40%), Positives = 59/108 (54%), Gaps = 2/108 (1%)
 Frame = +2

Query: 107 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRP--RHQGVMVGMGQKDSYVGDGHKSKRGIL 280
           +V+D G+G  KAG +    P  V  + VGRP  R          KD  V D     R  L
Sbjct: 6   VVLDLGTGYLKAGLSSRQIPDFVLQNTVGRPILRSDESFSKAKLKDIMVCDETYPVRQYL 65

Query: 281 TLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPK 424
            L  P+EHGIV NW+D   +  + F  +L++  E+HP+L+TEAPLNPK
Sbjct: 66  DLTLPVEHGIVKNWEDEALVLDYVFKEKLKIRNEDHPLLITEAPLNPK 113


>UniRef50_A2ECQ8 Cluster: Actin family protein; n=1; Trichomonas
           vaginalis G3|Rep: Actin family protein - Trichomonas
           vaginalis G3
          Length = 371

 Score = 81.8 bits (193), Expect = 8e-15
 Identities = 37/106 (34%), Positives = 59/106 (55%)
 Frame = +2

Query: 95  EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHKSKRG 274
           ++  +V+DNG+   KAGFAG   P  + P++VG  +    MVG+  K  +VG+   +K  
Sbjct: 3   DMKTIVIDNGTFSVKAGFAGTKKPHFIIPTVVGTAKENADMVGIKNKAYFVGNEALAKEN 62

Query: 275 ILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAP 412
           +L L  PIE+G+V NW+   ++W   F N+     E+  +L  E P
Sbjct: 63  LLNLVNPIENGVVQNWEFQTQLWDELFANQFHCPLEDVCILTGEKP 108


>UniRef50_Q6X960 Cluster: HSD21; n=13; Theria|Rep: HSD21 - Homo
           sapiens (Human)
          Length = 416

 Score = 81.0 bits (191), Expect = 1e-14
 Identities = 38/109 (34%), Positives = 60/109 (55%)
 Frame = +2

Query: 95  EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHKSKRG 274
           +  A+V+D G+G CK GFAG  +P     +I+G    +    G     +++G+  +    
Sbjct: 48  KTGAVVIDMGTGTCKVGFAGQASPTYTVATILGCQPKKPATSGQSGLQTFIGEAARVLPE 107

Query: 275 ILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNP 421
            LTL  P+  GIV +WD  E IW H   ++LRVA  +HP+L ++ P +P
Sbjct: 108 -LTLVQPLRSGIVVDWDAAELIWRHLLEHDLRVATHDHPLLSSDPPFSP 155


>UniRef50_Q7M3B0 Cluster: Actin beta; n=1; Sus scrofa domestica|Rep:
           Actin beta - Sus scrofa domestica (domestic pig)
          Length = 195

 Score = 80.6 bits (190), Expect = 2e-14
 Identities = 33/39 (84%), Positives = 35/39 (89%)
 Frame = +2

Query: 290 YPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE 406
           YPIEHGIVTNWDDMEKIWHHTFYNELRVAPEE   ++ E
Sbjct: 21  YPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEMTQIMFE 59


>UniRef50_P61158 Cluster: Actin-related protein 3; n=107;
           Eukaryota|Rep: Actin-related protein 3 - Homo sapiens
           (Human)
          Length = 418

 Score = 80.6 bits (190), Expect = 2e-14
 Identities = 46/113 (40%), Positives = 60/113 (53%), Gaps = 8/113 (7%)
 Frame = +2

Query: 104 ALVVDNGSGMCKAGFAGDDAPRAVFPSI--------VGRPRHQGVMVGMGQKDSYVGDGH 259
           A VVD G+G  K G+AG+  P+ + PS         VG    + VM G+   D ++GD  
Sbjct: 7   ACVVDCGTGYTKLGYAGNTEPQFIIPSCIAIKESAKVGDQAQRRVMKGVDDLDFFIGDEA 66

Query: 260 KSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLN 418
             K    T K+PI HGIV +WD ME+      +  LR  PE+H  LLTE PLN
Sbjct: 67  IEKPTYAT-KWPIRHGIVEDWDLMERFMEQVIFKYLRAEPEDHYFLLTEPPLN 118


>UniRef50_Q54JL1 Cluster: Putative uncharacterized protein; n=1;
           Dictyostelium discoideum AX4|Rep: Putative
           uncharacterized protein - Dictyostelium discoideum AX4
          Length = 414

 Score = 79.4 bits (187), Expect = 4e-14
 Identities = 41/109 (37%), Positives = 65/109 (59%), Gaps = 3/109 (2%)
 Frame = +2

Query: 107 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHK--SKRGI- 277
           +++D G+   + G+ G++ P     +++G P     M+G+ +K+ Y G      +KR   
Sbjct: 5   IIIDVGTKNIRIGYGGEEKPNETLLNLIGIPTTIK-MIGVERKNYYAGSDINFINKRNHR 63

Query: 278 LTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPK 424
           L+L  P++ GIV+NW+DMEKI+    Y E +VAPEE  +LLTE PL  K
Sbjct: 64  LSLTCPMKRGIVSNWEDMEKIYSRLLYYEFKVAPEESDILLTEPPLTSK 112


>UniRef50_Q8MVN5 Cluster: Cardiac actin-like protein; n=1; Boltenia
           villosa|Rep: Cardiac actin-like protein - Boltenia
           villosa
          Length = 137

 Score = 79.0 bits (186), Expect = 6e-14
 Identities = 34/53 (64%), Positives = 37/53 (69%)
 Frame = +2

Query: 269 RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           R I   K P+E  I+TNWD  EKIWHHT  NEL VAPEEHP L T+A  NPKA
Sbjct: 32  REICLSKIPLERXIITNWDXQEKIWHHTLNNELEVAPEEHPTLFTKAAWNPKA 84


>UniRef50_A0CQQ2 Cluster: Chromosome undetermined scaffold_24, whole
           genome shotgun sequence; n=7; Oligohymenophorea|Rep:
           Chromosome undetermined scaffold_24, whole genome
           shotgun sequence - Paramecium tetraurelia
          Length = 869

 Score = 79.0 bits (186), Expect = 6e-14
 Identities = 40/108 (37%), Positives = 58/108 (53%), Gaps = 4/108 (3%)
 Frame = +2

Query: 110 VVDNGSGMCKAGFAGDDAPRAVFPSIVG-RPRHQGVMVGMGQK---DSYVGDGHKSKRGI 277
           V+DNG+G  K G+AG+  P+   P++V      Q V +        D Y+G         
Sbjct: 16  VIDNGTGFTKMGWAGNTEPQFDIPTVVADHQEKQKVQMSKNTNENLDYYIGYEAYDYTKS 75

Query: 278 LTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNP 421
             + YP++ GIV NWD MEK WH + ++ LR  P+E   +LTE P+NP
Sbjct: 76  HNIFYPMKSGIVENWDLMEKFWHRSIFDYLRAEPDETTFILTEPPMNP 123


>UniRef50_P32392 Cluster: Actin-related protein 3; n=27;
           Eukaryota|Rep: Actin-related protein 3 - Drosophila
           melanogaster (Fruit fly)
          Length = 418

 Score = 78.2 bits (184), Expect = 1e-13
 Identities = 42/113 (37%), Positives = 60/113 (53%), Gaps = 8/113 (7%)
 Frame = +2

Query: 104 ALVVDNGSGMCKAGFAGDDAPRAVFPSI--------VGRPRHQGVMVGMGQKDSYVGDGH 259
           A V+D G+G  K GFAG+  P+ + PS         VG    + +  G+   D ++GD  
Sbjct: 7   ACVIDVGTGYSKLGFAGNKEPQFIIPSAIAIKESARVGDTNTRRITKGIEDLDFFIGDEA 66

Query: 260 KSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLN 418
               G  ++KYP+ HG+V +WD ME+      +  LR  PE+H  LLTE PLN
Sbjct: 67  FDATGY-SIKYPVRHGLVEDWDLMERFLEQCVFKYLRAEPEDHYFLLTEPPLN 118


>UniRef50_Q4DMP2 Cluster: Actin-related protein 2, putative; n=4;
           Trypanosoma|Rep: Actin-related protein 2, putative -
           Trypanosoma cruzi
          Length = 403

 Score = 77.8 bits (183), Expect = 1e-13
 Identities = 46/122 (37%), Positives = 64/122 (52%), Gaps = 15/122 (12%)
 Frame = +2

Query: 95  EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRP-------RHQG--------VMVGMG 229
           E   +V+DNGSG  K G+AG + P AVF + +GRP       R  G          V   
Sbjct: 4   EKRPVVLDNGSGFIKCGYAGANFPTAVFQTALGRPVLRSTKKRSHGSGGGEEGHTHVDPM 63

Query: 230 QKDSYVGDGHKSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEA 409
            +D   GD     R +L + YPI +GI+ N D+M  +W +TF   L++ P EH +LL+E 
Sbjct: 64  MRDIVFGDECSGVRHLLDMTYPIRNGIIQNMDEMCHLWDYTFGEMLQINPSEHRLLLSEV 123

Query: 410 PL 415
           PL
Sbjct: 124 PL 125


>UniRef50_Q6FRF2 Cluster: Similar to sp|P38696 Saccharomyces
           cerevisiae YHR129c ACT5; n=1; Candida glabrata|Rep:
           Similar to sp|P38696 Saccharomyces cerevisiae YHR129c
           ACT5 - Candida glabrata (Yeast) (Torulopsis glabrata)
          Length = 387

 Score = 77.8 bits (183), Expect = 1e-13
 Identities = 34/102 (33%), Positives = 59/102 (57%), Gaps = 1/102 (0%)
 Frame = +2

Query: 107 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHKSKRGILTL 286
           +++DNGS + KAGFAG   P  +  + +G P  +  MV +  K++Y+G+    +R  L L
Sbjct: 13  VILDNGSSVIKAGFAGSQQPDVLEYAWIGNPLAERSMVTVSNKETYIGNSAYERRATLHL 72

Query: 287 KYPIEHGIVTNWDDMEKIWHHTFYNELRVAP-EEHPVLLTEA 409
           + P     + +WD +E +W +   N+L +   +EHPV+LT +
Sbjct: 73  ESPYSTNAIMSWDRLEDLWDYVLLNKLEIEQLQEHPVVLTNS 114


>UniRef50_Q4SGD5 Cluster: Chromosome 17 SCAF14597, whole genome
           shotgun sequence; n=1; Tetraodon nigroviridis|Rep:
           Chromosome 17 SCAF14597, whole genome shotgun sequence -
           Tetraodon nigroviridis (Green puffer)
          Length = 425

 Score = 76.6 bits (180), Expect = 3e-13
 Identities = 41/106 (38%), Positives = 62/106 (58%), Gaps = 1/106 (0%)
 Frame = +2

Query: 107 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHKSKRGILTL 286
           +V DNG+G  K G+AG + P  +FP++VGRP        + +  + VG+        + +
Sbjct: 9   VVCDNGTGFVKCGYAGSNFPEHIFPALVGRP--------IIRSTAKVGNIE------IKV 54

Query: 287 KYPIEHGIVTNWDDMEKIWHHTFYNE-LRVAPEEHPVLLTEAPLNP 421
            YP+E+GIV NWDDM+ +W +TF  E L +      +LLTE P+NP
Sbjct: 55  NYPMENGIVRNWDDMKHLWDYTFGPEKLNIDSRNCKILLTEPPMNP 100


>UniRef50_A2VD47 Cluster: Zgc:158823 protein; n=3; Eukaryota|Rep:
           Zgc:158823 protein - Danio rerio (Zebrafish)
           (Brachydanio rerio)
          Length = 334

 Score = 76.6 bits (180), Expect = 3e-13
 Identities = 40/111 (36%), Positives = 59/111 (53%), Gaps = 8/111 (7%)
 Frame = +2

Query: 110 VVDNGSGMCKAGFAGDDAPRAVFPSI--------VGRPRHQGVMVGMGQKDSYVGDGHKS 265
           V+D G+G  K G+AG+  P+ + P+         VG    + ++ G+   D ++GD    
Sbjct: 10  VIDCGTGYTKIGYAGNTEPQFIMPTCIAVRESASVGDQAQRRLVKGVDDLDFFIGDEAID 69

Query: 266 KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLN 418
           K    T K+PI HGI+ +WD MEK      +  LR  PE+H  L+TE PLN
Sbjct: 70  KPNYAT-KWPIRHGIIEDWDFMEKFMEQVIFKYLRAEPEDHNFLMTEPPLN 119


>UniRef50_UPI000049A548 Cluster: actin; n=1; Entamoeba histolytica
           HM-1:IMSS|Rep: actin - Entamoeba histolytica HM-1:IMSS
          Length = 365

 Score = 75.8 bits (178), Expect = 5e-13
 Identities = 37/105 (35%), Positives = 60/105 (57%)
 Frame = +2

Query: 107 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHKSKRGILTL 286
           +++DNGSG+ KAG + ++ P+ VFP +VG  +    +  +G    +  D        L L
Sbjct: 6   IIIDNGSGLIKAGESSEELPKIVFPCVVGHSKETNKLENIGDFARFSKD--------LNL 57

Query: 287 KYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNP 421
           + PI+ GI+ +W+D+E IW   F  EL+V   +  V+LT+A L P
Sbjct: 58  QQPIQRGIINDWNDIEDIWDFAF-EELQVESSDQVVMLTQAALTP 101


>UniRef50_UPI0000F2DE11 Cluster: PREDICTED: similar to
           testis-specific actin-related protein 3; n=1;
           Monodelphis domestica|Rep: PREDICTED: similar to
           testis-specific actin-related protein 3 - Monodelphis
           domestica
          Length = 939

 Score = 74.9 bits (176), Expect = 9e-13
 Identities = 41/111 (36%), Positives = 67/111 (60%)
 Frame = +2

Query: 92  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHKSKR 271
           + +AA+V+D G+G  K G AG+D  RA+ P+ VGR  H   +   G K  Y     +++ 
Sbjct: 106 KNLAAVVIDTGTGYSKCGLAGEDRTRAIVPTRVGR--H---LNSEGDKTPYYIT-EEAEA 159

Query: 272 GILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPK 424
              TL      G+VT+WD +E +W+H FY++L V P+E  VL+ ++P++P+
Sbjct: 160 ACSTLI----RGVVTDWDALEVLWNHIFYSKLCVEPQELAVLVADSPVSPR 206


>UniRef50_UPI0000EBF019 Cluster: PREDICTED: similar to ribosomal
           protein L10; n=1; Bos taurus|Rep: PREDICTED: similar to
           ribosomal protein L10 - Bos taurus
          Length = 289

 Score = 74.5 bits (175), Expect = 1e-12
 Identities = 39/87 (44%), Positives = 53/87 (60%)
 Frame = +2

Query: 107 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHKSKRGILTL 286
           LVVD G   CK GF  D+    V P+    P+HQ  MVG+GQKDSY+G   + +  + T 
Sbjct: 4   LVVDCGFDTCKTGFTEDNTLSCV-PTHRLVPQHQDCMVGVGQKDSYMGGKIQGRLSVQTP 62

Query: 287 KYPIEHGIVTNWDDMEKIWHHTFYNEL 367
           +YP+E GI+T+ DD+ KIW     N+L
Sbjct: 63  EYPMEQGIITHPDDVGKIWITIAINQL 89


>UniRef50_A4RW28 Cluster: Predicted protein; n=2; Ostreococcus|Rep:
           Predicted protein - Ostreococcus lucimarinus CCE9901
          Length = 425

 Score = 74.5 bits (175), Expect = 1e-12
 Identities = 49/138 (35%), Positives = 74/138 (53%), Gaps = 6/138 (4%)
 Frame = +2

Query: 92  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQG--VMVGMGQKDS---YVGDG 256
           +EV+A+V+D G+   KAG+AG D P+ VFPS VG     G   M   G+  S   +  D 
Sbjct: 5   DEVSAVVIDLGTHSVKAGYAGQDTPQHVFPSAVGECAKGGDADMTAEGENASARHFEVDN 64

Query: 257 HKSKRGILTLKYPI-EHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKALQ 433
              +R  + +  P  E+G++ +W+ +E IW H     L +  +EHPVLL+E   N  A+ 
Sbjct: 65  MGIRRDGMEVTSPYGENGMLEDWEAVEAIWEHALKKRLALQTDEHPVLLSEPVHNSDAV- 123

Query: 434 RRR*PQIHGSKTIQHAPP 487
           R +  ++   K   HAPP
Sbjct: 124 RAKMVELMFEK---HAPP 138


>UniRef50_Q8IS27 Cluster: Actin-related protein 2; n=5;
           Oligohymenophorea|Rep: Actin-related protein 2 -
           Tetrahymena thermophila
          Length = 393

 Score = 74.5 bits (175), Expect = 1e-12
 Identities = 38/107 (35%), Positives = 61/107 (57%), Gaps = 2/107 (1%)
 Frame = +2

Query: 107 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRP--RHQGVMVGMGQKDSYVGDGHKSKRGIL 280
           +V D+G+G  K G+AGD+ P+   P+++GRP  R    +  +  K+  +G      + +L
Sbjct: 7   IVCDSGTGYIKIGYAGDNFPKYSIPAMIGRPMLRFNQKIDDVELKEIMIGGEAAPYQAML 66

