SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0016
         (532 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_Q7PZG2 Cluster: ENSANGP00000021271; n=3; Endopterygota|...    45   0.001
UniRef50_Q8N9Q5 Cluster: CDNA FLJ36746 fis, clone UTERU2016757; ...    41   0.016
UniRef50_Q96G75 Cluster: RMD5 homolog B; n=37; Eumetazoa|Rep: RM...    41   0.016
UniRef50_Q9W2N5 Cluster: CG3295-PA; n=3; Diptera|Rep: CG3295-PA ...    38   0.19 
UniRef50_Q245M8 Cluster: Putative uncharacterized protein; n=1; ...    37   0.33 
UniRef50_A1H814 Cluster: Putative uncharacterized protein; n=1; ...    34   1.8  
UniRef50_UPI0001560B62 Cluster: PREDICTED: similar to FLJ44048 p...    34   2.4  
UniRef50_A1YK56 Cluster: Nup107; n=22; Sophophora|Rep: Nup107 - ...    33   3.1  
UniRef50_UPI00005A5FD5 Cluster: PREDICTED: similar to FLJ44048 p...    33   4.1  
UniRef50_Q6VU67 Cluster: Laminin alpha 3 splice variant b2; n=29...    33   5.4  
UniRef50_Q16787 Cluster: Laminin subunit alpha-3 precursor; n=17...    33   5.4  
UniRef50_A0HHR1 Cluster: Periplasmic sensor signal transduction ...    32   9.5  
UniRef50_A2DA16 Cluster: Putative uncharacterized protein; n=1; ...    32   9.5  

>UniRef50_Q7PZG2 Cluster: ENSANGP00000021271; n=3;
           Endopterygota|Rep: ENSANGP00000021271 - Anopheles
           gambiae str. PEST
          Length = 420

 Score = 44.8 bits (101), Expect = 0.001
 Identities = 28/78 (35%), Positives = 40/78 (51%), Gaps = 2/78 (2%)
 Frame = +1

Query: 298 PPNTPL--TPEQAQVVSELASTIKQNAFQLSTDHRELHATVSKSGQVYR*AFRGPIMQQL 471
           PP  PL  T  Q  V++E  S  K    +L+T+HR+LH TVSK G+     F        
Sbjct: 73  PPPLPLLVTAGQVDVLNEALSKTKDKLHRLTTEHRDLHGTVSKVGKAIDRNFVADF--TA 130

Query: 472 LQRREMFCSDENHLLWNK 525
             R ++F ++ N +L NK
Sbjct: 131 TSRTDVFQTERNVMLLNK 148



 Score = 40.7 bits (91), Expect = 0.021
 Identities = 13/34 (38%), Positives = 26/34 (76%)
 Frame = +2

Query: 161 MDSCIGVEQDLDKAITKFTNLNEHTDEVLQDILT 262
           MDSC  VE++++K I KF+ +N+H+  ++ D+++
Sbjct: 1   MDSCAAVEKEVEKVINKFSAINDHSQRIIGDVIS 34


>UniRef50_Q8N9Q5 Cluster: CDNA FLJ36746 fis, clone UTERU2016757;
           n=7; Euteleostomi|Rep: CDNA FLJ36746 fis, clone
           UTERU2016757 - Homo sapiens (Human)
          Length = 217

 Score = 41.1 bits (92), Expect = 0.016
 Identities = 20/64 (31%), Positives = 39/64 (60%), Gaps = 1/64 (1%)
 Frame = +1

Query: 241 SIARYINKVEELRREIAQQP-PNTPLTPEQAQVVSELASTIKQNAFQLSTDHRELHATVS 417
           S+   ++ V +LR E+A      TPL+   + V+S+    IK    +L++DH+++H++VS
Sbjct: 28  SLEELLHYVGQLRAELASAALQGTPLSATLSLVMSQCCRKIKDTVQKLASDHKDIHSSVS 87

Query: 418 KSGQ 429
           + G+
Sbjct: 88  RVGK 91


>UniRef50_Q96G75 Cluster: RMD5 homolog B; n=37; Eumetazoa|Rep: RMD5
           homolog B - Homo sapiens (Human)
          Length = 393

 Score = 41.1 bits (92), Expect = 0.016
 Identities = 20/64 (31%), Positives = 39/64 (60%), Gaps = 1/64 (1%)
 Frame = +1

