SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0012
         (588 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_UPI00015B4309 Cluster: PREDICTED: similar to ATP-bindin...   118   1e-25
UniRef50_Q9UG63 Cluster: ATP-binding cassette sub-family F membe...   108   1e-22
UniRef50_Q802V8 Cluster: ATP-binding cassette, sub-family F (GCN...   106   3e-22
UniRef50_Q9FJH6 Cluster: ABC transporter; n=7; Eukaryota|Rep: AB...   101   9e-21
UniRef50_Q5BXN0 Cluster: SJCHGC05385 protein; n=1; Schistosoma j...    96   5e-19
UniRef50_A6QZU7 Cluster: ATP-binding cassette sub-family F membe...    95   1e-18
UniRef50_P40024 Cluster: Probable ATP-dependent transporter YER0...    91   2e-17
UniRef50_Q015J6 Cluster: Non-transporter ABC protein; n=2; Eukar...    87   3e-16
UniRef50_A4S7V5 Cluster: Predicted protein; n=1; Ostreococcus lu...    76   7e-13
UniRef50_Q00UV4 Cluster: Multidrug/pheromone exporter, ABC super...    75   1e-12
UniRef50_Q5KAU0 Cluster: Regulation of translational elongation-...    67   2e-10
UniRef50_Q9M1H3 Cluster: ABC transporter-like protein; n=15; Mag...    66   4e-10
UniRef50_Q3YB25 Cluster: ABC transporter ABCF1; n=2; Arthropoda|...    66   8e-10
UniRef50_Q4SB38 Cluster: Chromosome undetermined SCAF14677, whol...    65   1e-09
UniRef50_P43535 Cluster: Protein GCN20; n=27; Ascomycota|Rep: Pr...    65   1e-09
UniRef50_Q4TGK5 Cluster: Chromosome undetermined SCAF3640, whole...    63   5e-09
UniRef50_A3ACW9 Cluster: Putative uncharacterized protein; n=1; ...    63   5e-09
UniRef50_Q9NUQ8 Cluster: ATP-binding cassette sub-family F membe...    62   1e-08
UniRef50_Q00V30 Cluster: ENSANGP00000010790; n=2; Ostreococcus|R...    61   2e-08
UniRef50_Q54MF1 Cluster: Non-transporter ABC protein; n=2; Dicty...    61   2e-08
UniRef50_Q9USH9 Cluster: Ribosome biogenesis ATPase, Arb family;...    61   2e-08
UniRef50_Q4P7Y9 Cluster: Putative uncharacterized protein; n=1; ...    60   3e-08
UniRef50_Q8NE71 Cluster: ATP-binding cassette sub-family F membe...    60   5e-08
UniRef50_A4RV42 Cluster: Predicted protein; n=1; Ostreococcus lu...    59   7e-08
UniRef50_UPI0000499068 Cluster: non-transporter ABC protein; n=3...    59   9e-08
UniRef50_Q4Q4I8 Cluster: ATP-binding cassette protein, putative;...    58   1e-07
UniRef50_Q4FAB6 Cluster: ATP-binding cassette sub-family F membe...    58   2e-07
UniRef50_Q5CJV9 Cluster: ABC transporter-like protein; n=3; Cryp...    57   3e-07
UniRef50_Q7YR37 Cluster: ATP-binding cassette sub-family F membe...    57   3e-07
UniRef50_Q26026 Cluster: Elongation factor 3 related protein; n=...    56   5e-07
UniRef50_UPI000049993C Cluster: non-transporter ABC protein; n=1...    55   1e-06
UniRef50_Q22KG9 Cluster: ABC transporter family protein; n=5; Ol...    54   2e-06
UniRef50_Q8H0V6 Cluster: GCN20-type ATP-binding cassette protein...    53   4e-06
UniRef50_Q2UG40 Cluster: RIB40 genomic DNA, SC023; n=2; Pezizomy...    52   8e-06
UniRef50_Q8W1S2 Cluster: ABC transporter-like protein; n=5; Magn...    52   1e-05
UniRef50_Q8SRV5 Cluster: BELONGS TO THE ABC TRANSPORTER SUPERFAM...    50   5e-05
