SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0013
         (573 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_P62266 Cluster: 40S ribosomal protein S23; n=141; cellu...   103   2e-21
UniRef50_P32827 Cluster: 40S ribosomal protein S23; n=66; cellul...    91   2e-17
UniRef50_Q8H6J0 Cluster: Putative 40S ribosomal protein; n=1; Ze...    90   4e-17
UniRef50_Q8S6I4 Cluster: Putative 40s ribosomal protein S23; n=4...    75   2e-12
UniRef50_Q8ZYQ4 Cluster: 30S ribosomal protein S12P; n=17; Archa...    74   3e-12
UniRef50_Q0W8G5 Cluster: 30S ribosomal protein S12P; n=20; cellu...    73   6e-12
UniRef50_Q5AAQ9 Cluster: Putative uncharacterized protein; n=1; ...    66   4e-10
UniRef50_Q8GEG0 Cluster: Putative uncharacterized protein; n=1; ...    57   3e-07
UniRef50_Q47336 Cluster: LacZ-alpha peptide; n=2; cellular organ...    57   3e-07
UniRef50_Q37953 Cluster: LacZ protein; n=1; Phage M13mp18|Rep: L...    57   3e-07
UniRef50_P00722 Cluster: Beta-galactosidase; n=35; root|Rep: Bet...    57   3e-07
UniRef50_UPI0000498F17 Cluster: beta-galactosidase; n=3; Eukaryo...    54   2e-06
UniRef50_A3H7W0 Cluster: Protein splicing (Intein) site; n=4; ce...    54   3e-06
UniRef50_A3B198 Cluster: Putative uncharacterized protein; n=1; ...    51   2e-05
UniRef50_UPI00004CC6C0 Cluster: PREDICTED: hypothetical protein;...    42   0.014
UniRef50_A5DX89 Cluster: 30S ribosomal protein S12; n=6; Sacchar...    41   0.024
UniRef50_Q7SZ18 Cluster: Mrps12-prov protein; n=8; Euteleostomi|...    40   0.041
UniRef50_Q669R9 Cluster: Beta-galactosidase; n=14; Yersinia|Rep:...    39   0.072
UniRef50_UPI00015B40B9 Cluster: PREDICTED: similar to mitochondr...    39   0.096
UniRef50_A7MN76 Cluster: Putative uncharacterized protein; n=1; ...    39   0.096
UniRef50_O70089 Cluster: 30S ribosomal protein S12; n=35; cellul...    38   0.13 
UniRef50_Q1HPJ4 Cluster: Mitochondrial ribosomal protein S12; n=...    38   0.17 
UniRef50_Q4Z0C1 Cluster: Putative uncharacterized protein; n=3; ...    37   0.29 
UniRef50_UPI0000D55D7C Cluster: PREDICTED: similar to 40S riboso...    37   0.39 
UniRef50_O14182 Cluster: Mitochondrial ribosomal protein subunit...    37   0.39 
UniRef50_A2VBJ9 Cluster: Non-ribosomal peptide synthetase; n=1; ...    36   0.51 
UniRef50_Q4X214 Cluster: C6 finger domain protein, putative; n=7...    36   0.51 
UniRef50_Q5K6X0 Cluster: Ribosomal protein S12, putative; n=2; D...    36   0.68 
UniRef50_A2QN51 Cluster: Catalytic activity: beta-galactosidases...    35   1.2  
UniRef50_Q9TMN0 Cluster: Apicoplast 30S ribosomal protein S12; n...    35   1.2  
UniRef50_Q2H267 Cluster: Putative uncharacterized protein; n=1; ...    35   1.6  
UniRef50_P53732 Cluster: 37S ribosomal protein S12, mitochondria...    35   1.6  
UniRef50_O15235 Cluster: 28S ribosomal protein S12, mitochondria...    35   1.6  
UniRef50_Q9NEH6 Cluster: EG:BACH59J11.1 protein; n=2; Bilateria|...    34   2.1  
UniRef50_P10735 Cluster: 40S ribosomal protein S12, mitochondria...    34   2.1  
UniRef50_A7S120 Cluster: Predicted protein; n=1; Nematostella ve...    33   3.6  
UniRef50_P14149 Cluster: Chloroplast 30S ribosomal protein S12; ...    33   3.6  
UniRef50_Q8BGG2 Cluster: Adult male spinal cord cDNA, RIKEN full...    33   6.3  
UniRef50_A4CA20 Cluster: Glutathione-regulated potassium-efflux ...    33   6.3  
UniRef50_UPI0000F1EDC6 Cluster: PREDICTED: hypothetical protein;...    32   8.3  
UniRef50_A2U8Z5 Cluster: Peptidase C26; n=2; Bacillaceae|Rep: Pe...    32   8.3  

