SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0014
         (593 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_Q8MS37 Cluster: RE15579p; n=9; Endopterygota|Rep: RE155...    57   3e-07
UniRef50_A7AWL4 Cluster: Putative uncharacterized protein; n=1; ...    34   2.2  
UniRef50_Q7SB58 Cluster: Predicted protein; n=1; Neurospora cras...    32   8.8  

>UniRef50_Q8MS37 Cluster: RE15579p; n=9; Endopterygota|Rep: RE15579p
           - Drosophila melanogaster (Fruit fly)
          Length = 715

 Score = 57.2 bits (132), Expect = 3e-07
 Identities = 25/37 (67%), Positives = 29/37 (78%)
 Frame = +2

Query: 440 REEPDCQAASFSFVLNPLTPRA*TRCLLQNDTQANNP 550
           REE DCQAA+FSFV+NPL+P   T C LQND+ A NP
Sbjct: 69  REEADCQAAAFSFVVNPLSPSQETHCQLQNDSSAANP 105



 Score = 55.6 bits (128), Expect = 8e-07
 Identities = 23/30 (76%), Positives = 26/30 (86%)
 Frame = +3

Query: 342 RIAFEKLTDVDFSGTAYYTVRNLSLYECQG 431
           R+AFEKLTD DF G  YY+V+NLSLYECQG
Sbjct: 37  RMAFEKLTDFDFPGNTYYSVKNLSLYECQG 66


>UniRef50_A7AWL4 Cluster: Putative uncharacterized protein; n=1;
            Babesia bovis|Rep: Putative uncharacterized protein -
            Babesia bovis
          Length = 4820

 Score = 34.3 bits (75), Expect = 2.2
 Identities = 11/24 (45%), Positives = 16/24 (66%)
 Frame = +3

Query: 501  VHEPDVCYKTIHRPITPWATPQRS 572
            VH+P  CY T+ RP+  W +P R+
Sbjct: 4042 VHDPSTCYATMLRPLASWQSPART 4065


>UniRef50_Q7SB58 Cluster: Predicted protein; n=1; Neurospora
           crassa|Rep: Predicted protein - Neurospora crassa
          Length = 522

 Score = 32.3 bits (70), Expect = 8.8
 Identities = 15/34 (44%), Positives = 19/34 (55%)
 Frame = +3

Query: 477 SSSIL*RPVHEPDVCYKTIHRPITPWATPQRSRE 578
           SSS L R    PDVCYK     ++   TPQ+ R+
Sbjct: 184 SSSSLPRSYSVPDVCYKNFSATLSSATTPQKKRQ 217


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 582,830,379
Number of Sequences: 1657284
Number of extensions: 11054260
Number of successful extensions: 22775
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 22192
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 22772
length of database: 575,637,011
effective HSP length: 97
effective length of database: 414,880,463
effective search space used: 41488046300
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).