Query: 281 TLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNP 421
            L  P+E G V NW DME +W ++F  +L    + + VL+TE  LNP
Sbjct: 67  ELTKPVEEGTVKNWQDMELLWDYSF-KKLGAETKGNTVLMTEPVLNP 112


>UniRef50_Q5CSX9 Cluster: Actin; n=2; Cryptosporidium|Rep: Actin -
           Cryptosporidium parvum Iowa II
          Length = 405

 Score = 74.1 bits (174), Expect = 2e-12
 Identities = 35/103 (33%), Positives = 60/103 (58%)
 Frame = +2

Query: 107 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHKSKRGILTL 286
           +V+D GS   KAG   D +P  +FPS+VG+ R + V         +VG+   ++R  L+L
Sbjct: 22  IVIDCGSAYMKAGTDSDKSPTCIFPSMVGQYRSRYVPEDEDNNPIFVGEEAIAQRKKLSL 81

Query: 287 KYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPL 415
            +PI+HG + +W   E++ ++ FY  L + P +  V++T+ PL
Sbjct: 82  TFPIDHGHIDDWTKFEELLNYLFYRGLDIDPIDSSVIITKPPL 124


>UniRef50_A2DNQ0 Cluster: Actin family protein; n=1; Trichomonas
           vaginalis G3|Rep: Actin family protein - Trichomonas
           vaginalis G3
          Length = 358

 Score = 73.7 bits (173), Expect = 2e-12
 Identities = 40/104 (38%), Positives = 61/104 (58%)
 Frame = +2

Query: 107 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHKSKRGILTL 286
           +V+D G  + KAGF GD  P  VFPS  G    + +  G   K  Y+     SK G  T 
Sbjct: 6   IVLDCGGSIIKAGFGGDSEPGIVFPS-TGPKLKKDIESGFDDK-RYI-----SKFGP-TF 57

Query: 287 KYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLN 418
           + PIE+ ++TN+D+M++IW   F  +L++ PE+HP L+ ++ LN
Sbjct: 58  RSPIENRVITNFDNMKRIWQELFTEQLQIQPEQHPFLVADSALN 101


>UniRef50_Q6BG22 Cluster: Actin, putative; n=2; Paramecium
           tetraurelia|Rep: Actin, putative - Paramecium
           tetraurelia
          Length = 370

 Score = 72.9 bits (171), Expect = 4e-12
 Identities = 36/111 (32%), Positives = 63/111 (56%)
 Frame = +2

Query: 107 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHKSKRGILTL 286
           +V++N S   +AG  G+ APR  FP+ V + +    +  +      +G+  +  +     
Sbjct: 8   VVIENSSCNIRAGIVGEAAPRCCFPTRVDKVQESQTIKFL------IGNQIEENQYNNQP 61

Query: 287 KYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKALQRR 439
            YPI++G + +W+ +E+IW + F  +L+++P  HPVLLTEAP N K  Q +
Sbjct: 62  CYPIQNGQIMDWESIEQIWRYIFEVQLKISPSNHPVLLTEAPCNSKINQEK 112


>UniRef50_Q383R8 Cluster: Actin-like protein, putative; n=4;
           Trypanosoma|Rep: Actin-like protein, putative -
           Trypanosoma brucei
          Length = 394

 Score = 72.9 bits (171), Expect = 4e-12
 Identities = 34/108 (31%), Positives = 60/108 (55%), Gaps = 2/108 (1%)
 Frame = +2

Query: 92  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQ--KDSYVGDGHKS 265
           ++   +V D GS   + GFAG++APR +  ++VG PR +G++  + Q   D Y GD   +
Sbjct: 3   QQQPVVVFDMGSNKTRVGFAGEEAPRVISSTVVGVPRQRGLVGSLMQHYSDDYAGDAACA 62

Query: 266 KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEA 409
           + G+L L YP+ +  +T+  ++E      FY+ L + P    +L  E+
Sbjct: 63  QEGMLNLSYPVRNRRITSMPEVEHFLQDVFYSRLPLVPSNTMMLWVES 110


>UniRef50_UPI0000449ED3 Cluster: PREDICTED: similar to RIKEN cDNA
           4921517D21 gene; n=2; Gallus gallus|Rep: PREDICTED:
           similar to RIKEN cDNA 4921517D21 gene - Gallus gallus
          Length = 321

 Score = 71.7 bits (168), Expect = 8e-12
 Identities = 45/110 (40%), Positives = 62/110 (56%)
 Frame = +2

Query: 92  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHKSKR 271
           +++ A+V+D G G  ++G AGD+ PR+V PS                KD    DG     
Sbjct: 10  KDLCAVVIDTGMGHTRSGLAGDERPRSVAPS----------------KDK---DG----- 45

Query: 272 GILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNP 421
            ILT      HG+VT+WD +E++WH  FY+EL V PEE  VL T+APL+P
Sbjct: 46  SILT------HGVVTDWDRLEELWHRIFYHELAVCPEELAVLATDAPLSP 89


>UniRef50_Q9DFB8 Cluster: Actin; n=1; Scomberomorus maculatus|Rep:
           Actin - Scomberomorus maculatus (Spanish mackerel)
          Length = 101

 Score = 71.3 bits (167), Expect = 1e-11
 Identities = 36/73 (49%), Positives = 44/73 (60%)
 Frame = +1

Query: 262 EQKRYPDPQIPHRTRNRH*LG*HGEDLASYLLQ*AACRPRGTPRPAY*GSPQPQGPTEEK 441
           E+KR+PDP++ HR R+ H LG HGEDLA +LLQ AAC PR  P P   G  QP+    E 
Sbjct: 24  EKKRHPDPEVSHRARHHHQLGRHGEDLAPHLLQRAACGPRRAPHPGDRGPSQPKSQQRED 83

Query: 442 MTPDSWFENNSTR 480
             PD   +   TR
Sbjct: 84  -DPDHVRDVQCTR 95



 Score = 31.9 bits (69), Expect = 8.3
 Identities = 12/14 (85%), Positives = 14/14 (100%)
 Frame = +2

Query: 194 RPRHQGVMVGMGQK 235
           RPRHQGVMVGMG++
Sbjct: 1   RPRHQGVMVGMGRR 14


>UniRef50_UPI0000F2D272 Cluster: PREDICTED: similar to actin; n=1;
           Monodelphis domestica|Rep: PREDICTED: similar to actin -
           Monodelphis domestica
          Length = 790

 Score = 70.5 bits (165), Expect = 2e-11
 Identities = 40/113 (35%), Positives = 61/113 (53%), Gaps = 5/113 (4%)
 Frame = +2

Query: 95  EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQG---VMVGMGQKDSYVGDGHKS 265
           E + LVVD GS  CKAG+ G+  P  + PS+VG    +G   +  G  +  + +  G K+
Sbjct: 423 ERSCLVVDIGSACCKAGWCGEKFPPIIVPSVVGYSPLEGNPSLRPGPSRSQAKLLTGSKN 482

Query: 266 KRGI--LTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLN 418
              +  L  ++ I  G +TNW+ ME IW + F  EL     +HP+L+T  P+N
Sbjct: 483 LPIMRDLRTEFVINRGTITNWEAMESIWRYIF-GELNSGSMDHPLLITGLPMN 534



 Score = 61.7 bits (143), Expect = 9e-09
 Identities = 38/124 (30%), Positives = 65/124 (52%), Gaps = 9/124 (7%)
 Frame = +2

Query: 95  EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQ--------GVMVGMGQK-DSYV 247
           E +++V+D GS  CKAG A ++ P    PS+VG   ++         ++     K    V
Sbjct: 68  ESSSVVIDIGSAWCKAGLAMENYPTLAVPSVVGYQFYEEEVKVYSPNILKACPPKIRKVV 127

Query: 248 GDGHKSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           G     +   +  ++ I+ G V NWD ME IW+++F + L +  + HPVL+TE P N + 
Sbjct: 128 GLEKMRELKEMPNQFAIDRGRVLNWDAMEDIWYYSF-DYLGIKTKNHPVLITEFPRNDEN 186

Query: 428 LQRR 439
            +++
Sbjct: 187 YRQK 190


>UniRef50_Q9P7X7 Cluster: Actin-related protein 4; n=1;
           Schizosaccharomyces pombe|Rep: Actin-related protein 4 -
           Schizosaccharomyces pombe (Fission yeast)
          Length = 433

 Score = 70.1 bits (164), Expect = 3e-11
 Identities = 39/110 (35%), Positives = 60/110 (54%)
 Frame = +2

Query: 92  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHKSKR 271
           +EV+A+V+D GS   + GF+G+D P+ V PS  G       + G    + Y+   +KS  
Sbjct: 9   DEVSAIVIDPGSKWTRIGFSGEDIPKCVLPSYCGEFSDGRRLFG----EEYI---YKSNP 61

Query: 272 GILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNP 421
           G + +K  I +G V NWD    +W +    +L+  P EHP+L+TE   NP
Sbjct: 62  G-MEIKNAIRNGWVENWDVTVDLWRYGLEQQLKTNPLEHPILITEPFDNP 110


>UniRef50_Q14BL3 Cluster: RIKEN cDNA 4921517D21 gene; n=7;
            Eutheria|Rep: RIKEN cDNA 4921517D21 gene - Mus musculus
            (Mouse)
          Length = 1207

 Score = 69.3 bits (162), Expect = 4e-11
 Identities = 36/111 (32%), Positives = 62/111 (55%)
 Frame = +2

Query: 92   EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHKSKR 271
            +++AA+V+D G+G  K G A ++   +V PS V   +H       GQ    V +  +   
Sbjct: 856  QKMAAIVIDTGTGFTKCGLAQENHVLSVVPSQVQMLQHPP----QGQPQYVVPEHQEGSY 911

Query: 272  GILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPK 424
             +L        G+V++WD +E +W H FY +L+V PEE  VL+ ++P++P+
Sbjct: 912  SVLN------RGVVSDWDALEVLWQHLFYCKLKVQPEEMAVLVADSPISPR 956


>UniRef50_Q8IIQ4 Cluster: Actin, putative; n=7; Apicomplexa|Rep:
           Actin, putative - Plasmodium falciparum (isolate 3D7)
          Length = 392

 Score = 67.3 bits (157), Expect = 2e-10
 Identities = 38/107 (35%), Positives = 55/107 (51%)
 Frame = +2

Query: 95  EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHKSKRG 274
           E   +V+DNGSG  KAG    + P  VFP+IVG  ++         K  Y GD       
Sbjct: 2   ENKTIVIDNGSGYIKAGINSSEEPTIVFPTIVGIEKNDET------KRIYTGDEAFFHES 55

Query: 275 ILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPL 415
            L +  PI+HG +++WD  +K+W +T  N +  +     +LLTE PL
Sbjct: 56  NLNIYRPIDHGHISDWDKAQKVWDYTL-NCVDPSKSIKDILLTEPPL 101


>UniRef50_Q4N7N1 Cluster: Actin, putative; n=2; Theileria|Rep:
           Actin, putative - Theileria parva
          Length = 383

 Score = 66.5 bits (155), Expect = 3e-10
 Identities = 41/115 (35%), Positives = 63/115 (54%), Gaps = 1/115 (0%)
 Frame = +2

Query: 83  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHK 262
           M DE+   +V+DNGS   K G +G  +P  +  S+VG PR +        +D Y  +   
Sbjct: 1   MADEQ--CVVIDNGSFSLKIGLSGSYSPSFIVHSVVGNPRPK--YKHNFTEDFYYAEDVY 56

Query: 263 SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPL-NPK 424
           S    ++L + I+HG ++++D ME +W + F   L V  +  PVLLTEAP  +PK
Sbjct: 57  SSLEFMSLDHLIDHGHISDFDKMEGLWQYCF-TRLEVHSDCRPVLLTEAPFTSPK 110


>UniRef50_O96019 Cluster: Actin-like protein 6A; n=63;
           Eumetazoa|Rep: Actin-like protein 6A - Homo sapiens
           (Human)
          Length = 429

 Score = 65.7 bits (153), Expect = 6e-10
 Identities = 41/127 (32%), Positives = 65/127 (51%), Gaps = 11/127 (8%)
 Frame = +2

Query: 92  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGR--PRHQG--VMVGMGQKDSYVGDGH 259
           +EV ALV D GS   +AG+AG+D P+  FP+ +G    R  G  +M   G K    G  +
Sbjct: 9   DEVGALVFDIGSYTVRAGYAGEDCPKVDFPTAIGMVVERDDGSTLMEIDGDKGKQGGPTY 68

Query: 260 KSKRGILTLKY-------PIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLN 418
                 L +         P+++G+V +WD  + I  HT+   ++     HPVL++EAP N
Sbjct: 69  YIDTNALRVPRENMEAISPLKNGMVEDWDSFQAILDHTYKMHVKSEASLHPVLMSEAPWN 128

Query: 419 PKALQRR 439
            +A + +
Sbjct: 129 TRAKREK 135


>UniRef50_UPI00005A3B5D Cluster: PREDICTED: similar to Actin-5C; n=3;
            Laurasiatheria|Rep: PREDICTED: similar to Actin-5C -
            Canis familiaris
          Length = 1248

 Score = 65.3 bits (152), Expect = 7e-10
 Identities = 37/112 (33%), Positives = 62/112 (55%), Gaps = 1/112 (0%)
 Frame = +2

Query: 92   EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHKSKR 271
            +++AA+V+D G+G  K G A +D   +V PS V   +H         +D       +++ 
Sbjct: 897  QDMAAVVIDTGTGFTKCGLAREDHVLSVLPSRVQLLQHPA-------QDEPRYAVPENQE 949

Query: 272  GILTLKYPI-EHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPK 424
            G     YP+   G+V++WD +E +W H FY  L V PEE  VL+ ++P++P+
Sbjct: 950  G----SYPVLNRGVVSDWDALEVLWQHLFYCRLGVRPEELAVLVADSPISPR 997


>UniRef50_Q4Q187 Cluster: Actin-like protein, putative; n=3;
           Leishmania|Rep: Actin-like protein, putative -
           Leishmania major
          Length = 407

 Score = 65.3 bits (152), Expect = 7e-10
 Identities = 38/117 (32%), Positives = 60/117 (51%), Gaps = 2/117 (1%)
 Frame = +2

Query: 98  VAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQK--DSYVGDGHKSKR 271
           + ++VVD G+   + GF+G++APR +  S VG P  +     + Q   D   GD   +  
Sbjct: 8   IQSVVVDVGTRNTRVGFSGEEAPRTMLRSCVGLPGTRRPRPTLLQHPFDIATGDAAYNDG 67

Query: 272 GILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKALQRRR 442
           G+L+L YP+  G V ++D +EK+  +    E RV P+  P L    P +   L R R
Sbjct: 68  GLLSLTYPVRAGHVCDYDALEKLLFYALVEEARVTPDTSPFLFL-VPADQTRLDRER 123


>UniRef50_Q4QF44 Cluster: Actin-related protein 3, putative; n=3;
           Leishmania|Rep: Actin-related protein 3, putative -
           Leishmania major
          Length = 405

 Score = 64.9 bits (151), Expect = 1e-09
 Identities = 38/109 (34%), Positives = 56/109 (51%), Gaps = 2/109 (1%)
 Frame = +2

Query: 101 AALVVDNGSGMCKAGFAGDDAPRAVFPSIVG-RPRHQGVMVGMGQKDS-YVGDGHKSKRG 274
           + +V D G+   + G+AG+  P    P++   R R       +G   +  VG G + +R 
Sbjct: 9   SVVVCDVGTSTTRLGYAGNAEPTFALPTVCAWRDRMSAETFAVGDAAATMVGPGVQQRR- 67

Query: 275 ILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNP 421
                 P+EHG+V NWD ME+ W H F   L V P++  VLLTEA + P
Sbjct: 68  ------PLEHGLVVNWDVMEEYWCHLFNRYLCVEPQDVGVLLTEAAVTP 110


>UniRef50_Q9Y7X8 Cluster: Actin-like protein Arp5; n=1;
           Schizosaccharomyces pombe|Rep: Actin-like protein Arp5 -
           Schizosaccharomyces pombe (Fission yeast)
          Length = 721

 Score = 64.5 bits (150), Expect = 1e-09
 Identities = 35/106 (33%), Positives = 61/106 (57%), Gaps = 1/106 (0%)
 Frame = +2

Query: 107 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHKSKRGILTL 286
           LV+DNGS   +AG+ G+  P+ VF ++V R R +     + +  + VG+    + G  ++
Sbjct: 27  LVIDNGSWQLRAGWGGEKDPKLVFDNLVSRYRDR----KLSRTSTLVGNDTLIEVGSRSI 82

Query: 287 -KYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNP 421
            + P E  +++NWD ME++  +TF  +L +   EHP+ +TE   NP
Sbjct: 83  ARSPFERNVISNWDLMEQVLDYTFL-KLGIDRMEHPICMTEPLANP 127


>UniRef50_Q19R56 Cluster: Actin-like protein 3; n=4; Trypanosoma
           cruzi|Rep: Actin-like protein 3 - Trypanosoma cruzi
           strain CL Brener
          Length = 426

 Score = 64.1 bits (149), Expect = 2e-09
 Identities = 41/119 (34%), Positives = 61/119 (51%), Gaps = 1/119 (0%)
 Frame = +2