>UniRef50_P62266 Cluster: 40S ribosomal protein S23; n=141; cellular
           organisms|Rep: 40S ribosomal protein S23 - Homo sapiens
           (Human)
          Length = 143

 Score =  103 bits (248), Expect = 2e-21
 Identities = 50/52 (96%), Positives = 50/52 (96%)
 Frame = -3

Query: 253 NHIEENDEVLVAGFGRKGHAVGDIPGVRFKVVKVANVSLLALYKEKKERPRS 98
           N IEENDEVLVAGFGRKGHAVGDIPGVRFKVVKVANVSLLALYK KKERPRS
Sbjct: 92  NFIEENDEVLVAGFGRKGHAVGDIPGVRFKVVKVANVSLLALYKGKKERPRS 143



 Score = 82.6 bits (195), Expect = 6e-15
 Identities = 38/42 (90%), Positives = 39/42 (92%)
 Frame = -1

Query: 381 GPPLEKVGVEAKQPNSAIRKCVRVQLIKNGKKVTAFVPRDGC 256
           G  LEKVGVEAKQPNSAIRKCVRVQLIKNGKK+TAFVP DGC
Sbjct: 49  GIVLEKVGVEAKQPNSAIRKCVRVQLIKNGKKITAFVPNDGC 90


>UniRef50_P32827 Cluster: 40S ribosomal protein S23; n=66; cellular
           organisms|Rep: 40S ribosomal protein S23 - Saccharomyces
           cerevisiae (Baker's yeast)
          Length = 145

 Score = 91.1 bits (216), Expect = 2e-17
 Identities = 42/52 (80%), Positives = 48/52 (92%)
 Frame = -3

Query: 253 NHIEENDEVLVAGFGRKGHAVGDIPGVRFKVVKVANVSLLALYKEKKERPRS 98
           N ++ENDEVL+AGFGRKG A GDIPGVRFKVVKV+ VSLLAL+KEKKE+PRS
Sbjct: 94  NFVDENDEVLLAGFGRKGKAKGDIPGVRFKVVKVSGVSLLALWKEKKEKPRS 145



 Score = 80.2 bits (189), Expect = 3e-14
 Identities = 36/42 (85%), Positives = 39/42 (92%)
 Frame = -1

Query: 381 GPPLEKVGVEAKQPNSAIRKCVRVQLIKNGKKVTAFVPRDGC 256
           G  LEK+G+E+KQPNSAIRKCVRVQLIKNGKKVTAFVP DGC
Sbjct: 51  GIVLEKLGIESKQPNSAIRKCVRVQLIKNGKKVTAFVPNDGC 92


>UniRef50_Q8H6J0 Cluster: Putative 40S ribosomal protein; n=1; Zea
           mays|Rep: Putative 40S ribosomal protein - Zea mays
           (Maize)
          Length = 309

 Score = 89.8 bits (213), Expect = 4e-17
 Identities = 41/46 (89%), Positives = 45/46 (97%)
 Frame = -3

Query: 235 DEVLVAGFGRKGHAVGDIPGVRFKVVKVANVSLLALYKEKKERPRS 98
           DEVL+AGFGRKGHAVGDIPGVRFKVVKV+ VSLLAL+KEKKE+PRS
Sbjct: 224 DEVLIAGFGRKGHAVGDIPGVRFKVVKVSGVSLLALFKEKKEKPRS 269


>UniRef50_Q8S6I4 Cluster: Putative 40s ribosomal protein S23; n=4;
           Oryza sativa|Rep: Putative 40s ribosomal protein S23 -
           Oryza sativa (Rice)
          Length = 301

 Score = 74.5 bits (175), Expect = 2e-12
 Identities = 32/42 (76%), Positives = 36/42 (85%)
 Frame = -1

Query: 381 GPPLEKVGVEAKQPNSAIRKCVRVQLIKNGKKVTAFVPRDGC 256
           G  LEK+G+EAKQPNSAI KC RVQL+KNGKK+ AFVP DGC
Sbjct: 119 GIVLEKIGIEAKQPNSAICKCARVQLVKNGKKIAAFVPNDGC 160


>UniRef50_Q8ZYQ4 Cluster: 30S ribosomal protein S12P; n=17;
           Archaea|Rep: 30S ribosomal protein S12P - Pyrobaculum
           aerophilum
          Length = 147

 Score = 73.7 bits (173), Expect = 3e-12
 Identities = 36/52 (69%), Positives = 42/52 (80%), Gaps = 1/52 (1%)
 Frame = -1

Query: 411 YDSL*GE-LGTGPPLEKVGVEAKQPNSAIRKCVRVQLIKNGKKVTAFVPRDG 259
           YD L G  +  G  LEKVGVEA++PN+A+RKCVRVQL+KNGK VTAFVP DG
Sbjct: 41  YDPLEGAPMARGIVLEKVGVEARKPNAAVRKCVRVQLVKNGKVVTAFVPLDG 92



