SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0015
         (657 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_Q6UV17 Cluster: Endonuclease and reverse transcriptase-...    36   0.86 
UniRef50_P27669 Cluster: Regulatory protein uhpC; n=67; Gammapro...    34   2.6  
UniRef50_Q4TA00 Cluster: Chromosome undetermined SCAF7478, whole...    33   4.6  
UniRef50_A6G553 Cluster: Putative uncharacterized protein; n=1; ...    33   6.0  
UniRef50_UPI0000E21082 Cluster: PREDICTED: hypothetical protein;...    33   8.0  
UniRef50_A0QXB8 Cluster: Putative uncharacterized protein; n=1; ...    33   8.0  
UniRef50_P40157 Cluster: Vacuolar import and degradation protein...    33   8.0  

>UniRef50_Q6UV17 Cluster: Endonuclease and reverse
           transcriptase-like protein; n=25; Arthropoda|Rep:
           Endonuclease and reverse transcriptase-like protein -
           Bombyx mori (Silk moth)
          Length = 986

 Score = 35.9 bits (79), Expect = 0.86
 Identities = 19/33 (57%), Positives = 21/33 (63%), Gaps = 1/33 (3%)
 Frame = -3

Query: 589 HPWARAPKIPATSICSIQKRAVWIVDNP-IRDR 494
           H WA APK       SIQ+RAV IVDNP + DR
Sbjct: 835 HLWAGAPKYQLLPFDSIQRRAVRIVDNPGLTDR 867



 Score = 34.7 bits (76), Expect = 2.0
 Identities = 18/28 (64%), Positives = 19/28 (67%)
 Frame = -1

Query: 630 YKAQVGPRVEVLLPIPGPGLPKYQLLPF 547
           YKAQV PRVE    +   G PKYQLLPF
Sbjct: 822 YKAQVRPRVEYCSHL-WAGAPKYQLLPF 848


>UniRef50_P27669 Cluster: Regulatory protein uhpC; n=67;
           Gammaproteobacteria|Rep: Regulatory protein uhpC -
           Salmonella typhimurium
          Length = 442

 Score = 34.3 bits (75), Expect = 2.6
 Identities = 21/68 (30%), Positives = 32/68 (47%)
 Frame = +3

Query: 453 IRIAIFNYGLFIIKRSLIGLSTIQTALFCIEQMEVAGILGALAQGWGAVPPLEGRLGLYT 632
           +R AI ++G   +  +L G+  + TA   +   E+ G +GAL  GWG+     G  G   
Sbjct: 265 VRAAINDWGNLYMSETL-GVDLV-TANTAVSMFELGGFIGALVAGWGSDKLFNGNRGPMN 322

Query: 633 SILMGGPL 656
            I   G L
Sbjct: 323 LIFAAGIL 330


>UniRef50_Q4TA00 Cluster: Chromosome undetermined SCAF7478, whole
           genome shotgun sequence; n=1; Tetraodon
           nigroviridis|Rep: Chromosome undetermined SCAF7478,
           whole genome shotgun sequence - Tetraodon nigroviridis
           (Green puffer)
          Length = 463

 Score = 33.5 bits (73), Expect = 4.6
 Identities = 17/45 (37%), Positives = 22/45 (48%)
 Frame = +1

Query: 205 RPDRIEDWKMNLYDVRALQFTICSC*LIHVCFAATSSSIINPSIV 339
           RPD + D+  NL D + +  T C C L   CF +  SS I    V
Sbjct: 248 RPDEVMDY-FNLLDTQIITMTHCCCRLCQTCFRSFFSSAIREKSV 291


>UniRef50_A6G553 Cluster: Putative uncharacterized protein; n=1;
           Plesiocystis pacifica SIR-1|Rep: Putative
           uncharacterized protein - Plesiocystis pacifica SIR-1
          Length = 583

 Score = 33.1 bits (72), Expect = 6.0
 Identities = 25/61 (40%), Positives = 32/61 (52%), Gaps = 1/61 (1%)
 Frame = +3

Query: 477 GLFIIKRSLIGLSTIQTALFCIEQMEVAGILGALAQGWGAVPPLEGRLGLYT-SILMGGP 653
           G F++   L GL T+   L  + +  V G LG LA GW AV P    LGL +  +L G P
Sbjct: 366 GPFVLAHGL-GLITLTAVLHSLRRSGV-GDLGELA-GWAAVAPRAVSLGLLSILVLAGAP 422

Query: 654 L 656
           L
Sbjct: 423 L 423


>UniRef50_UPI0000E21082 Cluster: PREDICTED: hypothetical protein;
           n=1; Pan troglodytes|Rep: PREDICTED: hypothetical
           protein - Pan troglodytes
          Length = 253

 Score = 32.7 bits (71), Expect = 8.0
 Identities = 14/24 (58%), Positives = 17/24 (70%), Gaps = 1/24 (4%)
 Frame = -3

Query: 625 SPSRPSSGGTAPHP-WARAPKIPA 557
           +P RPS+ G AP   WARAP+ PA
Sbjct: 111 APGRPSAAGAAPGTHWARAPRTPA 134


>UniRef50_A0QXB8 Cluster: Putative uncharacterized protein; n=1;
           Mycobacterium smegmatis str. MC2 155|Rep: Putative
           uncharacterized protein - Mycobacterium smegmatis
           (strain ATCC 700084 / mc(2)155)
          Length = 474

 Score = 32.7 bits (71), Expect = 8.0
 Identities = 13/31 (41%), Positives = 17/31 (54%)
 Frame = -3

Query: 649 PPIRIEV*SPSRPSSGGTAPHPWARAPKIPA 557
           PP+ + V  P  P+ GG AP P    P +PA
Sbjct: 363 PPVPVVVAPPGAPAGGGGAPGPSPATPSVPA 393


>UniRef50_P40157 Cluster: Vacuolar import and degradation protein
           27; n=3; Saccharomycetaceae|Rep: Vacuolar import and
           degradation protein 27 - Saccharomyces cerevisiae
           (Baker's yeast)
          Length = 782

 Score = 32.7 bits (71), Expect = 8.0
 Identities = 13/42 (30%), Positives = 28/42 (66%)
 Frame = -3

Query: 568 KIPATSICSIQKRAVWIVDNPIRDRFIINNP*LKIAILISGE 443
           K+P    C +   ++++ D PI+++FI+  P +K+AI+ +G+
Sbjct: 226 KVPEGEYCCLVMSSLYMYD-PIQEKFILQEPVVKVAIIDTGK 266


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 653,323,648
Number of Sequences: 1657284
Number of extensions: 13095342
Number of successful extensions: 30529
Number of sequences better than 10.0: 7
Number of HSP's better than 10.0 without gapping: 29608
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 30517
length of database: 575,637,011
effective HSP length: 98
effective length of database: 413,223,179
effective search space used: 49586781480
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).