Query: 101 AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVM-VGMGQKDSYVGDGHKSKRGI 277
           + +V+D GSG  KA F+   AP + FPS+ GR +++ +     G     VG     +RG+
Sbjct: 3   STIVLDAGSGSVKAAFSSATAPTS-FPSLAGRVKYKPLFQTSHGCDVVSVGKDAAERRGL 61

Query: 278 LTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKALQRRR*PQI 454
           L L YPI+HGI+ NWD  + +       +L  +  E  V   E P + +  QR R  QI
Sbjct: 62  LHLTYPIQHGIIVNWDVWQLLLQQ-IEQQLDASLAEKSVFWVEHPFSSRP-QRARVAQI 118


>UniRef50_A2DEE0 Cluster: Actin family protein; n=1; Trichomonas
           vaginalis G3|Rep: Actin family protein - Trichomonas
           vaginalis G3
          Length = 378

 Score = 63.7 bits (148), Expect = 2e-09
 Identities = 37/115 (32%), Positives = 61/115 (53%), Gaps = 1/115 (0%)
 Frame = +2

Query: 95  EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQK-DSYVGDGHKSKR 271
           ++  +V+D GS   K G +GDD PR    S+ G  +   +    G   D +VG     K 
Sbjct: 13  QMKVVVIDLGSDRIKVGISGDDIPRHFVKSVFGTLKTFDIK---GHNIDFFVGQEAIEKS 69

Query: 272 GILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKALQR 436
              +L  P ++G +TN DD+E+++H+ F  E+ + PE+  V+++  PLN    QR
Sbjct: 70  DPNSLYNPFKNGYITNPDDIERLFHYIFEKEIHINPEKKSVIIS-TPLNGPQSQR 123


>UniRef50_Q9SRK2 Cluster: Putative actin; n=1; Arabidopsis
           thaliana|Rep: Putative actin - Arabidopsis thaliana
           (Mouse-ear cress)
          Length = 378

 Score = 62.5 bits (145), Expect = 5e-09
 Identities = 34/110 (30%), Positives = 56/110 (50%)
 Frame = +2

Query: 107 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHKSKRGILTL 286
           +V+DNG G+ KAG  G+  P  V P+ + +P      +      +   +   +   +   
Sbjct: 5   VVLDNGGGLIKAGQGGERDPTTVIPNCLYKPLSSKKFIHPSPLTTLSDEIDLTSAAV--- 61

Query: 287 KYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKALQR 436
           + PI+ G + N D   +IW H F + L +AP    +LLTEAPL+  ++QR
Sbjct: 62  RRPIDRGYLINSDLQREIWSHLFTSLLHIAPSSSSLLLTEAPLSIPSVQR 111


>UniRef50_A2YQV6 Cluster: Putative uncharacterized protein; n=1;
           Oryza sativa (indica cultivar-group)|Rep: Putative
           uncharacterized protein - Oryza sativa subsp. indica
           (Rice)
          Length = 581

 Score = 62.5 bits (145), Expect = 5e-09
 Identities = 29/68 (42%), Positives = 40/68 (58%), Gaps = 3/68 (4%)
 Frame = +2

Query: 224 MGQKDSYVGDGHKS---KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPV 394
           M   D ++GD   S     G+ T K+PI HG V +WD ME+ W    +N LR  PEEH  
Sbjct: 364 MADLDFFMGDEALSLFKSSGLYTRKHPINHGQVDDWDTMERFWQQCIFNYLRCNPEEHYF 423

Query: 395 LLTEAPLN 418
           LLT++P++
Sbjct: 424 LLTDSPVS 431


>UniRef50_A5B4L4 Cluster: Putative uncharacterized protein; n=1;
           Vitis vinifera|Rep: Putative uncharacterized protein -
           Vitis vinifera (Grape)
          Length = 571

 Score = 62.1 bits (144), Expect = 7e-09
 Identities = 29/67 (43%), Positives = 35/67 (52%), Gaps = 3/67 (4%)
 Frame = +2

Query: 224 MGQKDSYVGD---GHKSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPV 394
           M   D ++GD             L YPI HG V NWD ME+ W    +N LR  PE+H  
Sbjct: 120 MADLDFFIGDEAIARSRNSSTYNLSYPIVHGQVDNWDAMERFWQQCIFNYLRCDPEDHYF 179

Query: 395 LLTEAPL 415
           LLTE+PL
Sbjct: 180 LLTESPL 186


>UniRef50_Q19R57 Cluster: Actin-like protein 1; n=2; Trypanosoma
           cruzi|Rep: Actin-like protein 1 - Trypanosoma cruzi
           strain CL Brener
          Length = 390

 Score = 60.9 bits (141), Expect = 2e-08
 Identities = 37/114 (32%), Positives = 56/114 (49%), Gaps = 8/114 (7%)
 Frame = +2

Query: 107 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQ--------KDSYVGDGHK 262
           ++VD GS + KAG   +  P  +FP++VG P  +  ++   +            VG    
Sbjct: 2   IIVDFGSSLVKAGTVTESLPSLIFPAVVGVPAKKNGLLKRNKIALEEAPLAPFLVGAEAI 61

Query: 263 SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPK 424
            +    TL +PI HGIV +W  ME++ HHTF  E  +  EE  ++ TE    PK
Sbjct: 62  HEMHRATLHHPIRHGIVKDWPRMEQVIHHTFV-EFGMNSEETSIVCTEPLFTPK 114


>UniRef50_Q8LKR0 Cluster: Actin-related protein 6; n=26;
           Magnoliophyta|Rep: Actin-related protein 6 - Arabidopsis
           thaliana (Mouse-ear cress)
          Length = 422

 Score = 60.5 bits (140), Expect = 2e-08
 Identities = 33/108 (30%), Positives = 54/108 (50%)
 Frame = +2

Query: 113 VDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHKSKRGILTLKY 292
           +DNG G+ KAG  G+  P  V P+ + +P      +      +   +   +   +   + 
Sbjct: 8   LDNGGGLIKAGQGGERDPTTVIPNCLYKPLSSKKFIHPSPLTTLSDEIDLTSAAV---RR 64

Query: 293 PIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKALQR 436
           PI+ G + N D   +IW H F + L +AP    +LLTEAPL+  ++QR
Sbjct: 65  PIDRGYLINSDLQREIWSHLFTSLLHIAPSSSSLLLTEAPLSIPSVQR 112


>UniRef50_UPI0000EC9F4D Cluster: HSD21.; n=2; Gallus gallus|Rep:
           HSD21. - Gallus gallus
          Length = 373

 Score = 60.1 bits (139), Expect = 3e-08
 Identities = 34/106 (32%), Positives = 59/106 (55%), Gaps = 1/106 (0%)
 Frame = +2

Query: 107 LVVDNGSGMCKAGFAGDDAPRAVFPSIVG-RPRHQGVMVGMGQKDSYVGDGHKSKRGILT 283
           +V+D G+  C+AGF+G  +P A   ++VG R   +G   G+      +G+       I T
Sbjct: 15  IVIDMGTRSCRAGFSGHYSPSAEVSTLVGHRMGSEGASAGV-----IIGEEALLYSDIET 69

Query: 284 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNP 421
           ++  + +G + NW+  E + ++   +ELRV PE+H +LLTE   +P
Sbjct: 70  MEV-MHNGFIINWEAAENLCYYLLKHELRVNPEDHALLLTEPLFSP 114


>UniRef50_Q6C061 Cluster: Actin-related protein 4; n=1; Yarrowia
           lipolytica|Rep: Actin-related protein 4 - Yarrowia
           lipolytica (Candida lipolytica)
          Length = 432

 Score = 59.7 bits (138), Expect = 4e-08
 Identities = 35/119 (29%), Positives = 59/119 (49%), Gaps = 7/119 (5%)
 Frame = +2

Query: 92  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS-------YVG 250
           +EVA LV+D GS   + G+AG+D P+ V  +  G    + V +     ++        VG
Sbjct: 14  DEVATLVIDTGSSYTRVGYAGEDTPKLVVSTECGLMADEDVEMEDDTSNTTKKLNKYKVG 73

Query: 251 DGHKSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           D        + + +P+  GIV +WD ++ IW ++    L    + HP++LTE   N +A
Sbjct: 74  DSANLPLPNMEVLHPLTDGIVADWDAVQNIWEYSL-ARLNADTKTHPLMLTEPCWNTQA 131


>UniRef50_Q9H568 Cluster: Actin-like protein 8; n=10; Eutheria|Rep:
           Actin-like protein 8 - Homo sapiens (Human)
          Length = 366

 Score = 59.3 bits (137), Expect = 5e-08
 Identities = 36/114 (31%), Positives = 56/114 (49%), Gaps = 3/114 (2%)
 Frame = +2

Query: 107 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGR---PRHQGVMVGMGQKDSYVGDGHKSKRGI 277
           +++D+GSG  KAG AG + P+ VFP+IV       + G      +    +   H      
Sbjct: 6   VIIDHGSGFLKAGTAGWNEPQMVFPNIVNYLPCKENPGPSYARRRVSLGIDICHPD---- 61

Query: 278 LTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKALQRR 439
            T  YPIE G + NW+ ++ +W     N  R   E  PV++TE PL   A +++
Sbjct: 62  -TFSYPIERGRILNWEGVQYLWSFVLENHRR-EQEVPPVIITETPLREPADRKK 113


>UniRef50_Q6C0A9 Cluster: Yarrowia lipolytica chromosome F of strain
           CLIB122 of Yarrowia lipolytica; n=1; Yarrowia
           lipolytica|Rep: Yarrowia lipolytica chromosome F of
           strain CLIB122 of Yarrowia lipolytica - Yarrowia
           lipolytica (Candida lipolytica)
          Length = 427

 Score = 58.8 bits (136), Expect = 6e-08
 Identities = 31/113 (27%), Positives = 60/113 (53%), Gaps = 1/113 (0%)
 Frame = +2

Query: 92  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHKSKR 271
           +EV ++V++ GS   + GF+GDD P+ V P+  G+  +     G    +  + + H+   
Sbjct: 18  DEVTSIVIECGSSYTRVGFSGDDLPKVVIPTKYGKYTND---KGEDVYEFGLENVHRPVA 74

Query: 272 GILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAP-EEHPVLLTEAPLNPKA 427
           G   +  P++ G + +WD + K+W +    +L+V    E+P+++TE   N  A
Sbjct: 75  G-KEIYSPVQDGCIQDWDGVAKLWEYAIKEKLKVDDLSEYPLVITEQMWNSSA 126


>UniRef50_A6R1X8 Cluster: Putative uncharacterized protein; n=1;
           Ajellomyces capsulatus NAm1|Rep: Putative
           uncharacterized protein - Ajellomyces capsulatus NAm1
          Length = 444

 Score = 58.4 bits (135), Expect = 8e-08
 Identities = 33/104 (31%), Positives = 58/104 (55%), Gaps = 3/104 (2%)
 Frame = +2

Query: 92  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYV-GDG-HKS 265
           +EV+A+++D G    +AGFAG+D P++V P+  G+            +D Y+ GD  + +
Sbjct: 15  DEVSAIILDPGYSTVRAGFAGEDTPKSVIPTCYGK-------YTTDAQDKYIYGDSIYVT 67

Query: 266 KRGILTLKYPI-EHGIVTNWDDMEKIWHHTFYNELRVAPEEHPV 394
            R  L++  P+   GIV +WD  EK+W ++F + L      +P+
Sbjct: 68  PRPGLSIHNPMGREGIVEDWDAAEKVWEYSFTSRLTGPKSGNPL 111


>UniRef50_Q09849 Cluster: Uncharacterized protein C23D3.09; n=1;
           Schizosaccharomyces pombe|Rep: Uncharacterized protein
           C23D3.09 - Schizosaccharomyces pombe (Fission yeast)
          Length = 430

 Score = 58.4 bits (135), Expect = 8e-08
 Identities = 32/118 (27%), Positives = 64/118 (54%), Gaps = 2/118 (1%)
 Frame = +2

Query: 92  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHKSKR 271
           EE+ +LV+D GS   + G+AG+++P  + PS      + GV   +  ++ YV D  +   
Sbjct: 8   EEIPSLVIDPGSCWTRFGYAGEESPMTILPS------YYGVRSDVTGRNKYVVDELQIHA 61

Query: 272 GI--LTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKALQRR 439
            I  + +K    +GI+ +W+     W      +L+V P E+ +++TE   NP++++++
Sbjct: 62  PIPGMEVKNGKSNGIIQDWESTLYTWERGLKEKLQVNPTEYAMMITEPSWNPQSVRQQ 119


>UniRef50_Q5C3R3 Cluster: SJCHGC08022 protein; n=1; Schistosoma
           japonicum|Rep: SJCHGC08022 protein - Schistosoma
           japonicum (Blood fluke)
          Length = 209

 Score = 58.0 bits (134), Expect = 1e-07
 Identities = 39/107 (36%), Positives = 61/107 (57%), Gaps = 2/107 (1%)
 Frame = +2

Query: 107 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPR-HQGVMVGMGQKDSYVGDGHKSKRGILT 283
           +V+DNG+  C+AG++  + P   FP++V RPR  +GV+VG   +D       +S R   +
Sbjct: 39  IVIDNGNFECRAGYSNFEKPHMTFPNVVYRPRMSKGVLVGNDIQDL------ESVRH--S 90

Query: 284 LKYPIEHGIVTNWDDMEKIWHHTFYNELRV-APEEHPVLLTEAPLNP 421
           LK P    +V N D  E++  H F ++L V  P  +PV++ EA  NP
Sbjct: 91  LKSPFIDNLVINLDVQEQVISHIF-DKLNVQKPLSNPVVINEALCNP 136


>UniRef50_A2EUM6 Cluster: Actin family protein; n=1; Trichomonas
           vaginalis G3|Rep: Actin family protein - Trichomonas
           vaginalis G3
          Length = 360

 Score = 58.0 bits (134), Expect = 1e-07
 Identities = 34/99 (34%), Positives = 54/99 (54%)
 Frame = +2

Query: 107 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHKSKRGILTL 286
           LV+D GSG  KAGFAG+D+P  VFP++VG  RH   +      D  +G+   S   + T+
Sbjct: 8   LVLDFGSGFVKAGFAGNDSPSLVFPTVVGNLRH-AKLGPSNSNDPLIGESALSGANV-TV 65

Query: 287 KYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLT 403
           K PI    + + +D   I ++ F   L +  E + +L++
Sbjct: 66  KRPIVRSEIQSPEDFYSIVNYIF-QTLEIKGENNHILIS 103


>UniRef50_Q54E71 Cluster: Putative uncharacterized protein; n=1;
           Dictyostelium discoideum AX4|Rep: Putative
           uncharacterized protein - Dictyostelium discoideum AX4
          Length = 684

 Score = 57.6 bits (133), Expect = 1e-07
 Identities = 35/106 (33%), Positives = 58/106 (54%), Gaps = 1/106 (0%)
 Frame = +2

Query: 107 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRH-QGVMVGMGQKDSYVGDGHKSKRGILT 283
           +++DNGS  C+AGFA D +P+ +F S+VG+ +     +VG   K+   GD  +     LT
Sbjct: 33  IIIDNGSYQCRAGFANDISPKLIFRSLVGKVKSTSSPIVGNSLKE---GDISR-----LT 84

Query: 284 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNP 421
           +K P +  ++ +    E I+ + F+        E+PVL+TE   NP
Sbjct: 85  IKSPFDSNLLVHPPSQESIFDYIFHKFGIENEIENPVLITEPTSNP 130


>UniRef50_Q7S6X6 Cluster: Actin-like protein arp-6; n=5;
           Pezizomycotina|Rep: Actin-like protein arp-6 -
           Neurospora crassa
          Length = 446

 Score = 56.8 bits (131), Expect = 3e-07
 Identities = 37/117 (31%), Positives = 60/117 (51%), Gaps = 8/117 (6%)
 Frame = +2

Query: 107 LVVDNGSGMCKAGFAGDDA----PRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHKSKR- 271
           LV+DNG+   KAGF  DD     PR + P+ + R RH+ + VG         +  K K  
Sbjct: 22  LVLDNGADTIKAGFVSDDKSDGKPR-IIPNCLARDRHRKIYVG--------SELEKCKDF 72

Query: 272 GILTLKYPIEHGIVTNWDDMEKIWHHTFYNE---LRVAPEEHPVLLTEAPLNPKALQ 433
             L  + P+E G + NW+  ++IW   F+++    +  P +  ++LTE P +  +LQ
Sbjct: 73  SELAFRRPVEKGFIVNWEAQKEIWDREFFDDKAAQKCDPSDTRLILTEQPNSLPSLQ 129


>UniRef50_UPI0000E4A0BF Cluster: PREDICTED: similar to Actin-related
           protein 5; n=2; Strongylocentrotus purpuratus|Rep:
           PREDICTED: similar to Actin-related protein 5 -
           Strongylocentrotus purpuratus
          Length = 602

 Score = 56.4 bits (130), Expect = 3e-07
 Identities = 33/109 (30%), Positives = 56/109 (51%), Gaps = 4/109 (3%)
 Frame = +2

Query: 107 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHKSKRGI-LT 283
           +++DNGS   + G+A +  PR  F +I+ R R      G    D+ +G+   +   +   
Sbjct: 93  IIIDNGSCFSRVGWASEGTPRLTFRNIIARQR------GKKDSDAQIGNDIPNVETVRWL 146

