SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0017
         (477 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_UPI00015B4B40 Cluster: PREDICTED: similar to phosphatid...    33   3.3  
UniRef50_UPI00015B4352 Cluster: PREDICTED: similar to eukariotic...    33   4.3  
UniRef50_P38717 Cluster: Protein SIP3; n=2; Saccharomyces cerevi...    32   7.5  
UniRef50_A6TA16 Cluster: Putative ARAC-type regulatory protein; ...    31   10.0 

>UniRef50_UPI00015B4B40 Cluster: PREDICTED: similar to
            phosphatidylinositol 3-kinase catalytic subunit alpha,
            beta, delta; n=1; Nasonia vitripennis|Rep: PREDICTED:
            similar to phosphatidylinositol 3-kinase catalytic
            subunit alpha, beta, delta - Nasonia vitripennis
          Length = 1103

 Score = 33.1 bits (72), Expect = 3.3
 Identities = 18/40 (45%), Positives = 24/40 (60%)
 Frame = -1

Query: 180  MNSTGKPELTGEKNCNNSRNST*VN*HECFHEKENRSKFD 61
            M STG PEL+ EK+ N  R++  +   E   +K  RSKFD
Sbjct: 1039 MISTGLPELSSEKDLNYLRDTLVLEMSEAEAQKHFRSKFD 1078


>UniRef50_UPI00015B4352 Cluster: PREDICTED: similar to eukariotic
           translation initiation factor 2b, epsilon subunit; n=1;
           Nasonia vitripennis|Rep: PREDICTED: similar to
           eukariotic translation initiation factor 2b, epsilon
           subunit - Nasonia vitripennis
          Length = 688

 Score = 32.7 bits (71), Expect = 4.3
 Identities = 17/49 (34%), Positives = 29/49 (59%)
 Frame = -3

Query: 355 TISKMAAVAANCLLSESAIFQRSLDPTNLTPTLSVRTHNSYFHSITLIQ 209
           T+   + V  N  L E++  QRS+  +N T  ++V+ +NSY  S +LI+
Sbjct: 329 TLHSESIVGENSTLGENSFIQRSVIGSNCTIGINVQINNSYIISNSLIK 377


>UniRef50_P38717 Cluster: Protein SIP3; n=2; Saccharomyces
           cerevisiae|Rep: Protein SIP3 - Saccharomyces cerevisiae
           (Baker's yeast)
          Length = 1229

 Score = 31.9 bits (69), Expect = 7.5
 Identities = 15/54 (27%), Positives = 29/54 (53%)
 Frame = +3

Query: 66  ISNGFLFHENIRVNLLKCCYVSCYSFSLQLTQVFQSSSFSYNTKCLDY*ISVIE 227
           +SNGF+ +++    L+       Y FS++L Q+ +    S++T  L+   + IE
Sbjct: 84  LSNGFVSNQSFTPRLIDSFNKDYYDFSMKLLQIVKGDDSSHSTALLELMTTAIE 137


>UniRef50_A6TA16 Cluster: Putative ARAC-type regulatory protein;
           n=1; Klebsiella pneumoniae subsp. pneumoniae MGH
           78578|Rep: Putative ARAC-type regulatory protein -
           Klebsiella pneumoniae subsp. pneumoniae MGH 78578
          Length = 308

 Score = 31.5 bits (68), Expect = 10.0
 Identities = 13/25 (52%), Positives = 18/25 (72%)
 Frame = -3

Query: 337 AVAANCLLSESAIFQRSLDPTNLTP 263
           A+AA+C LS S +F+R  D T +TP
Sbjct: 216 ALAADCALSRSTLFERFTDLTGMTP 240


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 434,918,080
Number of Sequences: 1657284
Number of extensions: 7852945
Number of successful extensions: 16398
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 16019
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 16397
length of database: 575,637,011
effective HSP length: 94
effective length of database: 419,852,315
effective search space used: 26870548160
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).