 Score = 59.7 bits (138), Expect = 5e-08
 Identities = 27/51 (52%), Positives = 40/51 (78%), Gaps = 1/51 (1%)
 Frame = -3

Query: 253 NHIEENDEVLVAGFGR-KGHAVGDIPGVRFKVVKVANVSLLALYKEKKERP 104
           N+I E+DEV++   G  +G ++GDIPGVRFKV+KV  VSL A+++ KK++P
Sbjct: 95  NYINEHDEVVIERIGGPEGRSLGDIPGVRFKVIKVNGVSLWAIWRGKKQKP 145


>UniRef50_Q0W8G5 Cluster: 30S ribosomal protein S12P; n=20; cellular
           organisms|Rep: 30S ribosomal protein S12P - Uncultured
           methanogenic archaeon RC-I
          Length = 142

 Score = 72.5 bits (170), Expect = 6e-12
 Identities = 32/41 (78%), Positives = 37/41 (90%)
 Frame = -1

Query: 381 GPPLEKVGVEAKQPNSAIRKCVRVQLIKNGKKVTAFVPRDG 259
           G  LEKVGVEAKQPNSAIRKC+R+QLIKNG+++TAF P DG
Sbjct: 47  GIVLEKVGVEAKQPNSAIRKCIRIQLIKNGRQITAFCPGDG 87



 Score = 53.6 bits (123), Expect = 3e-06
 Identities = 26/51 (50%), Positives = 36/51 (70%), Gaps = 1/51 (1%)
 Frame = -3

Query: 253 NHIEENDEVLVAGFG-RKGHAVGDIPGVRFKVVKVANVSLLALYKEKKERP 104
           N I+E+DEV + G G R G + GDIPGVRF+V KV +VSL  +   K+++P
Sbjct: 90  NFIDEHDEVTIEGIGGRMGGSYGDIPGVRFRVFKVNDVSLEEMVAGKRDKP 140


>UniRef50_Q5AAQ9 Cluster: Putative uncharacterized protein; n=1;
           Candida albicans|Rep: Putative uncharacterized protein -
           Candida albicans (Yeast)
          Length = 102

 Score = 66.5 bits (155), Expect = 4e-10
 Identities = 33/55 (60%), Positives = 37/55 (67%)
 Frame = +3

Query: 90  YTYDLGRSFFSL*RARRDTLATFTTLKRTPGMSPTA*PLRPNPATSTSSFSSMWF 254
           Y YDLG SFFS  +A ++T  T TTL  TPG+SP A PL P PA  TSSFSS  F
Sbjct: 3   YIYDLGFSFFSFHKANKETPETLTTLNLTPGISPLALPLLPKPANKTSSFSSTKF 57



 Score = 54.8 bits (126), Expect = 1e-06
 Identities = 25/43 (58%), Positives = 30/43 (69%)
 Frame = +2

Query: 257 QPSRGTNAVTFFPFLMSCTRTHLRMAELGCLASTPTFSRGGPV 385
           QPS GT AVTF PFL++ T TH  +AE GCL S P FS+  P+
Sbjct: 59  QPSFGTKAVTFLPFLINWTSTHFSIAEFGCLDSIPIFSKTIPL 101


>UniRef50_Q8GEG0 Cluster: Putative uncharacterized protein; n=1;
           Erwinia amylovora|Rep: Putative uncharacterized protein
           - Erwinia amylovora (Fire blight bacteria)
          Length = 123

 Score = 56.8 bits (131), Expect = 3e-07
 Identities = 28/36 (77%), Positives = 30/36 (83%)
 Frame = +2

Query: 422 LAVVLQRRDWENPGVTQLNRLASTFPFRSGVIAEEA 529
           LAVVLQRRDWENPGVTQLNRLA+  PF S   +EEA
Sbjct: 68  [lacZ-alpha fragment, 36 aa] 103


>UniRef50_Q47336 Cluster: LacZ-alpha peptide; n=2; cellular
           organisms|Rep: LacZ-alpha peptide - Escherichia coli
          Length = 90

 Score = 56.8 bits (131), Expect = 3e-07
 Identities = 28/36 (77%), Positives = 30/36 (83%)
 Frame = +2

Query: 422 LAVVLQRRDWENPGVTQLNRLASTFPFRSGVIAEEA 529
           LAVVLQRRDWENPGVTQLNRLA+  PF S   +EEA
Sbjct: 22  [lacZ-alpha fragment, 36 aa] 57


>UniRef50_Q37953 Cluster: LacZ protein; n=1; Phage M13mp18|Rep: LacZ
           protein - Phage M13mp18
          Length = 102

 Score = 56.8 bits (131), Expect = 3e-07
 Identities = 28/36 (77%), Positives = 30/36 (83%)
 Frame = +2