Query: 284 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPE---EHPVLLTEAPLNP 421
           LK   +  +VT++D  E+I  H F   L +  E   +HP+++TE P NP
Sbjct: 147 LKTQFDRDVVTHYDAQEQILDHAF-QRLGIDSEGAVKHPIVMTETPCNP 194


>UniRef50_P80428 Cluster: Actin-related protein 4; n=4;
           Saccharomycetales|Rep: Actin-related protein 4 -
           Saccharomyces cerevisiae (Baker's yeast)
          Length = 489

 Score = 56.4 bits (130), Expect = 3e-07
 Identities = 35/110 (31%), Positives = 53/110 (48%), Gaps = 1/110 (0%)
 Frame = +2

Query: 92  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHKSKR 271
           +EV+A+V+D GS     G++G D P+++ PS+ G+          G K  +        R
Sbjct: 12  DEVSAVVIDPGSYTTNIGYSGSDFPQSILPSVYGK-----YTADEGNKKIFSEQSIGIPR 66

Query: 272 GILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEH-PVLLTEAPLN 418
               LK  IE+G+V +WD  ++ W     NEL +      P LLTE   N
Sbjct: 67  KDYELKPIIENGLVIDWDTAQEQWQWALQNELYLNSNSGIPALLTEPVWN 116


>UniRef50_A3BPG0 Cluster: Putative uncharacterized protein; n=3;
           Oryza sativa|Rep: Putative uncharacterized protein -
           Oryza sativa subsp. japonica (Rice)
          Length = 467

 Score = 56.0 bits (129), Expect = 4e-07
 Identities = 23/59 (38%), Positives = 36/59 (61%)
 Frame = +2

Query: 242 YVGDGHKSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLN 418
           YVG   + +R  + +  P++ G VT+WD ++ IW+H F   L + PEEHP+L+ E   N
Sbjct: 105 YVGQELEFRRDHMEVISPMKDGTVTDWDIVDNIWNHAFRQRLLINPEEHPMLIAEPSTN 163



 Score = 52.0 bits (119), Expect = 7e-06
 Identities = 21/32 (65%), Positives = 28/32 (87%)
 Frame = +2

Query: 92  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSI 187
           +EV+A+V+D GS  CKAG+AGDD P+AVFPS+
Sbjct: 5   DEVSAIVIDVGSYSCKAGYAGDDTPKAVFPSL 36


>UniRef50_UPI0000499930 Cluster: actin; n=1; Entamoeba histolytica
           HM-1:IMSS|Rep: actin - Entamoeba histolytica HM-1:IMSS
          Length = 372

 Score = 55.6 bits (128), Expect = 6e-07
 Identities = 34/111 (30%), Positives = 59/111 (53%)
 Frame = +2

Query: 107 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHKSKRGILTL 286
           +V+D GS  C+ G AG+  P  +FPS VG PR +  +    + D YVG   K ++    +
Sbjct: 5   IVLDFGSQTCRVGNAGESMPTNIFPSYVGIPREKSQL----KPDFYVGKILKEQKREFQI 60

Query: 287 KYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKALQRR 439
           K PI++G + +      ++ +   +E +   +  P+L TE  LNPK ++ +
Sbjct: 61  KSPIKNGTIEDISMASALFKNAL-DECQGYGK--PILFTEPALNPKQIREK 108


>UniRef50_UPI0000498FDF Cluster: actin; n=1; Entamoeba histolytica
           HM-1:IMSS|Rep: actin - Entamoeba histolytica HM-1:IMSS
          Length = 763

 Score = 54.0 bits (124), Expect = 2e-06
 Identities = 33/104 (31%), Positives = 58/104 (55%)
 Frame = +2

Query: 110 VVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHKSKRGILTLK 289
           ++D GS   K+GF     P  V P++VG+  HQ    G  +++ YVGD    KRGIL+L+
Sbjct: 425 IIDIGSCSIKSGFESVGTPSIVTPTVVGKNLHQ--TSGFVEQNLYVGDEAIDKRGILSLE 482

Query: 290 YPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNP 421
           YP++   + +++ ++ +  H+    + VA + HP ++    L P
Sbjct: 483 YPMQKEPI-DYNSLKSVMKHS----VEVA-QGHPTVVITNGLTP 520


>UniRef50_Q9LHH0 Cluster: Actin-like protein; n=11;
           Magnoliophyta|Rep: Actin-like protein - Arabidopsis
           thaliana (Mouse-ear cress)
          Length = 724

 Score = 54.0 bits (124), Expect = 2e-06
 Identities = 35/111 (31%), Positives = 55/111 (49%), Gaps = 6/111 (5%)
 Frame = +2

Query: 107 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHKSKRGILTL 286
           +V+DNG+   + G+AG+  PR VF +IV RPRH+      G+  + VGD   S       
Sbjct: 22  IVIDNGASYFRIGWAGETEPRVVFRNIVQRPRHKAT----GETVTIVGDLDPSMMKYFDC 77

Query: 287 -----KYPIEHGIVTNWDDMEKIWHHTFYN-ELRVAPEEHPVLLTEAPLNP 421
                + P +  +V  ++ ME I  + F       +  +HP+L+TE   NP
Sbjct: 78  TRSGPRSPFDSNVVYQFEIMEYILDYAFDRLGANGSGIDHPILITECACNP 128


>UniRef50_A0D9D5 Cluster: Chromosome undetermined scaffold_42, whole
           genome shotgun sequence; n=1; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_42,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 94

 Score = 54.0 bits (124), Expect = 2e-06
 Identities = 27/67 (40%), Positives = 40/67 (59%), Gaps = 2/67 (2%)
 Frame = +2

Query: 107 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRP--RHQGVMVGMGQKDSYVGDGHKSKRGIL 280
           ++ D+G+G  K GFAGD+ P   FP++VGRP  R    +     KD  +GD  +  RG+L
Sbjct: 5   IIEDSGTGYLKIGFAGDNFPSHSFPAMVGRPTLRADEQLDDANLKDIMIGDEAQPYRGLL 64

Query: 281 TLKYPIE 301
            L +P+E
Sbjct: 65  ELTHPLE 71


>UniRef50_Q0V0G6 Cluster: Putative uncharacterized protein; n=1;
           Phaeosphaeria nodorum|Rep: Putative uncharacterized
           protein - Phaeosphaeria nodorum (Septoria nodorum)
          Length = 443

 Score = 54.0 bits (124), Expect = 2e-06
 Identities = 43/124 (34%), Positives = 59/124 (47%), Gaps = 14/124 (11%)
 Frame = +2

Query: 107 LVVDNGSGMCKAGF--AGDDAPR----AVFPSIVGRPRHQGVMVGMGQKDSYVG---DGH 259
           LV+DNG+   KAG+  +  +AP      V P+ + R            K +YVG   DG 
Sbjct: 18  LVLDNGAYAIKAGYVPSASEAPTYDDCRVIPNCIARSTRD--------KCTYVGSDLDGC 69

Query: 260 KSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNE-----LRVAPEEHPVLLTEAPLNPK 424
           K   G L  + P+E G + NW+  + IW H F         R  P+E  +LLTE P  PK
Sbjct: 70  KDF-GELAFRRPVEKGFIVNWEAEKAIWEHEFMEAAVVEGFRCDPKETNLLLTEKPNCPK 128

Query: 425 ALQR 436
            LQ+
Sbjct: 129 ELQK 132


>UniRef50_Q17GZ9 Cluster: Actin-related protein 5; n=4;
           Endopterygota|Rep: Actin-related protein 5 - Aedes
           aegypti (Yellowfever mosquito)
          Length = 655

 Score = 53.6 bits (123), Expect = 2e-06
 Identities = 35/114 (30%), Positives = 57/114 (50%), Gaps = 7/114 (6%)
 Frame = +2

Query: 101 AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQ---KDSYVGDGHKSKR 271
           AA+V+DNGS  C+AG+AG D P  VF +++ +PR         +       +G+   +  
Sbjct: 28  AAIVIDNGSYHCRAGWAGKDVPSLVFKNVLAKPRKDRSKKDTSEVVVPTVQIGNDITNIE 87

Query: 272 GI-LTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPE---EHPVLLTEAPLNP 421
            +   L+   +  +VT+    E+I+ + F   L +  +    HPVLLTE   NP
Sbjct: 88  AVRFQLRTQFDRNVVTHLHVQEQIFDYLF-GRLGINADGCVPHPVLLTECVANP 140


>UniRef50_Q54KZ7 Cluster: Putative uncharacterized protein; n=1;
           Dictyostelium discoideum AX4|Rep: Putative
           uncharacterized protein - Dictyostelium discoideum AX4
          Length = 490

 Score = 53.2 bits (122), Expect = 3e-06
 Identities = 28/103 (27%), Positives = 56/103 (54%), Gaps = 1/103 (0%)
 Frame = +2

Query: 107 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHKSKRGILTL 286
           L++DNG    K        P  + P+ VG+ +++   + MG++     D  + +      
Sbjct: 31  LIIDNGGHTLKIATNNPSQPHIIVPNQVGKVKNEKHQI-MGEELINYNDPSEVRS----- 84

Query: 287 KYPIEHGIVTNWDDMEKIWHHTF-YNELRVAPEEHPVLLTEAP 412
           + P+E G +TNW   ++IW + F  +++++ P+++ +LLTEAP
Sbjct: 85  RNPMEKGYITNWGLEKEIWDYAFKRDDMKIKPQDYNLLLTEAP 127


>UniRef50_Q22WQ4 Cluster: Actin family protein; n=1; Tetrahymena
           thermophila SB210|Rep: Actin family protein -
           Tetrahymena thermophila SB210
          Length = 444

 Score = 53.2 bits (122), Expect = 3e-06
 Identities = 41/139 (29%), Positives = 67/139 (48%), Gaps = 27/139 (19%)
 Frame = +2

Query: 83  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPR-------------------- 202
           M  E++ A+VVD GS   +AG++G+D PR V PS VG                       
Sbjct: 1   MFTEDITAIVVDPGSLSIRAGYSGEDTPRLVMPSQVGVREEIKVPDQSQLLKDEDGNIIN 60

Query: 203 -HQGVMVGMGQKDS-----YVGDGH-KSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYN 361
             Q  M+   + D      YVG+ + K +R  + +     +G V +WD  EK+    + N
Sbjct: 61  AEQNKMIEENKSDDKFKNYYVGESNLKIRRDNMEVVSSYMNGEVKDWDAFEKLLLDVYEN 120

Query: 362 ELRVAPEEHPVLLTEAPLN 418
           ++RV P E+ +L++E+ L+
Sbjct: 121 QIRVQPSEYCLLISESSLH 139


>UniRef50_Q6BIA3 Cluster: CA5059|IPF3691 Candida albicans IPF3691;
           n=5; Saccharomycetales|Rep: CA5059|IPF3691 Candida
           albicans IPF3691 - Debaryomyces hansenii (Yeast)
           (Torulaspora hansenii)
          Length = 450

 Score = 52.8 bits (121), Expect = 4e-06
 Identities = 38/108 (35%), Positives = 56/108 (51%), Gaps = 3/108 (2%)
 Frame = +2

Query: 104 ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHKSKRGILT 283
           A+V+DNGS   KAGFA DD P  VF S      +  V VG    D  V +  +S   I+T
Sbjct: 7   AVVIDNGSHTTKAGFALDDLPSLVFNSNYVVDSNSKVQVG----DKQVDESPES--DIMT 60

Query: 284 LKYPIEHGIVTNWDDMEKIWHHTF---YNELRVAPEEHPVLLTEAPLN 418
               +E+G++ N+D +   W + +    N   +  +E P++LTE P N
Sbjct: 61  F---MENGLIYNFDSIVHNWQYVYDNIDNNNAINAKEFPLMLTEQPWN 105


>UniRef50_A7TM96 Cluster: Putative uncharacterized protein; n=1;
           Vanderwaltozyma polyspora DSM 70294|Rep: Putative
           uncharacterized protein - Vanderwaltozyma polyspora DSM
           70294
          Length = 488

 Score = 52.8 bits (121), Expect = 4e-06
 Identities = 30/100 (30%), Positives = 51/100 (51%), Gaps = 1/100 (1%)
 Frame = +2

Query: 107 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVG-MGQKDSYVGDGHKSKRGILT 283
           +V+ NG+    AGF+  + P+ + PS   + +    + G     DS   +G +S   I T
Sbjct: 9   VVIHNGTSTTIAGFSNSEIPKCIIPSSYLKKKDGSFVFGTFDMMDSLEDEGAESD--IFT 66

Query: 284 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLT 403
           +    + G+  NW+ +EK W + F  +L+  P E PVL+T
Sbjct: 67  I-VDSQLGVPYNWEALEKQWEYIFEKQLKCDPTELPVLIT 105


>UniRef50_Q2H0E9 Cluster: Putative uncharacterized protein; n=1;
           Chaetomium globosum|Rep: Putative uncharacterized
           protein - Chaetomium globosum (Soil fungus)
          Length = 656

 Score = 52.4 bits (120), Expect = 6e-06
 Identities = 34/111 (30%), Positives = 53/111 (47%), Gaps = 5/111 (4%)
 Frame = +2

Query: 101 AALVVDNGSGMCKAGFAGDDAPRAVFPSIVG--RPRHQGVMVGMGQKDSYVGDGHKSKRG 274
           A +V+DNGS   +AG++ +D PR   P I+   R R  G       +D Y      + RG
Sbjct: 54  AVIVIDNGSSTVRAGWSFEDKPRLAIPPIMSKYRDRKAGKTFSFAGQDCY---ADTTARG 110

Query: 275 ILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPE---EHPVLLTEAPLN 418
            +   +    GIV++WD +E +  H F        E   + P+++TEA  N
Sbjct: 111 HIRNAFEAGTGIVSSWDVVEHVLDHVFIKLGMNGVEGGIDMPIVMTEAVAN 161


>UniRef50_A1C924 Cluster: Actin family protein; n=4;
           Eurotiomycetidae|Rep: Actin family protein - Aspergillus
           clavatus
          Length = 436

 Score = 52.4 bits (120), Expect = 6e-06
 Identities = 35/127 (27%), Positives = 64/127 (50%), Gaps = 18/127 (14%)
 Frame = +2

Query: 110 VVDNGSGMCKAGFAGDDAPR----------AVFPSIVGRPRHQGVMVGMGQKDSYVGDGH 259
           ++DNG+   KAG+A +  P           ++ P+ + + R   + +G  Q  + V D +
Sbjct: 26  IIDNGAYTLKAGYASESPPTNDIDQALSACSIIPNAIAKTRGNRIYIG-AQLSTQVTDWN 84

Query: 260 KSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNE-------LRVA-PEEHPVLLTEAPL 415
           +     +  + P+E G + NW+  ++IW  +F++E       LR+  PE+  ++LTEAP 
Sbjct: 85  E-----MAFRRPVEKGYIVNWEAQKEIWETSFFDEKTVRSKDLRIENPEDTTLVLTEAPN 139

Query: 416 NPKALQR 436
               LQR
Sbjct: 140 ALPTLQR 146


>UniRef50_UPI0000F2D271 Cluster: PREDICTED: similar to actin-like 8;
           n=1; Monodelphis domestica|Rep: PREDICTED: similar to
           actin-like 8 - Monodelphis domestica
          Length = 370

 Score = 51.6 bits (118), Expect = 1e-05
 Identities = 31/103 (30%), Positives = 50/103 (48%), Gaps = 3/103 (2%)
 Frame = +2

Query: 104 ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGR---PRHQGVMVGMGQKDSYVGDGHKSKRG 274
           ++V+D G+  CKAG  G + P    P ++G    P + G      Q    VG  + +   
Sbjct: 4   SVVIDIGNDWCKAGLGGKNYPTIAVPEVIGYQSFPENPG--PSNPQTRKIVGFNNLALMK 61

Query: 275 ILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLT 403
            L  ++PI  G V NW+ ME +  + F   L +  E+H +L+T
Sbjct: 62  ELPTEFPIVRGQVKNWEAMETVLTYAF-ESLGIKTEDHAILVT 103


>UniRef50_UPI0000E80C06 Cluster: PREDICTED: hypothetical protein;
           n=1; Gallus gallus|Rep: PREDICTED: hypothetical protein
           - Gallus gallus
          Length = 65

 Score = 51.6 bits (118), Expect = 1e-05
 Identities = 28/59 (47%), Positives = 32/59 (54%)
 Frame = +3

Query: 93  KKLPRW**TMAPVCARPASQEMMLLAQCFPRSWEGPAIRA*WSVWDRRTLM*EMGTRAK 269
           +KL  W  TMA VCAR A   MM    C    W+ P I+  W VW RRT M EM  RA+
Sbjct: 2   RKLLPWWWTMALVCARQALLGMMPPGLCSLPLWDAPGIKVSWWVWGRRTAMWEMKPRAR 60


>UniRef50_Q00UL2 Cluster: Alpha amylase 1; n=3; Ostreococcus|Rep:
           Alpha amylase 1 - Ostreococcus tauri
          Length = 913

 Score = 51.6 bits (118), Expect = 1e-05
 Identities = 25/33 (75%), Positives = 28/33 (84%)
 Frame = -2