Query: 241 SIARYINKVEELRREIAQQP-PNTPLTPEQAQVVSELASTIKQNAFQLSTDHRELHATVS 417
           S+   ++ V +LR E+A      TPL+   + V+S+    IK    +L++DH+++H++VS
Sbjct: 28  SLEELLHYVGQLRAELASAALQGTPLSATLSLVMSQCCRKIKDTVQKLASDHKDIHSSVS 87

Query: 418 KSGQ 429
           + G+
Sbjct: 88  RVGK 91


>UniRef50_Q9W2N5 Cluster: CG3295-PA; n=3; Diptera|Rep: CG3295-PA -
           Drosophila melanogaster (Fruit fly)
          Length = 432

 Score = 37.5 bits (83), Expect = 0.19
 Identities = 23/79 (29%), Positives = 38/79 (48%), Gaps = 2/79 (2%)
 Frame = +1

Query: 301 PNTP--LTPEQAQVVSELASTIKQNAFQLSTDHRELHATVSKSGQVYR*AFRGPIMQQLL 474
           P  P  LT  Q + V    +   +   +LST+HR+LH ++SK G+     F       + 
Sbjct: 81  PTAPQRLTERQVESVRNALARCHERVQKLSTEHRDLHGSISKIGKAIDRNFSADFSSTM- 139

Query: 475 QRREMFCSDENHLLWNKPL 531
            R ++   +EN +L NK +
Sbjct: 140 -RVDVLQDEENLMLLNKAI 157


>UniRef50_Q245M8 Cluster: Putative uncharacterized protein; n=1;
           Tetrahymena thermophila SB210|Rep: Putative
           uncharacterized protein - Tetrahymena thermophila SB210
          Length = 1363

 Score = 36.7 bits (81), Expect = 0.33
 Identities = 25/67 (37%), Positives = 31/67 (46%), Gaps = 3/67 (4%)
 Frame = -2

Query: 291 GYFPPQLLYFVNISCNTSSVCSFKFVNFVIALSKS---CSTPIQESIVFQDSSPYSVFQK 121
           GYFPP L    N S  T +     F   V AL+ S     T  Q S +F  SS YS  +K
Sbjct: 171 GYFPPDLRCIYNFSQITGNSSLVAFSPEVFALNNSQQVTQTFCQRSFIFNSSSIYSRNEK 230

Query: 120 TTPYCIR 100
            +  C+R
Sbjct: 231 GSILCLR 237


>UniRef50_A1H814 Cluster: Putative uncharacterized protein; n=1;
           Ralstonia pickettii 12J|Rep: Putative uncharacterized
           protein - Ralstonia pickettii 12J
          Length = 207

 Score = 34.3 bits (75), Expect = 1.8
 Identities = 20/57 (35%), Positives = 29/57 (50%)
 Frame = +1

Query: 241 SIARYINKVEELRREIAQQPPNTPLTPEQAQVVSELASTIKQNAFQLSTDHRELHAT 411
           SI+ Y    E LR  +AQ     P   + AQ+V + A+  K+NA +     R+L AT
Sbjct: 82  SISYYWRNAERLRPVLAQWAKKNPERAKAAQIVWKAANFAKRNAHEAKRRARKLQAT 138


>UniRef50_UPI0001560B62 Cluster: PREDICTED: similar to FLJ44048
            protein; n=1; Equus caballus|Rep: PREDICTED: similar to
            FLJ44048 protein - Equus caballus
          Length = 2580

 Score = 33.9 bits (74), Expect = 2.4
 Identities = 15/63 (23%), Positives = 32/63 (50%)
 Frame = +1

Query: 286  IAQQPPNTPLTPEQAQVVSELASTIKQNAFQLSTDHRELHATVSKSGQVYR*AFRGPIMQ 465
            +   P    L+PE  +++S++A ++  +  Q S  H EL+  +  +  V+R      I+ 
Sbjct: 2144 VTANPEEKFLSPESIEMISQMADSVYNHVLQQSGTHEELYYNMKGANNVFRKEVASLIIS 2203

Query: 466  QLL 474
            ++L
Sbjct: 2204 KVL 2206


>UniRef50_A1YK56 Cluster: Nup107; n=22; Sophophora|Rep: Nup107 -
           Drosophila melanogaster (Fruit fly)
          Length = 846

 Score = 33.5 bits (73), Expect = 3.1
 Identities = 16/57 (28%), Positives = 32/57 (56%)
 Frame = +1

Query: 232 YR*SIARYINKVEELRREIAQQPPNTPLTPEQAQVVSELASTIKQNAFQLSTDHREL 402
           +R  + R+ +KV+E  ++  +   N  + P++  +V    + + +NA QL+ DHR L
Sbjct: 709 HRSEVVRWEHKVKEQAKQTIELLYNVLMFPDKGWLVDPFIAKLPENAVQLNWDHRLL 765