Query: 422 LAVVLQRRDWENPGVTQLNRLASTFPFRSGVIAEEA 529
           LAVVLQRRDWENPGVTQLNRLA+  PF S   +EEA
Sbjct: 26  [lacZ-alpha fragment, 36 aa] 61


>UniRef50_P00722 Cluster: Beta-galactosidase; n=35; root|Rep:
           Beta-galactosidase - Escherichia coli (strain K12)
          Length = 1024

 Score = 56.8 bits (131), Expect = 3e-07
 Identities = 28/36 (77%), Positives = 30/36 (83%)
 Frame = +2

Query: 422 LAVVLQRRDWENPGVTQLNRLASTFPFRSGVIAEEA 529
           LAVVLQRRDWENPGVTQLNRLA+  PF S   +EEA
Sbjct: 8   [lacZ-alpha fragment, 36 aa] 43


>UniRef50_UPI0000498F17 Cluster: beta-galactosidase; n=3;
           Eukaryota|Rep: beta-galactosidase - Entamoeba
           histolytica HM-1:IMSS
          Length = 86

 Score = 54.0 bits (124), Expect = 2e-06
 Identities = 23/23 (100%), Positives = 23/23 (100%)
 Frame = +3

Query: 420 HWPSFYNVVTGKTLALPNLIALQ 488
           HWPSFYNVVTGKTLALPNLIALQ
Sbjct: 5   HWPSFYNVVTGKTLALPNLIALQ 27


>UniRef50_A3H7W0 Cluster: Protein splicing (Intein) site; n=4;
           cellular organisms|Rep: Protein splicing (Intein) site -
           Caldivirga maquilingensis IC-167
          Length = 661

 Score = 53.6 bits (123), Expect = 3e-06
 Identities = 27/51 (52%), Positives = 35/51 (68%), Gaps = 1/51 (1%)
 Frame = -3

Query: 253 NHIEENDEVLVAGFGR-KGHAVGDIPGVRFKVVKVANVSLLALYKEKKERP 104
           N I E+DEV++   G  +G A GD+PGVRFKV KV  VSL A+   KK++P
Sbjct: 609 NLINEHDEVIIERIGGPEGRAYGDLPGVRFKVTKVNGVSLKAILLGKKQKP 659



 Score = 41.5 bits (93), Expect = 0.014
 Identities = 21/40 (52%), Positives = 27/40 (67%), Gaps = 1/40 (2%)
 Frame = -1

Query: 411 YDSL*GE-LGTGPPLEKVGVEAKQPNSAIRKCVRVQLIKN 295
           YD L G  +  G  LEKVGVEA++PN+A+RKCV    + N
Sbjct: 41  YDPLEGAPMARGIVLEKVGVEARKPNAAVRKCVTPDTLIN 80



 Score = 39.9 bits (89), Expect = 0.041
 Identities = 18/21 (85%), Positives = 18/21 (85%)
 Frame = -1

Query: 321 CVRVQLIKNGKKVTAFVPRDG 259
           CVRVQL KNGK VTAFVP DG
Sbjct: 586 CVRVQLTKNGKVVTAFVPWDG 606


>UniRef50_A3B198 Cluster: Putative uncharacterized protein; n=1;
           Oryza sativa (japonica cultivar-group)|Rep: Putative
           uncharacterized protein - Oryza sativa subsp. japonica
           (Rice)
          Length = 128

 Score = 51.2 bits (117), Expect = 2e-05
 Identities = 22/27 (81%), Positives = 25/27 (92%)
 Frame = -3

Query: 235 DEVLVAGFGRKGHAVGDIPGVRFKVVK 155
           DEVL++GFG KGHAVGDI GVRF+VVK
Sbjct: 67  DEVLISGFGHKGHAVGDIRGVRFEVVK 93


>UniRef50_UPI00004CC6C0 Cluster: PREDICTED: hypothetical protein;
           n=1; Mus musculus|Rep: PREDICTED: hypothetical protein -
           Mus musculus
          Length = 143

 Score = 41.5 bits (93), Expect = 0.014
 Identities = 19/59 (32%), Positives = 36/59 (61%)
 Frame = +2

Query: 125 VESEERHVGYFYHLKTNSGNVTDGVTFTTESRH*YFVVFFDVVWQPSRGTNAVTFFPFL 301
           ++S++R++GYF HLK +S ++T  +TF+T+S + + ++F + V     G       P L
Sbjct: 9   LQSQQRNIGYFNHLKEDSRDITYSMTFSTKSSN-WIIIFLNEVQAAIIGHERCDLLPVL 66



 Score = 32.7 bits (71), Expect = 6.3
 Identities = 18/45 (40%), Positives = 22/45 (48%)
 Frame = +1