Query: 186 IEGNTARGASSPAKPALHIPEPLSTTNAATSSS 88
           ++GNTA GASSPAKPAL IPEPLS T+A TS S
Sbjct: 1   MDGNTAFGASSPAKPALTIPEPLSHTSAETSPS 33


>UniRef50_Q5KAQ4 Cluster: Actin-like protein ARP6; n=1;
           Filobasidiella neoformans|Rep: Actin-like protein ARP6 -
           Cryptococcus neoformans (Filobasidiella neoformans)
          Length = 490

 Score = 51.6 bits (118), Expect = 1e-05
 Identities = 35/107 (32%), Positives = 52/107 (48%), Gaps = 3/107 (2%)
 Frame = +2

Query: 107 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHKSKRGILTL 286
           L++DNG+   KAG +G D    V P+ + R R         +K  YVGD   + + +  +
Sbjct: 7   LIIDNGAYEIKAGISGVDWEPRVLPNSIARSR--------TEKRVYVGDEIDNCKDLSGI 58

Query: 287 KY--PIEHGIVTNWDDMEKIWHHTFY-NELRVAPEEHPVLLTEAPLN 418
            Y  P E G++ NWD    IW   F  + L + P E  +L+TE   N
Sbjct: 59  VYRRPFEKGMLVNWDAERIIWDRLFSPSVLNINPTETSLLVTEPYFN 105


>UniRef50_Q9N4N4 Cluster: Putative uncharacterized protein; n=2;
           Caenorhabditis|Rep: Putative uncharacterized protein -
           Caenorhabditis elegans
          Length = 436

 Score = 51.2 bits (117), Expect = 1e-05
 Identities = 39/133 (29%), Positives = 62/133 (46%), Gaps = 17/133 (12%)
 Frame = +2

Query: 92  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHK--S 265
           +EV+ LV D GS   + GFAG++ P+   PS +             Q+    GD  K  +
Sbjct: 9   DEVSGLVFDAGSQSFRVGFAGEEYPKGDIPSYIAVQEALPDDTIEKQEAMEEGDNSKVQT 68

Query: 266 KR------GILTLKYP---------IEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLL 400
           KR      G   +  P         ++ G++ +W+  EKI  H++ N L   P EHPVL 
Sbjct: 69  KREKNFFIGTTKIIVPRARTNMESFMKEGLIEDWELFEKIVEHSYENILYSNPSEHPVLF 128

Query: 401 TEAPLNPKALQRR 439
           +E+  N +A + +
Sbjct: 129 SESSWNDRARREK 141


>UniRef50_Q6CSB9 Cluster: Actin-related protein 4; n=1;
           Kluyveromyces lactis|Rep: Actin-related protein 4 -
           Kluyveromyces lactis (Yeast) (Candida sphaerica)
          Length = 520

 Score = 51.2 bits (117), Expect = 1e-05
 Identities = 30/117 (25%), Positives = 57/117 (48%), Gaps = 1/117 (0%)
 Frame = +2

Query: 92  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHKSKR 271
           +E+ A+V+D GS +   G++G D P+++ PS  G     G       K  +        R
Sbjct: 12  DEINAIVIDPGSFVTNIGYSGTDCPQSIMPSSYGNVETDG-----DTKRIFNEQPLLFPR 66

Query: 272 GILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEE-HPVLLTEAPLNPKALQRR 439
             + +K  +E+  + +WD  ++ W +    +L+    +  PVLLTE   N +A +++
Sbjct: 67  AGMEIKPIVENSTIVDWDRAQEQWEYALNTDLKFESNKGTPVLLTEPIWNSEASRKK 123


>UniRef50_Q18PR4 Cluster: Actin-related protein; n=1; Porphyra
           yezoensis|Rep: Actin-related protein - Porphyra
           yezoensis
          Length = 573

 Score = 50.8 bits (116), Expect = 2e-05
 Identities = 39/141 (27%), Positives = 68/141 (48%), Gaps = 9/141 (6%)
 Frame = +2

Query: 89  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVG---RPRHQGVMVGMGQKDSYVGDGH 259
           D  V ++V D GS  CK GFAG+D P +++ S +G    P      V   ++   VGD  
Sbjct: 5   DGTVPSVVFDFGSHTCKVGFAGEDLPHSLYSSNIGAFPSPVVANGGVQPAKRGIIVGDQA 64

Query: 260 KS-KRGILTLKYPIE-HGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKALQ 433
            + +R  + +    + +G+V NW+  E +  H +   ++ A E+  V+  E P +    Q
Sbjct: 65  LAIRRDDMNVTPAFDANGLVANWEAYEGLLAHAYSTGVQAASEDFAVMYAE-PTHACIRQ 123

Query: 434 RRR*PQI----HGSKTIQHAP 484
           R R  ++    HG+  +  +P
Sbjct: 124 RERIGELLFETHGAPALAVSP 144


>UniRef50_UPI0000498A93 Cluster: actin; n=1; Entamoeba histolytica
           HM-1:IMSS|Rep: actin - Entamoeba histolytica HM-1:IMSS
          Length = 360

 Score = 50.4 bits (115), Expect = 2e-05
 Identities = 32/109 (29%), Positives = 52/109 (47%)
 Frame = +2

Query: 95  EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHKSKRG 274
           E   +V+D GS   KAG A D+AP  +  +++G     G + G    ++ + D H     
Sbjct: 3   EEVPIVLDIGSYSIKAGTAEDEAPSCIIRNVIGE-HETGKIYGESVFNNNIKDYH----- 56

Query: 275 ILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNP 421
                YPI  G++++ DD+E I    F   + V     P+++TE  L P
Sbjct: 57  -----YPINRGMISDCDDIEGILRFVFDENMGVDASTRPIIVTEEALCP 100


>UniRef50_Q5CKL2 Cluster: BRG1/brm-associated factor 53A; n=2;
           Cryptosporidium|Rep: BRG1/brm-associated factor 53A -
           Cryptosporidium hominis
          Length = 423

 Score = 50.4 bits (115), Expect = 2e-05
 Identities = 38/117 (32%), Positives = 59/117 (50%), Gaps = 1/117 (0%)
 Frame = +2

Query: 92  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHKSKR 271
           ++V A++VD GS M K G+ G+D PR V+PS+VG  +  G         SY+ D      
Sbjct: 11  DDVGAIIVDVGSYMTKIGYGGEDCPRQVWPSVVG-VKESGDKRFPLNFLSYLEDVSVEP- 68

Query: 272 GILTLKYPIEHGIVTNWDDMEKIWHHTFYN-ELRVAPEEHPVLLTEAPLNPKALQRR 439
               LKY ++  ++ N D  E+I   T     L     EHP+LLTE   + + ++ +
Sbjct: 69  ---CLKY-VDGDLILNGDVFEEIIRTTSGKIGLSTDLREHPILLTEPSKHNRQIREK 121


>UniRef50_Q75JT2 Cluster: Similar to Drosophila melanogaster (Fruit
           fly). RE12057p; n=4; Dictyostelium discoideum|Rep:
           Similar to Drosophila melanogaster (Fruit fly). RE12057p
           - Dictyostelium discoideum (Slime mold)
          Length = 414

 Score = 50.0 bits (114), Expect = 3e-05
 Identities = 36/94 (38%), Positives = 52/94 (55%)
 Frame = +2

Query: 143 GFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHKSKRGILTLKYPIEHGIVTNW 322
           GF+GD++P A FPS+VG  + +     +GQ DSY+         +LT K          W
Sbjct: 198 GFSGDESPHA-FPSVVGFSKPK-----IGQVDSYLL--------LLTGKI---------W 234

Query: 323 DDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPK 424
              +K W+H F ++L V+ ++HPV LTE P NPK
Sbjct: 235 ---KKFWNHAFNDQLCVSSDQHPVFLTEPPFNPK 265


>UniRef50_Q4WA13 Cluster: Chromatin remodeling complex subunit
           (Arp5), putative; n=14; Pezizomycotina|Rep: Chromatin
           remodeling complex subunit (Arp5), putative -
           Aspergillus fumigatus (Sartorya fumigata)
          Length = 757

 Score = 49.6 bits (113), Expect = 4e-05
 Identities = 28/85 (32%), Positives = 45/85 (52%)
 Frame = +2

Query: 101 AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHKSKRGIL 280
           +A+V+DNGS + KAG++ D +PR + P ++ R R + +  G  Q   Y      + RG L
Sbjct: 59  SAIVIDNGSSLLKAGWSFDVSPRFILPPVMSRYRDRKLNKGC-QFIGYDAYVDATTRGQL 117

Query: 281 TLKYPIEHGIVTNWDDMEKIWHHTF 355
              +     +V NWD ME +  + F
Sbjct: 118 RYAFDPGTSVVGNWDVMEGLLDYVF 142


>UniRef50_Q12406 Cluster: Actin-related protein 7; n=2;
           Saccharomyces cerevisiae|Rep: Actin-related protein 7 -
           Saccharomyces cerevisiae (Baker's yeast)
          Length = 477

 Score = 49.6 bits (113), Expect = 4e-05
 Identities = 28/107 (26%), Positives = 50/107 (46%), Gaps = 1/107 (0%)
 Frame = +2

Query: 107 LVVDNGSGMCKAGFAGDDAPRAVFPS-IVGRPRHQGVMVGMGQKDSYVGDGHKSKRGILT 283
           +V+ NGS    AGF+  + P+ + PS  + R    G    +    + +    + + G   
Sbjct: 8   VVIHNGSHRTVAGFSNVELPQCIIPSSYIKRTDEGGEAEFIFGTYNMIDAAAEKRNGDEV 67

Query: 284 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPK 424
                  G+  NWD +E  W + +  +L+V+PEE P+++T    N K
Sbjct: 68  YTLVDSQGLPYNWDALEMQWRYLYDTQLKVSPEELPLVITMPATNGK 114


>UniRef50_Q6BXN0 Cluster: Actin-related protein 4; n=7;
           Saccharomycetales|Rep: Actin-related protein 4 -
           Debaryomyces hansenii (Yeast) (Torulaspora hansenii)
          Length = 492

 Score = 49.2 bits (112), Expect = 5e-05
 Identities = 26/111 (23%), Positives = 54/111 (48%), Gaps = 6/111 (5%)
 Frame = +2

Query: 92  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMV------GMGQKDSYVGD 253
           +E+ A+V+D+ S   + G+AGDD P+ + PS    P    + +      G  +     G+
Sbjct: 14  DEINAIVLDSSSFHTRIGYAGDDFPKIITPSSYASPNEDAMELDNKKKNGKSKSSKIFGE 73

Query: 254 GHKSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE 406
                R    +   ++  ++ +W+   + +H+ F + L +  +E P+L+TE
Sbjct: 74  SINIPRSNHNVSPILKDSVIIDWEAAIEQYHYYFDDVLTLNYKEQPILITE 124


>UniRef50_Q7QA11 Cluster: ENSANGP00000003921; n=1; Anopheles gambiae
           str. PEST|Rep: ENSANGP00000003921 - Anopheles gambiae
           str. PEST
          Length = 390

 Score = 48.8 bits (111), Expect = 7e-05
 Identities = 32/109 (29%), Positives = 58/109 (53%), Gaps = 4/109 (3%)
 Frame = +2

Query: 107 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHKSKRGI-LT 283
           +V+DNGS  C+AG+   + P  VF +I+ +PR         +KD  +G+   +   + L 
Sbjct: 5   IVIDNGSFNCRAGWMLKEKPALVFRNILAKPRKD-----RNKKDIEIGNDIVNIEALRLQ 59

Query: 284 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEE---HPVLLTEAPLNP 421
           L+   +  +VT+++  E+I+ + F  +L +  E    H V++TE   NP
Sbjct: 60  LRTQFDRNVVTHYNVQEQIFDYIF-TKLGINSENSVPHKVMITECLFNP 107


>UniRef50_Q5AXH1 Cluster: Actin-like protein arp6; n=5;
           Trichocomaceae|Rep: Actin-like protein arp6 - Emericella
           nidulans (Aspergillus nidulans)
          Length = 479

 Score = 48.4 bits (110), Expect = 9e-05
 Identities = 37/127 (29%), Positives = 62/127 (48%), Gaps = 18/127 (14%)
 Frame = +2

Query: 110 VVDNGSGMCKAGFAGDDAPR----------AVFPSIVGRPRHQGVMVGMGQKDSYVGDGH 259
           ++DNG+   KAG+A D  P           A  P+ + + R     VG  Q  + V D +
Sbjct: 26  IIDNGAYNMKAGYAPDSQPLDDEEIALSACAAIPNAIVKTRANRTYVG-AQIGTNVTDWN 84

Query: 260 KSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYN-------ELRVA-PEEHPVLLTEAPL 415
           +     +  + P+E G   NW+  ++IW ++F++       EL +A PE+  ++ TEAP 
Sbjct: 85  E-----MLFRRPVEKGYTVNWEAQKEIWENSFFDERTVRSKELHIADPEDVTIIFTEAPN 139

Query: 416 NPKALQR 436
              ALQ+
Sbjct: 140 ALPALQK 146


>UniRef50_UPI00004987CF Cluster: actin; n=2; Entamoeba histolytica
           HM-1:IMSS|Rep: actin - Entamoeba histolytica HM-1:IMSS
          Length = 876

 Score = 47.6 bits (108), Expect = 2e-04
 Identities = 35/112 (31%), Positives = 55/112 (49%), Gaps = 1/112 (0%)
 Frame = +2

Query: 80  KMCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGH 259
           K+ D+  A LV D GS   K G AG++ PR V P+       +    G  ++  +   G+
Sbjct: 512 KIADD--AVLVFDCGSSFIKVGVAGEEQPRKVIPTCYCTIEDEDYEGG--ERKEF---GY 564

Query: 260 KSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVA-PEEHPVLLTEAP 412
           K+      L +P++    T+WD +  I  + + NEL    P  HPV++TE P
Sbjct: 565 KAIDEDEGLVWPLDPRKDTDWDGLLAIIQNIYENELDGCDPASHPVVMTELP 616


>UniRef50_Q9VEC3 Cluster: Actin-related protein 5; n=1; Drosophila
           melanogaster|Rep: Actin-related protein 5 - Drosophila
           melanogaster (Fruit fly)
          Length = 648

 Score = 47.6 bits (108), Expect = 2e-04
 Identities = 33/120 (27%), Positives = 55/120 (45%), Gaps = 15/120 (12%)
 Frame = +2

Query: 107 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS------------YVG 250
           LV+DNGS  C+ G++    P   F +++ +PR          + S             VG
Sbjct: 7   LVIDNGSYECRVGWSDSKEPDLRFRNVLTKPRKDRKKEAAASEGSASQTTVEQSAEIQVG 66

Query: 251 DGHKSKRGILT-LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPE--EHPVLLTEAPLNP 421
           +   +   +   LK P E  ++TNW+  E+I+ + F        +  +HP++LTEA  NP
Sbjct: 67  NDITNIEAVRAHLKSPFERNVITNWNHQEQIFDYIFTKMGFDGQDKIDHPIILTEALANP 126


>UniRef50_Q7SHR0 Cluster: Actin-related protein 4; n=16;
           Pezizomycotina|Rep: Actin-related protein 4 - Neurospora
           crassa
          Length = 469

 Score = 47.6 bits (108), Expect = 2e-04
 Identities = 28/93 (30%), Positives = 43/93 (46%)
 Frame = +2

Query: 92  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHKSKR 271
           +EV+ALV+D G    +AG+AG++ P+ V PS  G    + V       D Y+      K 
Sbjct: 20  DEVSALVLDPGYCNTRAGYAGEEMPKQVLPSFYGHINGRDVF-----GDEYI----VPKP 70

Query: 272 GILTLKYPIEHGIVTNWDDMEKIWHHTFYNELR 370
           G     Y     +V +WD   ++W H     L+
Sbjct: 71  GFEVRNYMNRDSVVEDWDAATRMWEHVLVKRLQ 103


>UniRef50_Q6CF37 Cluster: Similar to sp|P53946 Saccharomyces
           cerevisiae YNL059c ARP5Actin- related protein; n=1;
           Yarrowia lipolytica|Rep: Similar to sp|P53946
           Saccharomyces cerevisiae YNL059c ARP5Actin- related
           protein - Yarrowia lipolytica (Candida lipolytica)
          Length = 724

 Score = 47.2 bits (107), Expect = 2e-04
 Identities = 31/122 (25%), Positives = 61/122 (50%), Gaps = 4/122 (3%)
 Frame = +2

Query: 101 AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPR-HQGVMVGMGQKDSYVGDGHKSKRGI 277
           + + +D G+ M +AG+   + P  VFP++ G+ R  +    G+    +   D        
Sbjct: 23  STIAIDFGTHMTRAGYTDTNGPNLVFPTLTGKYRERKSAGPGLAGATTVGYDNFIEPSTR 82

Query: 278 LTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPE---EHPVLLTEAPLNPKALQRRR*P 448
           L+ + P +  +V+NW   E++  +TF  +LRV  +   ++ +++ E   +P A QRR   
Sbjct: 83  LSARSPYDGALVSNWTVAEEVLDYTF-AKLRVGSDGCVDNHIIMNELMSSP-AAQRRNLQ 140