>UniRef50_UPI00005A5FD5 Cluster: PREDICTED: similar to FLJ44048
            protein; n=2; Laurasiatheria|Rep: PREDICTED: similar to
            FLJ44048 protein - Canis familiaris
          Length = 3494

 Score = 33.1 bits (72), Expect = 4.1
 Identities = 12/50 (24%), Positives = 26/50 (52%)
 Frame = +1

Query: 286  IAQQPPNTPLTPEQAQVVSELASTIKQNAFQLSTDHRELHATVSKSGQVY 435
            ++  P  T L+PE  +++S++  ++     Q S  H EL+  +  +  V+
Sbjct: 3177 VSTDPEETFLSPESIEIISQMVDSVYNQVLQQSGTHEELYYNMKGTNNVF 3226


>UniRef50_Q6VU67 Cluster: Laminin alpha 3 splice variant b2; n=29;
            cellular organisms|Rep: Laminin alpha 3 splice variant b2
            - Homo sapiens (Human)
          Length = 3277

 Score = 32.7 bits (71), Expect = 5.4
 Identities = 18/61 (29%), Positives = 30/61 (49%)
 Frame = +1

Query: 232  YR*SIARYINKVEELRREIAQQPPNTPLTPEQAQVVSELASTIKQNAFQLSTDHRELHAT 411
            YR +I+ + +K+E L RE+           E+AQV S  A T+  N  + +   +EL   
Sbjct: 1877 YRSAISNHGSKIEGLERELTDLNQEFETLQEKAQVNSRKAQTLNNNVNRATQSAKELDVK 1936

Query: 412  V 414
            +
Sbjct: 1937 I 1937


>UniRef50_Q16787 Cluster: Laminin subunit alpha-3 precursor; n=17;
           Euarchontoglires|Rep: Laminin subunit alpha-3 precursor
           - Homo sapiens (Human)
          Length = 1713

 Score = 32.7 bits (71), Expect = 5.4
 Identities = 18/61 (29%), Positives = 30/61 (49%)
 Frame = +1

Query: 232 YR*SIARYINKVEELRREIAQQPPNTPLTPEQAQVVSELASTIKQNAFQLSTDHRELHAT 411
           YR +I+ + +K+E L RE+           E+AQV S  A T+  N  + +   +EL   
Sbjct: 257 YRSAISNHGSKIEGLERELTDLNQEFETLQEKAQVNSRKAQTLNNNVNRATQSAKELDVK 316

Query: 412 V 414
           +
Sbjct: 317 I 317


>UniRef50_A0HHR1 Cluster: Periplasmic sensor signal transduction
           histidine kinase precursor; n=1; Comamonas testosteroni
           KF-1|Rep: Periplasmic sensor signal transduction
           histidine kinase precursor - Comamonas testosteroni KF-1
          Length = 594

 Score = 31.9 bits (69), Expect = 9.5
 Identities = 16/53 (30%), Positives = 27/53 (50%)
 Frame = +1

Query: 244 IARYINKVEELRREIAQQPPNTPLTPEQAQVVSELASTIKQNAFQLSTDHREL 402
           + R +  +E LR+E++Q+PP       Q + V ELA  ++     L   HR +
Sbjct: 237 VTRGLRPLESLRQELSQRPPGDDSPVAQGRQVRELAPLVQTINHLLQRVHRAI 289


>UniRef50_A2DA16 Cluster: Putative uncharacterized protein; n=1;
           Trichomonas vaginalis G3|Rep: Putative uncharacterized
           protein - Trichomonas vaginalis G3
          Length = 1079

 Score = 31.9 bits (69), Expect = 9.5
 Identities = 17/45 (37%), Positives = 27/45 (60%), Gaps = 1/45 (2%)
 Frame = +1

Query: 253 YINKVEELRREI-AQQPPNTPLTPEQAQVVSELASTIKQNAFQLS 384
           Y NK+EEL +EI   Q  N  +  E+ Q+++ELA    Q+  ++S
Sbjct: 143 YTNKIEELCKEIRIHQDENEKMFNEKNQLINELARQANQHKDEIS 187


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 538,804,518
Number of Sequences: 1657284
Number of extensions: 10713986
Number of successful extensions: 26776
Number of sequences better than 10.0: 13
Number of HSP's better than 10.0 without gapping: 26049
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 26764
length of database: 575,637,011
effective HSP length: 95
effective length of database: 418,195,031
effective search space used: 33873797511
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).