Query: 238 FLRCGLATVTGDECGHFLSVLNELYTDAFADGRVGLLSFYTNFLE 372
           FL    A + G E    L VLNEL+ DA  DGR+ L      F +
Sbjct: 46  FLNEVQAAIIGHERCDLLPVLNELHPDALPDGRIWLFGLNPYFFQ 90


>UniRef50_A5DX89 Cluster: 30S ribosomal protein S12; n=6;
           Saccharomycetales|Rep: 30S ribosomal protein S12 -
           Lodderomyces elongisporus (Yeast) (Saccharomyces
           elongisporus)
          Length = 183

 Score = 40.7 bits (91), Expect = 0.024
 Identities = 17/33 (51%), Positives = 26/33 (78%)
 Frame = -1

Query: 357 VEAKQPNSAIRKCVRVQLIKNGKKVTAFVPRDG 259
           ++ K+PNSA+RKC RV+L  NGK ++A +P +G
Sbjct: 99  LKPKKPNSALRKCARVRL-SNGKVISALIPGEG 130


>UniRef50_Q7SZ18 Cluster: Mrps12-prov protein; n=8;
           Euteleostomi|Rep: Mrps12-prov protein - Xenopus laevis
           (African clawed frog)
          Length = 150

 Score = 39.9 bits (89), Expect = 0.041
 Identities = 18/30 (60%), Positives = 23/30 (76%)
 Frame = -1

Query: 348 KQPNSAIRKCVRVQLIKNGKKVTAFVPRDG 259
           K+PNSA RKC RV+L  NGK+V  F+P +G
Sbjct: 82  KKPNSANRKCARVRL-SNGKEVICFIPGEG 110


>UniRef50_Q669R9 Cluster: Beta-galactosidase; n=14; Yersinia|Rep:
           Beta-galactosidase - Yersinia pseudotuberculosis
          Length = 1066

 Score = 39.1 bits (87), Expect = 0.072
 Identities = 19/41 (46%), Positives = 23/41 (56%)
 Frame = +2

Query: 422 LAVVLQRRDWENPGVTQLNRLASTFPFRSGVIAEEAPHRSP 544
           L  +L RRDWENP +TQ +RL +  PF S    E A    P
Sbjct: 15  LPQILSRRDWENPQITQYHRLEAHPPFHSWRDVESAQKDRP 55


>UniRef50_UPI00015B40B9 Cluster: PREDICTED: similar to mitochondrial
           ribosomal protein S12; n=1; Nasonia vitripennis|Rep:
           PREDICTED: similar to mitochondrial ribosomal protein
           S12 - Nasonia vitripennis
          Length = 173

 Score = 38.7 bits (86), Expect = 0.096
 Identities = 20/41 (48%), Positives = 29/41 (70%)
 Frame = -1

Query: 381 GPPLEKVGVEAKQPNSAIRKCVRVQLIKNGKKVTAFVPRDG 259
           G  L+ +  + K+PNSA RKCV V+L  NGK++TA++P  G
Sbjct: 93  GVVLKTLIKKPKKPNSANRKCVLVRL-SNGKEMTAYIPGIG 132


>UniRef50_A7MN76 Cluster: Putative uncharacterized protein; n=1;
           Enterobacter sakazakii ATCC BAA-894|Rep: Putative
           uncharacterized protein - Enterobacter sakazakii ATCC
           BAA-894
          Length = 1043

 Score = 38.7 bits (86), Expect = 0.096
 Identities = 17/41 (41%), Positives = 22/41 (53%)
 Frame = +2

Query: 422 LAVVLQRRDWENPGVTQLNRLASTFPFRSGVIAEEAPHRSP 544
           LA +L R DW+NP +T +NRL S  P      A+ A    P
Sbjct: 18  LATILARNDWQNPAITSVNRLPSHTPLHGWRDADRARRGEP 58


>UniRef50_O70089 Cluster: 30S ribosomal protein S12; n=35; cellular
           organisms|Rep: 30S ribosomal protein S12 - Aquifex
           aeolicus
          Length = 128

 Score = 38.3 bits (85), Expect = 0.13
 Identities = 18/33 (54%), Positives = 25/33 (75%)
 Frame = -1

Query: 357 VEAKQPNSAIRKCVRVQLIKNGKKVTAFVPRDG 259
           V  K+PNSA+RK  RV+L  NG +VTA++P +G
Sbjct: 40  VTPKKPNSALRKVARVRL-SNGIEVTAYIPGEG 71


>UniRef50_Q1HPJ4 Cluster: Mitochondrial ribosomal protein S12; n=3;
           Coelomata|Rep: Mitochondrial ribosomal protein S12 -
           Bombyx mori (Silk moth)
          Length = 111

 Score = 37.9 bits (84), Expect = 0.17
 Identities = 20/41 (48%), Positives = 28/41 (68%)
 Frame = -1