Query: 449 QI 454
           Q+
Sbjct: 141 QV 142


>UniRef50_A7TST0 Cluster: Putative uncharacterized protein; n=1;
           Vanderwaltozyma polyspora DSM 70294|Rep: Putative
           uncharacterized protein - Vanderwaltozyma polyspora DSM
           70294
          Length = 501

 Score = 46.4 bits (105), Expect = 4e-04
 Identities = 33/118 (27%), Positives = 56/118 (47%), Gaps = 13/118 (11%)
 Frame = +2

Query: 92  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGV-MVGMGQKDSYVGDGHKSK 268
           +E++A+V+D GS     G++G D P+A+ PS  G    + V   G  + +      +KSK
Sbjct: 12  DEISAVVIDPGSFTTNIGYSGTDCPQAILPSYYGEISLKEVASEGNEEIEENSASNNKSK 71

Query: 269 R--GILTLKYP---------IEHGIVTNWDDMEKIWHHTFYNELRVAPEEH-PVLLTE 406
           +  G  ++ YP         +++G V +WD  ++ W     N L +      P  LTE
Sbjct: 72  KIFGEQSINYPRADYEIKPIVKNGEVIDWDGAQEQWDWALKNALYLESNSGIPAFLTE 129


>UniRef50_Q09443 Cluster: Actin-like protein C08B11.6; n=2;
           Caenorhabditis|Rep: Actin-like protein C08B11.6 -
           Caenorhabditis elegans
          Length = 418

 Score = 45.6 bits (103), Expect = 6e-04
 Identities = 27/86 (31%), Positives = 42/86 (48%)
 Frame = +2

Query: 98  VAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHKSKRGI 277
           +  ++ DNG    K G    ++PR V  SIV + +H+   V +  +     D    K  +
Sbjct: 3   LTTIIFDNGGHNMKIGTIDSESPRLVPNSIV-KAKHEKKRVFVAHEQEECSD----KFSL 57

Query: 278 LTLKYPIEHGIVTNWDDMEKIWHHTF 355
             ++ PIE G V NWD  ++IW  TF
Sbjct: 58  FYVR-PIERGYVVNWDTQQQIWEKTF 82


>UniRef50_A7QZ13 Cluster: Chromosome undetermined scaffold_261,
           whole genome shotgun sequence; n=1; Vitis vinifera|Rep:
           Chromosome undetermined scaffold_261, whole genome
           shotgun sequence - Vitis vinifera (Grape)
          Length = 232

 Score = 44.8 bits (101), Expect = 0.001
 Identities = 35/119 (29%), Positives = 59/119 (49%), Gaps = 3/119 (2%)
 Frame = +2

Query: 92  EEVAALVVDNGSGMCKAGFA-GDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHKSK 268
           E + A+VVD GS + KAGF   D AP  + P+ +      G ++     D+ + +     
Sbjct: 44  ESMEAVVVDAGSKLLKAGFTIPDQAPSMLIPTQMKHILEDGPLI-----DNLLFED---- 94

Query: 269 RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELR--VAPEEHPVLLTEAPLNPKALQRR 439
              +T+  P+  G++ +WD ME + +H  Y  LR  +  E H +L T+    PKA + +
Sbjct: 95  ---ITVD-PVVRGLIRDWDTMEDLLNHVLYTGLRWEMGNEGH-ILFTDPLSTPKAFREQ 148


>UniRef50_Q7SXV8 Cluster: ARP5 actin-related protein 5 homolog; n=6;
           Euteleostomi|Rep: ARP5 actin-related protein 5 homolog -
           Danio rerio (Zebrafish) (Brachydanio rerio)
          Length = 592

 Score = 44.4 bits (100), Expect = 0.001
 Identities = 35/111 (31%), Positives = 56/111 (50%), Gaps = 6/111 (5%)
 Frame = +2

Query: 107 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRP---RHQGVMVGMGQKDSYVGDGHKSKRGI 277
           +VVDNGS  C+AG++   AP    P +V RP   R +G   G  Q  + + +    +   
Sbjct: 35  VVVDNGSFQCRAGWS-SGAPELDNPRLVFRPAAARSRGAARGGAQVGNDIPNPEPLR--- 90

Query: 278 LTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPE---EHPVLLTEAPLNP 421
            TLK   +   V N+D  E ++ + F + L +  +   EHP+++TE   NP
Sbjct: 91  WTLKSAFDRDTVVNFDIQELVFDYIFMH-LGINTQGRVEHPLVVTEPACNP 140


>UniRef50_Q9LZY1 Cluster: Actin-like protein; n=4; core
           eudicotyledons|Rep: Actin-like protein - Arabidopsis
           thaliana (Mouse-ear cress)
          Length = 368

 Score = 44.0 bits (99), Expect = 0.002
 Identities = 38/114 (33%), Positives = 54/114 (47%), Gaps = 2/114 (1%)
 Frame = +2

Query: 104 ALVVDNGSGMCKAGFA-GDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHKSKRGIL 280
           ALVVD GS   KAG A  D +P  + PS + R      MV  G   +   D   +    +
Sbjct: 3   ALVVDAGSKFLKAGAAIPDQSPAMIIPSQMKR------MVDDGSSSA---DNPTTVFEDV 53

Query: 281 TLKYPIEHGIVTNWDDMEKIWHHTFYNELR-VAPEEHPVLLTEAPLNPKALQRR 439
           TL  PIE G++ +WD ME +  +  Y  L      E  +L T+    PKA++ +
Sbjct: 54  TLD-PIERGLIRDWDAMEDLLRYVVYTGLGWEEGNEGNILFTDPLCTPKAIREQ 106


>UniRef50_Q6C982 Cluster: Actin-like protein ARP6; n=1; Yarrowia
           lipolytica|Rep: Actin-like protein ARP6 - Yarrowia
           lipolytica (Candida lipolytica)
          Length = 387

 Score = 44.0 bits (99), Expect = 0.002
 Identities = 34/104 (32%), Positives = 48/104 (46%), Gaps = 1/104 (0%)
 Frame = +2

Query: 107 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHKSKR-GILT 283
           +++DNGS   K+   GD    A  P+ + R R + V VG         D  K K    L 
Sbjct: 1   MILDNGSYAIKSDRTGD----AETPNALIRGRDKTVYVGQ--------DLTKCKDYASLV 48

Query: 284 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPL 415
            K P E G + NWD  + +W + FYN       +  +LLT+ PL
Sbjct: 49  FKRPSEKGQLINWDIQKAVWDNLFYNPQTGVDTDSSLLLTQYPL 92


>UniRef50_P53946 Cluster: Actin-related protein 5; n=7;
           Saccharomycetales|Rep: Actin-related protein 5 -
           Saccharomyces cerevisiae (Baker's yeast)
          Length = 755

 Score = 44.0 bits (99), Expect = 0.002
 Identities = 29/104 (27%), Positives = 55/104 (52%), Gaps = 4/104 (3%)
 Frame = +2

Query: 107 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHKSKRGILT- 283
           + +D GS   +AGF     P  +FP+ + + R +     + +  ++VG+     + + + 
Sbjct: 40  IAIDFGSSKLRAGFVNHATPTHIFPNALTKFRDR----KLNKNFTFVGNDTLLDQAVRSQ 95

Query: 284 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEE---HPVLLTE 406
            + P +   VTNW+  E+I  +TF++ L V P+    +P+LLTE
Sbjct: 96  SRSPFDGPFVTNWNLTEEILDYTFHH-LGVVPDNGIPNPILLTE 138


>UniRef50_A4S826 Cluster: Predicted protein; n=1; Ostreococcus
           lucimarinus CCE9901|Rep: Predicted protein -
           Ostreococcus lucimarinus CCE9901
          Length = 346

 Score = 43.6 bits (98), Expect = 0.003
 Identities = 21/27 (77%), Positives = 23/27 (85%), Gaps = 1/27 (3%)
 Frame = +2

Query: 83  MCDE-EVAALVVDNGSGMCKAGFAGDD 160
           M DE E++ALV DNGSGM KAGFAGDD
Sbjct: 1   MADEGELSALVCDNGSGMVKAGFAGDD 27


>UniRef50_Q6BG23 Cluster: Actin, putative; n=1; Paramecium
           tetraurelia|Rep: Actin, putative - Paramecium
           tetraurelia
          Length = 328

 Score = 43.6 bits (98), Expect = 0.003
 Identities = 19/57 (33%), Positives = 33/57 (57%)
 Frame = +2

Query: 284 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKALQRRR*PQI 454
           +KYPI +  + ++D ME +WH  F+  L   PE+  +L+T + LN    ++ +  QI
Sbjct: 21  IKYPILNSKIVDFDTMETVWHKAFFEYLMTNPEDSSILIT-SQLNTSKNEKEKTTQI 76


>UniRef50_Q5KLG9 Cluster: 53 kDa brg1-associated factor b
           (Actin-related protein baf53b), putative; n=1;
           Filobasidiella neoformans|Rep: 53 kDa brg1-associated
           factor b (Actin-related protein baf53b), putative -
           Cryptococcus neoformans (Filobasidiella neoformans)
          Length = 476

 Score = 43.6 bits (98), Expect = 0.003
 Identities = 26/74 (35%), Positives = 38/74 (51%), Gaps = 2/74 (2%)
 Frame = +2

Query: 92  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHKSKR 271
           +EV+ALV+D GS   +AG+AG+D PR V PS  G           G   + VG+   +K 
Sbjct: 6   DEVSALVLDFGSYTTRAGYAGEDCPRVVCPSFYGYTNDPS---SSGSNGNSVGENGANKE 62

Query: 272 G--ILTLKYPIEHG 307
               +T+  P+  G
Sbjct: 63  NGEDVTMAEPVPEG 76



 Score = 41.5 bits (93), Expect = 0.010
 Identities = 27/73 (36%), Positives = 39/73 (53%), Gaps = 2/73 (2%)
 Frame = +2

Query: 221 GMGQKDSYVG-DGHKSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVL 397
           G G+K  YVG DG    R  + +   +  G+V + +    + HH  +  L V PEEHP++
Sbjct: 85  GSGRK-YYVGEDGVSVWRPGMEVGNFMLDGVVNDPEPASALLHHILHERLGVNPEEHPIM 143

Query: 398 LTEAPLN-PKALQ 433
           +TE   N PKA Q
Sbjct: 144 ITEPAWNTPKARQ 156


>UniRef50_A6RD01 Cluster: Putative uncharacterized protein; n=1;
           Ajellomyces capsulatus NAm1|Rep: Putative
           uncharacterized protein - Ajellomyces capsulatus NAm1
          Length = 762

 Score = 43.6 bits (98), Expect = 0.003
 Identities = 31/111 (27%), Positives = 53/111 (47%), Gaps = 5/111 (4%)
 Frame = +2

Query: 101 AALVVDNGSGMCKAGFAGDDAPRAVFPSIVG--RPRHQGVMVGMGQKDSYVGDGHKSKRG 274
           +A+V+DNGS + KAG++ D +PR + P ++   R R           D+YV     + RG
Sbjct: 111 SAIVIDNGSYLVKAGWSFDKSPRFIIPPVMAKYRDRKFNRTCHFVGYDAYV---DATTRG 167

Query: 275 ILTLKYPIEHGIVTNWDDMEKIWHHTFYN---ELRVAPEEHPVLLTEAPLN 418
            +   +     ++ NWD ME +  + F     +      + P++LTE   N
Sbjct: 168 QVRNAFDPGSSVIGNWDVMEGVLDYIFLKLGVDGANGSVDRPIVLTEPIAN 218


>UniRef50_A5E5Q2 Cluster: Putative uncharacterized protein; n=1;
           Lodderomyces elongisporus NRRL YB-4239|Rep: Putative
           uncharacterized protein - Lodderomyces elongisporus
           (Yeast) (Saccharomyces elongisporus)
          Length = 541

 Score = 43.2 bits (97), Expect = 0.003
 Identities = 27/106 (25%), Positives = 57/106 (53%), Gaps = 1/106 (0%)
 Frame = +2

Query: 92  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHKSKR 271
           +E+ A+++D G+   + G+AGDD P+ +  S  G+   QG  V  G+    +  G  +  
Sbjct: 13  DEINAIILDIGTHTTRIGYAGDDFPKIITTSNYGK-TSQGTKV-YGENIDVLRSGGTTVH 70

Query: 272 GILTLKYPIEHGIVTNWD-DMEKIWHHTFYNELRVAPEEHPVLLTE 406
            I+T      + ++T+WD  M++  +  ++  L++   + P+++TE
Sbjct: 71  PIVT------NSLITDWDAAMDQFAY--YFKLLKIEQNDQPIMITE 108


>UniRef50_Q10CH7 Cluster: Actin-related protein 7, putative,
           expressed; n=5; Oryza sativa|Rep: Actin-related protein
           7, putative, expressed - Oryza sativa subsp. japonica
           (Rice)
          Length = 398

 Score = 42.7 bits (96), Expect = 0.004
 Identities = 33/111 (29%), Positives = 52/111 (46%), Gaps = 2/111 (1%)
 Frame = +2

Query: 104 ALVVDNGSGMCKAGFA-GDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHKSKRGIL 280
           A+VVD GS + KAG A  D +P  V PS           + +  +D  +GDG   +  + 
Sbjct: 3   AVVVDAGSKLLKAGIALPDQSPSLVMPS----------KMKLEVEDGQMGDGAVVEEVV- 51

Query: 281 TLKYPIEHGIVTNWDDMEKIWHHTFYNELR-VAPEEHPVLLTEAPLNPKAL 430
               P+  G V +WD ME + ++  Y+ +     +E  +L TE    PK +
Sbjct: 52  ---QPVVRGFVKDWDAMEDLLNYVLYSNIGWEIGDEGQILFTEPLFTPKVI 99


>UniRef50_P45890 Cluster: Actin-like protein 13E; n=8;
           Eumetazoa|Rep: Actin-like protein 13E - Drosophila
           melanogaster (Fruit fly)
          Length = 398

 Score = 42.3 bits (95), Expect = 0.006
 Identities = 27/114 (23%), Positives = 55/114 (48%), Gaps = 3/114 (2%)
 Frame = +2

Query: 101 AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHKSKRGIL 280
           A +V+DNG+   K G A  D P  V P+ + + + +       ++ ++VG+     R   
Sbjct: 4   AVVVLDNGAHTAKVGLANQDEPHVV-PNCIMKAKSE-------RRRAFVGNQIDECRDTS 55

Query: 281 TLKY--PIEHGIVTNWDDMEKIWHHTFYNE-LRVAPEEHPVLLTEAPLNPKALQ 433
            L Y    + G + NW   + +W + F  + +  + E   +++TE  +N +++Q
Sbjct: 56  ALYYILAFQRGYLLNWHTQKTVWDYIFSKDGIGCSLENRNIVITEPQMNFQSIQ 109


>UniRef50_Q293V2 Cluster: Actin-related protein 5; n=2; Drosophila
           pseudoobscura|Rep: Actin-related protein 5 - Drosophila
           pseudoobscura (Fruit fly)
          Length = 651

 Score = 42.3 bits (95), Expect = 0.006
 Identities = 34/123 (27%), Positives = 58/123 (47%), Gaps = 18/123 (14%)
 Frame = +2

Query: 107 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQ-----------GVMVGMGQK---DSY 244
           LV+DNGS  C+ G+     P   F +++ +PR             G    +  +   +  
Sbjct: 8   LVIDNGSYECRVGWNNTKEPALRFRNVLTKPRKDRKKEAIPDTTDGAPTPVAAEVPAEIQ 67

Query: 245 VGDGHKSKRGILT-LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEE---HPVLLTEAP 412
           VG+   +   +   LK P E  I+TNW+  E+I+ + F  ++    E+   +P++LTEA 
Sbjct: 68  VGNDITNIEAVRAHLKSPFERNIITNWNHQEQIFDYIF-TKMGFEGEQSIANPIVLTEAL 126

Query: 413 LNP 421
            NP
Sbjct: 127 ANP 129


>UniRef50_Q4P303 Cluster: Putative uncharacterized protein; n=1;
           Ustilago maydis|Rep: Putative uncharacterized protein -
           Ustilago maydis (Smut fungus)
          Length = 1173

 Score = 41.9 bits (94), Expect = 0.008
 Identities = 31/117 (26%), Positives = 55/117 (47%), Gaps = 12/117 (10%)
 Frame = +2

Query: 107 LVVDNGSGMCKAGFAGDDA---------PRAVFPSIVG--RPRHQGVMVGMGQKDSYVGD 253
           +++DNGS   +AGFA   A         P   + +++   R R +   + +   D Y   
Sbjct: 424 IIIDNGSSELRAGFALSHAADPTSFSQQPFVAYDNLISKVRDRKKSFTMLLVGNDVYADG 483

Query: 254 GHKSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYN-ELRVAPEEHPVLLTEAPLNP 421
             +S     +++ P +  +VT+WD ME +  +TF N  +     +HP+ +TE   NP
Sbjct: 484 LSRS-----SIRSPFDTDVVTSWDAMEIVLDYTFSNLGIDTDRVQHPICMTETLCNP 535


>UniRef50_Q7M3Y5 Cluster: Actin; n=1; Aplysia californica|Rep: Actin
           - Aplysia californica (California sea hare)
          Length = 92

 Score = 41.5 bits (93), Expect = 0.010
 Identities = 19/20 (95%), Positives = 19/20 (95%)
 Frame = +2