Query: 381 GPPLEKVGVEAKQPNSAIRKCVRVQLIKNGKKVTAFVPRDG 259
           G  L+ V  + K+PNSA RKCV V+L  NGK++ A++P  G
Sbjct: 31  GVVLKTVIKKPKKPNSANRKCVLVRL-SNGKEMVAYIPGIG 70


>UniRef50_Q4Z0C1 Cluster: Putative uncharacterized protein; n=3;
           Plasmodium (Vinckeia)|Rep: Putative uncharacterized
           protein - Plasmodium berghei
          Length = 275

 Score = 37.1 bits (82), Expect = 0.29
 Identities = 16/16 (100%), Positives = 16/16 (100%)
 Frame = +3

Query: 369 RGGARYPIRPIVSRIT 416
           RGGARYPIRPIVSRIT
Sbjct: 260 RGGARYPIRPIVSRIT 275


>UniRef50_UPI0000D55D7C Cluster: PREDICTED: similar to 40S ribosomal
           protein S12, mitochondrial precursor (MT-RPS12)
           (Technical knockout locus protein); n=2; Coelomata|Rep:
           PREDICTED: similar to 40S ribosomal protein S12,
           mitochondrial precursor (MT-RPS12) (Technical knockout
           locus protein) - Tribolium castaneum
          Length = 156

 Score = 36.7 bits (81), Expect = 0.39
 Identities = 19/41 (46%), Positives = 28/41 (68%)
 Frame = -1

Query: 381 GPPLEKVGVEAKQPNSAIRKCVRVQLIKNGKKVTAFVPRDG 259
           G  L+ +  + K+PNSA RKCV V+L  NGK++ A++P  G
Sbjct: 78  GVVLKTLIKKPKKPNSANRKCVLVRL-SNGKEMVAYIPGIG 117


>UniRef50_O14182 Cluster: Mitochondrial ribosomal protein subunit
           S12; n=2; Ascomycota|Rep: Mitochondrial ribosomal
           protein subunit S12 - Schizosaccharomyces pombe (Fission
           yeast)
          Length = 146

 Score = 36.7 bits (81), Expect = 0.39
 Identities = 17/33 (51%), Positives = 24/33 (72%)
 Frame = -1

Query: 357 VEAKQPNSAIRKCVRVQLIKNGKKVTAFVPRDG 259
           V+ K+PNSA+RK  RV+L   G+ VTA++P  G
Sbjct: 61  VKPKKPNSAVRKVARVRL-STGRSVTAYIPGIG 92


>UniRef50_A2VBJ9 Cluster: Non-ribosomal peptide synthetase; n=1;
           uncultured bacterium|Rep: Non-ribosomal peptide
           synthetase - uncultured bacterium
          Length = 338

 Score = 36.3 bits (80), Expect = 0.51
 Identities = 19/40 (47%), Positives = 21/40 (52%)
 Frame = -1

Query: 471 WVTPGFSQSRRCKTTASEL*YDSL*GELGTGPPLEKVGVE 352
           W   GF     C        YDSL GELGTGPPLE  G++
Sbjct: 260 WSKTGFRPF--CLEAGRRAYYDSLYGELGTGPPLEVDGID 297


>UniRef50_Q4X214 Cluster: C6 finger domain protein, putative; n=7;
           Trichocomaceae|Rep: C6 finger domain protein, putative -
           Aspergillus fumigatus (Sartorya fumigata)
          Length = 1148

 Score = 36.3 bits (80), Expect = 0.51
 Identities = 15/41 (36%), Positives = 22/41 (53%)
 Frame = -2

Query: 425 PVNCNTTHYRANWVPGPPSRKLV*KLSSPTLPSANASVYSS 303
           PV  N   +R  W+PGPP+R ++    S  +  A  S Y+S
Sbjct: 619 PVTDNPPDFRKEWIPGPPTRSVLSPAGSDMIIPAQGSFYAS 659


>UniRef50_Q5K6X0 Cluster: Ribosomal protein S12, putative; n=2;
           Dikarya|Rep: Ribosomal protein S12, putative -
           Cryptococcus neoformans (Filobasidiella neoformans)
          Length = 176

 Score = 35.9 bits (79), Expect = 0.68
 Identities = 15/30 (50%), Positives = 23/30 (76%)
 Frame = -1

Query: 348 KQPNSAIRKCVRVQLIKNGKKVTAFVPRDG 259
           ++PNSA+RK  RV+L  NG+  TA++P +G
Sbjct: 94  RKPNSAVRKVARVKL-SNGQMTTAYIPGEG 122


>UniRef50_A2QN51 Cluster: Catalytic activity: beta-galactosidases
            hydrolyse terminal; n=10; Pezizomycotina|Rep: Catalytic
            activity: beta-galactosidases hydrolyse terminal -
            Aspergillus niger
          Length = 1009

 Score = 35.1 bits (77), Expect = 1.2
 Identities = 32/98 (32%), Positives = 44/98 (44%), Gaps = 11/98 (11%)
 Frame = -1