Query: 98  VAALVVDNGSGMCKAGFAGD 157
           VAALVVDNGSGM KAGFAGD
Sbjct: 1   VAALVVDNGSGMXKAGFAGD 20



 Score = 41.1 bits (92), Expect = 0.014
 Identities = 18/21 (85%), Positives = 19/21 (90%)
 Frame = +2

Query: 353 FYNELRVAPEEHPVLLTEAPL 415
           F  +LRVAPEEHPVLLTEAPL
Sbjct: 17  FAGDLRVAPEEHPVLLTEAPL 37


>UniRef50_Q6BML9 Cluster: Actin-like protein ARP6; n=3;
           Saccharomycetaceae|Rep: Actin-like protein ARP6 -
           Debaryomyces hansenii (Yeast) (Torulaspora hansenii)
          Length = 409

 Score = 41.1 bits (92), Expect = 0.014
 Identities = 26/85 (30%), Positives = 43/85 (50%), Gaps = 3/85 (3%)
 Frame = +2

Query: 110 VVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVG---MGQKDSYVGDGHKSKRGIL 280
           V+DNGS   KAGF+  DAP     + + + R   + VG   + Q ++Y G         +
Sbjct: 7   VIDNGSYNIKAGFSNQDAP-IKHQNALSKARDGLIYVGNEYLVQTNNYSG---------M 56

Query: 281 TLKYPIEHGIVTNWDDMEKIWHHTF 355
             K P +HG + +W+  + +W +TF
Sbjct: 57  IFKRPYDHGHLISWETEKAVWDYTF 81


>UniRef50_Q4P2E8 Cluster: Actin-related protein 4; n=1; Ustilago
           maydis|Rep: Actin-related protein 4 - Ustilago maydis
           (Smut fungus)
          Length = 534

 Score = 41.1 bits (92), Expect = 0.014
 Identities = 17/34 (50%), Positives = 23/34 (67%)
 Frame = +2

Query: 92  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVG 193
           +E+ ALV+D G    + G+AG+DAPR V PS  G
Sbjct: 8   DEINALVIDAGHSSSRVGWAGEDAPRVVLPSYYG 41


>UniRef50_A7AS14 Cluster: Actin, putative; n=1; Babesia bovis|Rep:
           Actin, putative - Babesia bovis
          Length = 382

 Score = 40.7 bits (91), Expect = 0.018
 Identities = 27/104 (25%), Positives = 50/104 (48%)
 Frame = +2

Query: 104 ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHKSKRGILT 283
           ++++D GS   KAG +    P    PSI G  R +     MG  + Y G+  + +   ++
Sbjct: 6   SVIIDTGSLYLKAGLSDQAEPLLHCPSIYGDVRRR-FQKEMG-NERYYGNECQQRMSYMS 63

Query: 284 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPL 415
               ++HG + ++D    +W + F + + V P+   VL+ E  L
Sbjct: 64  TTNVVDHGHIFDYDIAAGLWKYAF-DTMDVEPKGASVLMIEPVL 106


>UniRef50_Q6FMT7 Cluster: Similar to sp|Q12406 Saccharomyces
           cerevisiae YPR034w ARP7 Actin-like protein; n=1; Candida
           glabrata|Rep: Similar to sp|Q12406 Saccharomyces
           cerevisiae YPR034w ARP7 Actin-like protein - Candida
           glabrata (Yeast) (Torulopsis glabrata)
          Length = 529

 Score = 40.7 bits (91), Expect = 0.018
 Identities = 33/126 (26%), Positives = 54/126 (42%), Gaps = 15/126 (11%)
 Frame = +2

Query: 107 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRP-RHQGVMVGMGQKDS----YV-------- 247
           +V+  GS    AGF   D P+   PS   R  R   V +  G++D     YV        
Sbjct: 8   VVISTGSHRTVAGFNNVDLPQCTIPSSYVRVLRDDDVSMDDGEEDESRYEYVFGLFDMMD 67

Query: 248 --GDGHKSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNP 421
                   K G        +HGI  NW  +E+++ + +  EL+V P E P+++T   +  
Sbjct: 68  EAAFDVNGKGGREVFTIVDDHGIPYNWKALERLYRYIYEKELKVDPSELPLVITLPSMTN 127

Query: 422 KALQRR 439
           + L+ +
Sbjct: 128 RELETK 133


>UniRef50_Q0IFH2 Cluster: Actin; n=4; Endopterygota|Rep: Actin -
           Aedes aegypti (Yellowfever mosquito)
          Length = 400

 Score = 40.3 bits (90), Expect = 0.024
 Identities = 31/120 (25%), Positives = 57/120 (47%), Gaps = 3/120 (2%)
 Frame = +2

Query: 83  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHK 262
           M D +V   ++DNG+   K G +  DAP+ V   I      +        +  ++G+  +
Sbjct: 1   MSDGDV--FILDNGAFYAKLGMSDWDAPKTVLNCITKAKSER--------RRPFIGNQIE 50

Query: 263 SKRGILTLKYPI--EHGIVTNWDDMEKIWHHTFYNE-LRVAPEEHPVLLTEAPLNPKALQ 433
             R +  L Y +  + G + NWD  + +W + F ++   V   E P+L+TE   N +++Q
Sbjct: 51  ECRDVSGLFYILCFQRGYLVNWDIQKTVWDYMFSSDCCPVNFSETPLLITEPLFNFQSIQ 110


>UniRef50_Q0H7S7 Cluster: Actin; n=29; Sordariomycetes|Rep: Actin -
           Phaeoacremonium sphinctrophorum
          Length = 39

 Score = 39.5 bits (88), Expect = 0.042
 Identities = 16/19 (84%), Positives = 18/19 (94%)
 Frame = +2

Query: 131 MCKAGFAGDDAPRAVFPSI 187
           MCKAGFAGDDAPRAVF ++
Sbjct: 1   MCKAGFAGDDAPRAVFRNL 19


>UniRef50_UPI00006CC3F4 Cluster: Actin family protein; n=1;
           Tetrahymena thermophila SB210|Rep: Actin family protein
           - Tetrahymena thermophila SB210
          Length = 725

 Score = 39.1 bits (87), Expect = 0.055
 Identities = 25/108 (23%), Positives = 49/108 (45%), Gaps = 2/108 (1%)
 Frame = +2

Query: 107 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHKSKRGILTL 286
           +++D GSG+ KAG+     P     S++ + +     +      S + D    K      
Sbjct: 47  ILIDYGSGITKAGWGNSTKPDLSVQSLLSKSKDSKTSITQALTSSKIKDVDLFKG---NY 103

Query: 287 KYPIEHGIVTNWDDMEKIWHHTFYNELRVAPE--EHPVLLTEAPLNPK 424
           + P E  I+  +  +E + +   +NE+ V     +HP+++TE   NP+
Sbjct: 104 RSPYERNIIQQFGLLENL-NDFIFNEIGVVESKVDHPLIITEPVANPE 150


>UniRef50_Q3M0X0 Cluster: Actin6-2; n=3; Paramecium tetraurelia|Rep:
           Actin6-2 - Paramecium tetraurelia
          Length = 394

 Score = 39.1 bits (87), Expect = 0.055
 Identities = 26/103 (25%), Positives = 48/103 (46%), Gaps = 5/103 (4%)
 Frame = +2

Query: 107 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYV-GDG----HKSKR 271
           +V+DNG+   K G +G+D PR ++ +  G    Q        K   + G       K K+
Sbjct: 11  VVIDNGTDTIKVGISGEDYPRLIYDNKCGSHSVQNDNDNPNNKPQLLFGQDLKKVVKEKK 70

Query: 272 GILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLL 400
             + L  PI+ G + N + M++ W +   + L+++  +   LL
Sbjct: 71  LNVQLSNPIKDGKIDNVESMKEFWQYILEDGLQISELQQVNLL 113


>UniRef50_Q75BT7 Cluster: ACR184Cp; n=1; Eremothecium gossypii|Rep:
           ACR184Cp - Ashbya gossypii (Yeast) (Eremothecium
           gossypii)
          Length = 401

 Score = 39.1 bits (87), Expect = 0.055
 Identities = 29/103 (28%), Positives = 46/103 (44%)
 Frame = +2

Query: 104 ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHKSKRGILT 283
           A+V+  G     AGF+  D P+ + PS    P     + G+ +           +  I T
Sbjct: 6   AVVLHFGKHSTVAGFSNRDLPQCMLPSAYLMPDGGEPVYGLYELMQ------AKEHDIYT 59

Query: 284 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAP 412
           L      G+ T+W+ +E+     +  +LRV PEE PV +T  P
Sbjct: 60  LFD--NRGVPTDWEMLERFCRWIYATQLRVGPEELPVCITVPP 100


>UniRef50_Q9NZ32 Cluster: Actin-related protein 10; n=40;
           Eumetazoa|Rep: Actin-related protein 10 - Homo sapiens
           (Human)
          Length = 417

 Score = 38.7 bits (86), Expect = 0.073
 Identities = 15/34 (44%), Positives = 21/34 (61%)
 Frame = +2

Query: 95  EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGR 196
           E  A+V+D G    K GFAG+  PR + PS++ R
Sbjct: 12  EKTAVVIDLGEAFTKCGFAGETGPRCIIPSVIKR 45


>UniRef50_A3M088 Cluster: Vacuolar targeting, actin-related protein;
           n=5; Saccharomycetales|Rep: Vacuolar targeting,
           actin-related protein - Pichia stipitis (Yeast)
          Length = 775

 Score = 38.3 bits (85), Expect = 0.096
 Identities = 32/117 (27%), Positives = 55/117 (47%), Gaps = 6/117 (5%)
 Frame = +2

Query: 107 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVM--VGMGQKDSYVGDGHKSKRGIL 280
           + +D G    K G      P  +FPS+  R R +  +  + +  KD Y     +S     
Sbjct: 43  IALDIGCSSFKIGLTNSPEPHNIFPSVAARYRDRKALKTLTLAGKDVYRDSLVRS----- 97

Query: 281 TLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPE----EHPVLLTEAPLNPKALQRR 439
           ++K P +  +VTNWD ME +  ++  + L V  +     +P++LTE P+     QR+
Sbjct: 98  SIKTPFDGPLVTNWDYMEVLLDYSLAH-LGVVGDNGRLNNPLILTE-PVGVPFSQRK 152


>UniRef50_A3FQE6 Cluster: Putative uncharacterized protein; n=2;
           Cryptosporidium|Rep: Putative uncharacterized protein -
           Cryptosporidium parvum Iowa II
          Length = 396

 Score = 37.9 bits (84), Expect = 0.13
 Identities = 17/71 (23%), Positives = 40/71 (56%), Gaps = 1/71 (1%)
 Frame = +2

Query: 101 AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHK-SKRGI 277
           +++++D G+   +AG+ GDD PR+V P+ +G P  +  ++   +  + +       KR  
Sbjct: 15  SSIILDIGTQSIRAGYGGDDLPRSVVPTCIGIPNKEVDLIDSNRLCNTIFPLKPWEKRDY 74

Query: 278 LTLKYPIEHGI 310
           + + +P+++ I
Sbjct: 75  IEVLHPLQYNI 85


>UniRef50_Q9H9F9 Cluster: Actin-related protein 5; n=19;
           Euteleostomi|Rep: Actin-related protein 5 - Homo sapiens
           (Human)
          Length = 607

 Score = 37.5 bits (83), Expect = 0.17
 Identities = 35/114 (30%), Positives = 55/114 (48%), Gaps = 9/114 (7%)
 Frame = +2

Query: 107 LVVDNGSGMCKAGFA--GDDA---PRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHKSKR 271
           LV+DNGS   +AG+A  G D    PR  F ++  R R        G     VG+   S  
Sbjct: 33  LVLDNGSFQVRAGWACPGQDPGPEPRLQFRAVCARGRGGA----RGASGPQVGNALGSLE 88

Query: 272 GIL-TLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPE---EHPVLLTEAPLNP 421
            +   L+ P +  +  N +  E +  ++F + L V+ +   +HP++LTEA  NP
Sbjct: 89  PLRWMLRSPFDRNVPVNLELQELLLDYSFQH-LGVSSQGCVDHPIVLTEAVCNP 141


>UniRef50_Q19R70 Cluster: Actin-like protein 3; n=4; Leishmania|Rep:
           Actin-like protein 3 - Leishmania major
          Length = 519

 Score = 37.1 bits (82), Expect = 0.22
 Identities = 28/98 (28%), Positives = 43/98 (43%), Gaps = 11/98 (11%)
 Frame = +2

Query: 107 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQG----VMVGMGQKDSY------VGDG 256
           L++D GS   K+G      P    P++VG P++      V     Q  S       VG  
Sbjct: 29  LILDLGSRTIKSGLHTATTPHLT-PALVGTPKYPRCLPQVSSSFNQSSSISTSCFVVGSD 87

Query: 257 HKSKRGILTLKYPIEH-GIVTNWDDMEKIWHHTFYNEL 367
             S+RG+L L  PI+H G++ +W     +   +  N L
Sbjct: 88  AASRRGVLRLSRPIQHGGVIMDWVGTRPLLRQSIQNAL 125


>UniRef50_A7AQU0 Cluster: Actin-related, putative; n=1; Babesia
           bovis|Rep: Actin-related, putative - Babesia bovis
          Length = 508

 Score = 37.1 bits (82), Expect = 0.22
 Identities = 17/50 (34%), Positives = 24/50 (48%)
 Frame = +2

Query: 110 VVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGH 259
           VVDNGSG+ K   A    P  V P+ +G P+ +     +    +  GD H
Sbjct: 13  VVDNGSGLLKFSLASSVKPPFVLPNCIGHPKRKFTSQNLADGSASGGDDH 62


>UniRef50_Q4UGT7 Cluster: Actin-related protein, putative; n=2;
           Theileria|Rep: Actin-related protein, putative -
           Theileria annulata
          Length = 575

 Score = 36.7 bits (81), Expect = 0.29
 Identities = 15/32 (46%), Positives = 22/32 (68%)
 Frame = +2

Query: 107 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPR 202
           +V++NGSG  K G AG+  P  V P+ VG+P+
Sbjct: 12  VVLENGSGYVKIGMAGNKKPPHVIPNCVGQPK 43


>UniRef50_Q22XS7 Cluster: Actin family protein; n=1; Tetrahymena
           thermophila SB210|Rep: Actin family protein -
           Tetrahymena thermophila SB210
          Length = 725

 Score = 36.3 bits (80), Expect = 0.39
 Identities = 20/79 (25%), Positives = 41/79 (51%)
 Frame = +2

Query: 107 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHKSKRGILTL 286
           L+VDNGS   + G A ++ P   + +++G  R  G ++     ++Y+ + +     ++ +
Sbjct: 12  LIVDNGSWEIRLGSALNEVPNLTYYNLLGIDRKNGNLLCGENLNNYIDEAN-----LIYV 66

Query: 287 KYPIEHGIVTNWDDMEKIW 343
           K P   G+V +WD    +W
Sbjct: 67  K-PQVRGVVVDWDHEVHLW 84


>UniRef50_Q19R52 Cluster: ALP5; n=6; Trypanosomatidae|Rep: ALP5 -
           Trypanosoma cruzi strain CL Brener
          Length = 422

 Score = 36.3 bits (80), Expect = 0.39
 Identities = 39/121 (32%), Positives = 64/121 (52%), Gaps = 4/121 (3%)
 Frame = +2

Query: 104 ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVG-DGHKSKRGIL 280
           A +VD GS   + GFAGDD PR   P+         V+ G G++ S +      + R   
Sbjct: 27  AAIVDIGSYTTRIGFAGDDKPRVDEPTC--------VVKGTGKESSSLCLKKAYNCRATT 78

Query: 281 TLKYPIEHGIVTNWDDMEKIWHHTFYNE-LRVAPEE--HPVLLTEAPLNPKALQRRR*PQ 451
            +   IE G V +W+ ME++   ++ +E L+++ +E   P+LLTE  L P+  QR++  +
Sbjct: 79  EVSRVIEKGEV-DWEAMEQLL--SYLDELLQLSSKEVQTPLLLTEKMLVPRT-QRQKLAE 134

Query: 452 I 454
           I
Sbjct: 135 I 135


>UniRef50_UPI0000E46266 Cluster: PREDICTED: similar to actin; n=1;
           Strongylocentrotus purpuratus|Rep: PREDICTED: similar to
           actin - Strongylocentrotus purpuratus
          Length = 341

 Score = 35.9 bits (79), Expect = 0.51
 Identities = 12/34 (35%), Positives = 21/34 (61%)
 Frame = +2

Query: 311 VTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAP 412
           VT+WD  E+I  H  + + ++   +HP++L E P
Sbjct: 61  VTDWDSFEQIIQHAIWTKSKIKSSDHPLVLIEKP 94


>UniRef50_Q5AP59 Cluster: Actin-like protein ARP6; n=2;
           Saccharomycetales|Rep: Actin-like protein ARP6 - Candida
           albicans (Yeast)
          Length = 446

 Score = 35.9 bits (79), Expect = 0.51
 Identities = 28/98 (28%), Positives = 45/98 (45%), Gaps = 6/98 (6%)
 Frame = +2

Query: 92  EEVAALVVDNGSGMCKAGF-AGDDAPRAVFPSI-----VGRPRHQGVMVGMGQKDSYVGD 253
           E++  LV+DNGS   KAGF  GDD        I     + + +   + VG    + Y+  
Sbjct: 3   EQLQKLVIDNGSYTIKAGFNTGDDDGNDTSTPIKVTNAISKTKDGIIHVG----NQYL-- 56

Query: 254 GHKSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNEL 367
            H +    +  + P E   +T+W+  + IW +T  N L
Sbjct: 57  SHTNNFSGIQFRRPFEQNNLTSWETEKPIWDYTLDNLL 94


>UniRef50_Q8I450 Cluster: Actin-related protein, putative; n=5;
           Plasmodium|Rep: Actin-related protein, putative -
           Plasmodium falciparum (isolate 3D7)
          Length = 565

 Score = 34.7 bits (76), Expect = 1.2
 Identities = 15/35 (42%), Positives = 22/35 (62%)
 Frame = +2

Query: 95  EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRP 199
           ++ ++V+D G    K G+AGD+ P  VF S VG P
Sbjct: 6   DILSIVIDLGFENTKVGYAGDENPTNVFSSNVGMP 40


>UniRef50_Q7RR61 Cluster: Actin-like 6; n=3; Plasmodium
           (Vinckeia)|Rep: Actin-like 6 - Plasmodium yoelii yoelii
          Length = 538

 Score = 34.3 bits (75), Expect = 1.6
 Identities = 14/35 (40%), Positives = 24/35 (68%)
 Frame = +2

Query: 95  EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRP 199
           +V+++V+D G    K G++GD+ P+ +F S VG P
Sbjct: 6   DVSSIVIDLGFENIKLGYSGDENPKNIFSSNVGVP 40


>UniRef50_Q9GZN1 Cluster: Actin-related protein 6; n=26;
           Chordata|Rep: Actin-related protein 6 - Homo sapiens
           (Human)
          Length = 396

 Score = 34.3 bits (75), Expect = 1.6
 Identities = 25/113 (22%), Positives = 53/113 (46%), Gaps = 1/113 (0%)
 Frame = +2

Query: 98  VAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHKSKRGI 277
           +  LV+DNG+   K G++ ++   +V P+   R +   +      +   +    K   G+
Sbjct: 1   MTTLVLDNGAYNAKIGYSHENV--SVIPNCQFRSKTARLKTFTANQIDEI----KDPSGL 54

Query: 278 LTLKYPIEHGIVTNWDDMEKIWHHTFYNEL-RVAPEEHPVLLTEAPLNPKALQ 433
             +  P + G + NWD   ++W + F  E+ +V   +  +++TE   N  ++Q
Sbjct: 55  FYI-LPFQKGYLVNWDVQRQVWDYLFGKEMYQVDFLDTNIIITEPYFNFTSIQ 106


>UniRef50_Q7QV72 Cluster: GLP_438_30160_28841; n=1; Giardia lamblia
           ATCC 50803|Rep: GLP_438_30160_28841 - Giardia lamblia
           ATCC 50803
          Length = 439

 Score = 33.9 bits (74), Expect = 2.1
 Identities = 16/53 (30%), Positives = 28/53 (52%), Gaps = 5/53 (9%)
 Frame = -3

Query: 245 HKSPSVPYRPSRPDGGAFPRSRETLREEHHLLRSRP-----CTYRSHCLLPTR 102
           +K+  VPY+    DG  + +++E  RE HH+    P     CT  + C++ T+
Sbjct: 137 NKAKEVPYKLLDTDGMGYSKAQELFREHHHMKYDSPITKVTCTELAKCVMCTK 189


>UniRef50_A2DVJ3 Cluster: Actin family protein; n=1; Trichomonas
           vaginalis G3|Rep: Actin family protein - Trichomonas
           vaginalis G3
          Length = 394

 Score = 33.9 bits (74), Expect = 2.1
 Identities = 26/90 (28%), Positives = 42/90 (46%), Gaps = 2/90 (2%)
 Frame = +2

Query: 89  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHKSK 268
           D    ALV D GS M +AGFAG   P     S++      G++   G K+  +GD +   
Sbjct: 5   DNTYHALVYDLGSAMFRAGFAGSAYPEI---SVIS----AGMVKEEGSKEFLIGDDNILS 57

Query: 269 RGILTLKYPI--EHGIVTNWDDMEKIWHHT 352
           + +     P+  E G+++N D +     +T
Sbjct: 58  KRLHNEIIPLVDESGLISNPDILSSFLQYT 87


>UniRef50_UPI0000E477BD Cluster: PREDICTED: similar to
           uncharacterized hypothalamus protein HARP11; n=1;
           Strongylocentrotus purpuratus|Rep: PREDICTED: similar to
           uncharacterized hypothalamus protein HARP11 -
           Strongylocentrotus purpuratus
          Length = 481

 Score = 33.5 bits (73), Expect = 2.7
 Identities = 15/30 (50%), Positives = 18/30 (60%)
 Frame = +2

Query: 95  EVAALVVDNGSGMCKAGFAGDDAPRAVFPS 184
           E  A V D G+   K GFAG+ +PRA  PS
Sbjct: 12  EKTAAVFDIGAAYTKVGFAGETSPRATIPS 41


>UniRef50_A5KAY0 Cluster: Actin-related protein, putative; n=1;
           Plasmodium vivax|Rep: Actin-related protein, putative -
           Plasmodium vivax
          Length = 600

 Score = 33.5 bits (73), Expect = 2.7
 Identities = 15/35 (42%), Positives = 22/35 (62%)
 Frame = +2

Query: 95  EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRP 199
           ++ ++VVD G    K G+AGD+ P  +F S VG P
Sbjct: 6   DILSIVVDLGFENTKIGYAGDENPTNIFSSNVGVP 40


>UniRef50_UPI000065E8AF Cluster: bromo adjacent homology domain
           containing 1; n=1; Takifugu rubripes|Rep: bromo adjacent
           homology domain containing 1 - Takifugu rubripes
          Length = 798

 Score = 33.1 bits (72), Expect = 3.6
 Identities = 17/62 (27%), Positives = 31/62 (50%)
 Frame = -2

Query: 273 PLLLLCPSPT*ESFCPIPTITP*WRGLPTIEGNTARGASSPAKPALHIPEPLSTTNAATS 94
           P + +CPSP   + CP+PT+ P  + +P ++  T     S  +P L + +    +  + S
Sbjct: 505 PSVPICPSPRLLTGCPVPTVPPAGQAVPRLQ--TPLSDPSQPQPPLRVAKECPQSAKSPS 562

Query: 93  SS 88
            S
Sbjct: 563 GS 564


>UniRef50_Q8SRZ3 Cluster: ACTIN-RELATED PROTEIN; n=1;
           Encephalitozoon cuniculi|Rep: ACTIN-RELATED PROTEIN -
           Encephalitozoon cuniculi
          Length = 555

 Score = 33.1 bits (72), Expect = 3.6
 Identities = 13/32 (40%), Positives = 24/32 (75%)
 Frame = +2

Query: 107 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPR 202
           +V+DNG+  CKAG+ G ++P+ VF +++ R +
Sbjct: 23  IVIDNGTYECKAGYCG-ESPQMVFKNVLYRQK 53


>UniRef50_Q7S2J0 Cluster: Predicted protein; n=1; Neurospora
           crassa|Rep: Predicted protein - Neurospora crassa
          Length = 331

 Score = 33.1 bits (72), Expect = 3.6
 Identities = 12/28 (42%), Positives = 18/28 (64%)
 Frame = +1

Query: 226 GTEGLLCRRWAQEQKRYPDPQIPHRTRN 309
           G +GL   RWA++++  P PQ P  T+N
Sbjct: 192 GAKGLASSRWAKKEEEDPKPQFPEPTKN 219


>UniRef50_UPI0000E254E7 Cluster: PREDICTED: similar to putative cell
           wall protein FLO11p, partial; n=1; Pan troglodytes|Rep:
           PREDICTED: similar to putative cell wall protein FLO11p,
           partial - Pan troglodytes
          Length = 295

 Score = 32.7 bits (71), Expect = 4.8
 Identities = 15/31 (48%), Positives = 18/31 (58%)
 Frame = -3

Query: 248 LHKSPSVPYRPSRPDGGAFPRSRETLREEHH 156
           LH++PS P  PS PD  + PRS  T   E H
Sbjct: 45  LHRTPSHPRSPSTPDTESHPRSPSTPDTESH 75


>UniRef50_A7DFE1 Cluster: Prophage LambdaW4, terminase large
           subunit, putative; n=2; Methylobacterium extorquens
           PA1|Rep: Prophage LambdaW4, terminase large subunit,
           putative - Methylobacterium extorquens PA1
          Length = 183

 Score = 32.7 bits (71), Expect = 4.8
 Identities = 16/48 (33%), Positives = 26/48 (54%)
 Frame = +2

Query: 146 FAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHKSKRGILTLK 289
           F    A R    +I G+  + G  +G+G KDS    G K +RG++T++
Sbjct: 50  FVRSQAGRGNVHAIDGQDSYSGAFLGLGNKDS-TAKGKKLRRGLMTVR 96


>UniRef50_Q8ILM5 Cluster: Actin, putative; n=1; Plasmodium
           falciparum 3D7|Rep: Actin, putative - Plasmodium
           falciparum (isolate 3D7)
          Length = 522

 Score = 32.7 bits (71), Expect = 4.8
 Identities = 22/69 (31%), Positives = 32/69 (46%)
 Frame = +2

Query: 92  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHKSKR 271
           E++++LVVD G   CK G   +D PR    SI G            + ++Y+ DG     
Sbjct: 16  EDISSLVVDLGFYSCKIGHNQEDTPRIFLNSICGEREMN------DEYENYM-DGSLKNI 68

Query: 272 GILTLKYPI 298
               LKYP+
Sbjct: 69  NYKELKYPL 77


>UniRef50_Q8AXX1 Cluster: Putative gag protein; n=1; Danio
           rerio|Rep: Putative gag protein - Danio rerio
           (Zebrafish) (Brachydanio rerio)
          Length = 612

 Score = 32.3 bits (70), Expect = 6.3
 Identities = 13/27 (48%), Positives = 18/27 (66%)
 Frame = -2

Query: 156 SPAKPALHIPEPLSTTNAATSSSHILN 76
           SP  P+ H+P P S+  +A SSSH+ N
Sbjct: 62  SPITPSRHLPSPASSYASARSSSHVSN 88


>UniRef50_Q5BXM4 Cluster: SJCHGC05761 protein; n=1; Schistosoma
           japonicum|Rep: SJCHGC05761 protein - Schistosoma
           japonicum (Blood fluke)
          Length = 246

 Score = 32.3 bits (70), Expect = 6.3
 Identities = 14/35 (40%), Positives = 20/35 (57%)
 Frame = +2

Query: 95  EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRP 199
           E  A+V D G+   K GFAG+  PR + P+ +  P
Sbjct: 33  EKTAVVFDIGTVYTKCGFAGETGPRFIIPTAITLP 67


>UniRef50_Q2PE20 Cluster: CG10067-PB, isoform B; n=1; Drosophila
           melanogaster|Rep: CG10067-PB, isoform B - Drosophila
           melanogaster (Fruit fly)
          Length = 36

 Score = 32.3 bits (70), Expect = 6.3
 Identities = 13/15 (86%), Positives = 15/15 (100%)
 Frame = +2

Query: 83  MCDEEVAALVVDNGS 127
           MCD+EVAALVVDNG+
Sbjct: 1   MCDDEVAALVVDNGA 15


>UniRef50_Q16HG2 Cluster: PAF acetylhydrolase 45 kDa subunit,
           putative; n=1; Aedes aegypti|Rep: PAF acetylhydrolase 45
           kDa subunit, putative - Aedes aegypti (Yellowfever
           mosquito)
          Length = 422

 Score = 32.3 bits (70), Expect = 6.3
 Identities = 23/83 (27%), Positives = 36/83 (43%)
 Frame = +2

Query: 182 SIVGRPRHQGVMVGMGQKDSYVGDGHKSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYN 361
           S++  PR +   V   Q+   V  GHK     L++    E  +    D+   +WH     
Sbjct: 244 SLLSPPRTKEYHVDRKQQQKNVFLGHKKAVTCLSVSIDGETLLSGGADENVFLWHTKSRQ 303

Query: 362 ELRVAPEEHPVLLTEAPLNPKAL 430
           +LRV P +  V   +  L PKA+
Sbjct: 304 QLRVIPHKGIVTNAQFMLTPKAM 326


>UniRef50_Q0W6D4 Cluster: Putative uncharacterized protein; n=1;
           uncultured methanogenic archaeon RC-I|Rep: Putative
           uncharacterized protein - Uncultured methanogenic
           archaeon RC-I
          Length = 427

 Score = 32.3 bits (70), Expect = 6.3
 Identities = 16/45 (35%), Positives = 20/45 (44%)
 Frame = -2

Query: 228 PIPTITP*WRGLPTIEGNTARGASSPAKPALHIPEPLSTTNAATS 94
           P PT+TP     PT+E        +P       P P+ TT A TS
Sbjct: 353 PTPTVTPTPTPEPTVEATPVPATPTPTVEPTVAPSPVPTTTAQTS 397


>UniRef50_Q9C073 Cluster: Protein FAM117A; n=17; Amniota|Rep:
           Protein FAM117A - Homo sapiens (Human)
          Length = 453

 Score = 32.3 bits (70), Expect = 6.3
 Identities = 17/54 (31%), Positives = 25/54 (46%)
 Frame = -2

Query: 252 SPT*ESFCPIPTITP*WRGLPTIEGNTARGASSPAKPALHIPEPLSTTNAATSS 91
           +PT  +FCP+  + P + G+  I  N      SP  PA   P P     A+ +S
Sbjct: 375 NPTGSAFCPVNLMKPLFPGMGFIFRNCPSNPGSPLPPASPRPPPRKDPEASKAS 428


>UniRef50_UPI00015B86FC Cluster: UPI00015B86FC related cluster; n=1;
           unknown|Rep: UPI00015B86FC UniRef100 entry - unknown
          Length = 122

 Score = 31.9 bits (69), Expect = 8.3
 Identities = 21/54 (38%), Positives = 25/54 (46%), Gaps = 3/54 (5%)
 Frame = +1

Query: 247 RRWAQEQKRYPDPQIP---HRTRNRH*LG*HGEDLASYLLQ*AACRPRGTPRPA 399
           R W   Q R+PDP IP    R + R  L  HG +L + L      RP   P PA
Sbjct: 69  RSWPGRQTRHPDPAIPVDGGRPQVRAPLIRHGPELRAMLSMTGMSRPPTWPPPA 122


>UniRef50_A2PZD1 Cluster: Putative uncharacterized protein EZY20;
           n=1; Chlamydomonas reinhardtii|Rep: Putative
           uncharacterized protein EZY20 - Chlamydomonas
           reinhardtii
          Length = 382

 Score = 31.9 bits (69), Expect = 8.3
 Identities = 17/32 (53%), Positives = 18/32 (56%), Gaps = 1/32 (3%)
 Frame = +3

Query: 336 RFGIIPSTMSCVSPPRNTPSCLLRLP-STPRP 428
           R G  P T SC  PPR+TPS   R P ST  P
Sbjct: 270 RTGTWPPTPSCCPPPRSTPSTSWRTPGSTSLP 301


>UniRef50_Q6V7P1 Cluster: Gp51; n=1; Burkholderia phage Bcep22|Rep:
           Gp51 - Burkholderia phage Bcep22
          Length = 322

 Score = 31.9 bits (69), Expect = 8.3
 Identities = 16/37 (43%), Positives = 21/37 (56%)
 Frame = +2

Query: 80  KMCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIV 190
           K  D++ AA   D+ +G   AG  GDD P A  P+IV
Sbjct: 67  KKSDDDAAAGKTDDAAGDDDAGKKGDDTPAAAKPTIV 103


>UniRef50_A2FYS8 Cluster: Actin family protein; n=1; Trichomonas
           vaginalis G3|Rep: Actin family protein - Trichomonas
           vaginalis G3
          Length = 306

 Score = 31.9 bits (69), Expect = 8.3
 Identities = 12/22 (54%), Positives = 17/22 (77%)
 Frame = +2

Query: 104 ALVVDNGSGMCKAGFAGDDAPR 169
           A+V+D GS  C+AGFAG + P+
Sbjct: 3   AVVIDLGSYRCRAGFAGQEVPK 24


>UniRef50_Q4P230 Cluster: Putative uncharacterized protein; n=1;
           Ustilago maydis|Rep: Putative uncharacterized protein -
           Ustilago maydis (Smut fungus)
          Length = 692

 Score = 31.9 bits (69), Expect = 8.3
 Identities = 12/27 (44%), Positives = 19/27 (70%)
 Frame = +2

Query: 107 LVVDNGSGMCKAGFAGDDAPRAVFPSI 187
           +++D GS   K GF+G+  PRA+ PS+
Sbjct: 86  IILDIGSRYSKFGFSGEPRPRAIVPSV 112


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 572,679,176
Number of Sequences: 1657284
Number of extensions: 13703637
Number of successful extensions: 43720
Number of sequences better than 10.0: 202
Number of HSP's better than 10.0 without gapping: 40373
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 43546
length of database: 575,637,011
effective HSP length: 95
effective length of database: 418,195,031
effective search space used: 29691847201
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).