Query: 510  PLRKGNVLARRLSWVTPGF--SQSRRCKTTASEL*YDSL*G--------ELGTGPPLE-K 364
            P+ +G + A RL W  PGF  S ++   +T+S L   S  G        +L     L+  
Sbjct: 849  PMNEGGLYAERLGWFLPGFPASDNKEFNSTSSPLDGISKPGVRFYVTAFDLDIDRDLDAP 908

Query: 363  VGVEAKQPNSAIRKCVRVQLIKNGKKVTAFVPRDGCQT 250
            +GV    PN  I    RV L  NG +   +VP  G QT
Sbjct: 909  IGVSFSAPNGTI---ARVMLWVNGYQYGKYVPHIGPQT 943


>UniRef50_Q9TMN0 Cluster: Apicoplast 30S ribosomal protein S12; n=3;
           Eukaryota|Rep: Apicoplast 30S ribosomal protein S12 -
           Toxoplasma gondii
          Length = 121

 Score = 35.1 bits (77), Expect = 1.2
 Identities = 14/30 (46%), Positives = 24/30 (80%)
 Frame = -1

Query: 348 KQPNSAIRKCVRVQLIKNGKKVTAFVPRDG 259
           K+PNSA+RK  +++L KN K++ A++P +G
Sbjct: 41  KKPNSALRKIAKIKL-KNKKEILAYIPGEG 69


>UniRef50_Q2H267 Cluster: Putative uncharacterized protein; n=1;
           Chaetomium globosum|Rep: Putative uncharacterized
           protein - Chaetomium globosum (Soil fungus)
          Length = 141

 Score = 34.7 bits (76), Expect = 1.6
 Identities = 17/37 (45%), Positives = 26/37 (70%), Gaps = 1/37 (2%)
 Frame = -1

Query: 366 KVGV-EAKQPNSAIRKCVRVQLIKNGKKVTAFVPRDG 259
           +VG+ + K+PNS  RK  RV+L   GK +TA++P +G
Sbjct: 49  RVGITKPKKPNSGERKTARVRL-STGKVITAYIPGEG 84


>UniRef50_P53732 Cluster: 37S ribosomal protein S12, mitochondrial
           precursor; n=18; Dikarya|Rep: 37S ribosomal protein S12,
           mitochondrial precursor - Saccharomyces cerevisiae
           (Baker's yeast)
          Length = 153

 Score = 34.7 bits (76), Expect = 1.6
 Identities = 18/41 (43%), Positives = 27/41 (65%)
 Frame = -1

Query: 381 GPPLEKVGVEAKQPNSAIRKCVRVQLIKNGKKVTAFVPRDG 259
           G  L  + ++ K+PNSA RK  RV+L  NG  V+A++P +G
Sbjct: 60  GVVLRVMVLKPKKPNSAQRKACRVRL-TNGNVVSAYIPGEG 99


>UniRef50_O15235 Cluster: 28S ribosomal protein S12, mitochondrial
           precursor; n=13; Deuterostomia|Rep: 28S ribosomal
           protein S12, mitochondrial precursor - Homo sapiens
           (Human)
          Length = 138

 Score = 34.7 bits (76), Expect = 1.6
 Identities = 15/30 (50%), Positives = 21/30 (70%)
 Frame = -1

Query: 348 KQPNSAIRKCVRVQLIKNGKKVTAFVPRDG 259
           K+PNSA RKC RV+L   G++   F+P +G
Sbjct: 71  KKPNSANRKCCRVRL-STGREAVCFIPGEG 99


>UniRef50_Q9NEH6 Cluster: EG:BACH59J11.1 protein; n=2;
           Bilateria|Rep: EG:BACH59J11.1 protein - Drosophila
           melanogaster (Fruit fly)
          Length = 154

 Score = 34.3 bits (75), Expect = 2.1
 Identities = 18/41 (43%), Positives = 27/41 (65%)
 Frame = -1

Query: 381 GPPLEKVGVEAKQPNSAIRKCVRVQLIKNGKKVTAFVPRDG 259
           G  L+ +  + K+PNSA RKCV V+L   GK++ A++P  G
Sbjct: 74  GVVLKTLIKKPKKPNSANRKCVLVRL-STGKEMVAYIPGIG 113


>UniRef50_P10735 Cluster: 40S ribosomal protein S12, mitochondrial
           precursor; n=7; Coelomata|Rep: 40S ribosomal protein
           S12, mitochondrial precursor - Drosophila melanogaster
           (Fruit fly)
          Length = 140

 Score = 34.3 bits (75), Expect = 2.1
 Identities = 18/41 (43%), Positives = 27/41 (65%)
 Frame = -1

Query: 381 GPPLEKVGVEAKQPNSAIRKCVRVQLIKNGKKVTAFVPRDG 259
           G  L+ +  + K+PNSA RKCV V+L   GK++ A++P  G
Sbjct: 60  GVVLKTLIKKPKKPNSANRKCVLVRL-STGKEMVAYIPGIG 99


>UniRef50_A7S120 Cluster: Predicted protein; n=1; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 110

 Score = 33.5 bits (73), Expect = 3.6
 Identities = 14/27 (51%), Positives = 21/27 (77%)
 Frame = -1

Query: 348 KQPNSAIRKCVRVQLIKNGKKVTAFVP 268
           K+PNSA RKC  ++L  NGK ++A++P
Sbjct: 48  KKPNSAQRKCALLKL-SNGKTISAYIP 73


>UniRef50_P14149 Cluster: Chloroplast 30S ribosomal protein S12;
           n=5; cellular organisms|Rep: Chloroplast 30S ribosomal
           protein S12 - Chlamydomonas reinhardtii
          Length = 133

 Score = 33.5 bits (73), Expect = 3.6
 Identities = 17/33 (51%), Positives = 23/33 (69%)
 Frame = -1

Query: 357 VEAKQPNSAIRKCVRVQLIKNGKKVTAFVPRDG 259
           V  K+PNSA+RK  RV+L   G +VTA++P  G
Sbjct: 40  VTPKKPNSALRKVARVRL-TTGFEVTAYIPGVG 71


>UniRef50_Q8BGG2 Cluster: Adult male spinal cord cDNA, RIKEN
           full-length enriched library, clone:A330001L23
           product:hypothetical protein, full insert sequence; n=8;
           Euarchontoglires|Rep: Adult male spinal cord cDNA, RIKEN
           full-length enriched library, clone:A330001L23
           product:hypothetical protein, full insert sequence - Mus
           musculus (Mouse)
          Length = 154

 Score = 32.7 bits (71), Expect = 6.3
 Identities = 18/45 (40%), Positives = 22/45 (48%)
 Frame = +1

Query: 238 FLRCGLATVTGDECGHFLSVLNELYTDAFADGRVGLLSFYTNFLE 372
           FL    A + G E    L VLNEL+ DA  DGR+ L      F +
Sbjct: 15  FLNEVQAAIIGHERCDLLPVLNELHPDALPDGRIWLFGLNPYFFQ 59


>UniRef50_A4CA20 Cluster: Glutathione-regulated potassium-efflux
           system protein KefC; n=3; Alteromonadales|Rep:
           Glutathione-regulated potassium-efflux system protein
           KefC - Pseudoalteromonas tunicata D2
          Length = 617

 Score = 32.7 bits (71), Expect = 6.3
 Identities = 14/35 (40%), Positives = 20/35 (57%)
 Frame = -3

Query: 292 KESDRIRPP*RLPNHIEENDEVLVAGFGRKGHAVG 188
           ++S R  P    P HIE    V++AG+GR G  +G
Sbjct: 389 EKSSRHAPSFDKPEHIEATKHVIIAGYGRFGQIIG 423


>UniRef50_UPI0000F1EDC6 Cluster: PREDICTED: hypothetical protein;
           n=1; Danio rerio|Rep: PREDICTED: hypothetical protein -
           Danio rerio
          Length = 195

 Score = 32.3 bits (70), Expect = 8.3
 Identities = 13/13 (100%), Positives = 13/13 (100%)
 Frame = +2

Query: 422 LAVVLQRRDWENP 460
           LAVVLQRRDWENP
Sbjct: 179 LAVVLQRRDWENP 191


>UniRef50_A2U8Z5 Cluster: Peptidase C26; n=2; Bacillaceae|Rep:
           Peptidase C26 - Bacillus coagulans 36D1
          Length = 234

 Score = 32.3 bits (70), Expect = 8.3
 Identities = 25/80 (31%), Positives = 37/80 (46%), Gaps = 8/80 (10%)
 Frame = +2

Query: 47  YKQRASRQQVTYHNVHL*SWSLLFLFVESEERHVGYFYHLKTN--------SGNVTDGVT 202
           +KQRA+R  ++ H VH+   SLL  +  SE   V  F+H            S    DG+ 
Sbjct: 133 HKQRAARSHLS-HTVHVLPGSLLEKWAGSETMKVNSFHHQAVRTVKAPLMVSARAPDGII 191

Query: 203 FTTESRH*YFVVFFDVVWQP 262
              E+R+  F++   V W P
Sbjct: 192 EAVENRNARFMI--GVQWHP 209


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 622,603,000
Number of Sequences: 1657284
Number of extensions: 13319411
Number of successful extensions: 32456
Number of sequences better than 10.0: 41
Number of HSP's better than 10.0 without gapping: 31319
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 32444
length of database: 575,637,011
effective HSP length: 96
effective length of database: 416,537,747
effective search space used: 39154548218
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).