UniRef50_Q9N6L4 Cluster: ABC transporter protein, putative; n=6;...    49   9e-05
UniRef50_Q4PCL5 Cluster: Putative uncharacterized protein; n=1; ...    49   9e-05
UniRef50_Q20306 Cluster: Putative uncharacterized protein; n=2; ...    48   1e-04
UniRef50_O14134 Cluster: mRNA export factor elf1; n=1; Schizosac...    48   1e-04
UniRef50_Q0U533 Cluster: Putative uncharacterized protein; n=1; ...    48   2e-04
UniRef50_Q00VE5 Cluster: Peptide exporter, ABC superfamily; n=2;...    48   2e-04
UniRef50_A4RKM7 Cluster: Putative uncharacterized protein; n=4; ...    47   3e-04
UniRef50_A2R321 Cluster: Similarity to ABC transporters; n=1; As...    47   4e-04
UniRef50_Q015Q4 Cluster: ABC transporter protein 1; n=2; Ostreoc...    46   5e-04
UniRef50_Q8T6B4 Cluster: Non-transporter ABC protein AbcF4; n=3;...    46   5e-04
UniRef50_A2R4X2 Cluster: Function: the translational elongation ...    46   5e-04
UniRef50_A3U5B5 Cluster: ABC transporter ATP-binding protein; n=...    46   7e-04
UniRef50_Q1MRG4 Cluster: ATPase components of ABC transporters w...    46   9e-04
UniRef50_Q5KQ02 Cluster: MRNA export factor elf1, putative; n=2;...    45   0.001
UniRef50_A6QXS0 Cluster: Putative uncharacterized protein; n=1; ...    45   0.001
UniRef50_P44808 Cluster: Uncharacterized ABC transporter ATP-bin...    45   0.002
UniRef50_Q1H8S1 Cluster: Putative ABC transporter; n=1; Chenopod...    44   0.002
UniRef50_A7SEN5 Cluster: Predicted protein; n=1; Nematostella ve...    44   0.002
UniRef50_P53978 Cluster: Elongation factor 3B; n=25; Ascomycota|...    44   0.002
UniRef50_Q66093 Cluster: Translation elongation factor-3; n=8; r...    44   0.003
UniRef50_Q01BZ9 Cluster: ABC transporter family protein; n=1; Os...    44   0.003
UniRef50_Q7QWE0 Cluster: GLP_336_33150_35495; n=1; Giardia lambl...    44   0.003
UniRef50_Q6MCG4 Cluster: Putative uncharacterized protein; n=1; ...    43   0.005
UniRef50_Q0RX60 Cluster: ABC sugar transporter, ATP-binding comp...    43   0.005
UniRef50_A6NZJ2 Cluster: Putative uncharacterized protein; n=1; ...    43   0.005
UniRef50_A0L0D5 Cluster: ABC transporter related; n=20; Alteromo...    43   0.005
UniRef50_Q93ZN6 Cluster: AT5g64840/MXK3_6; n=10; cellular organi...    43   0.005
UniRef50_Q01DK5 Cluster: Protein containing adaptin N-terminal r...    43   0.005
UniRef50_Q8G7G7 Cluster: ATP binding protein of ABC transporter;...    43   0.006
UniRef50_Q0RZ01 Cluster: Monosaccharide-transporting ATPase; n=1...    43   0.006
UniRef50_A4TWA3 Cluster: ABC-type multidrug transport system, AT...    43   0.006
UniRef50_Q45W09 Cluster: Putative ATP-binding cassette protein; ...    43   0.006
UniRef50_Q02151 Cluster: Uncharacterized ABC transporter ATP-bin...    43   0.006
UniRef50_Q899L1 Cluster: ABC-type multidrug transport system; n=...    42   0.008
UniRef50_Q83GA5 Cluster: ABC transporter ATP-binding protein; n=...    42   0.008
UniRef50_Q5FPN2 Cluster: ABC transporter ATP-binding protein; n=...    42   0.008
UniRef50_Q9RDZ5 Cluster: Wzt protein; n=5; Legionella pneumophil...    42   0.008
UniRef50_Q0RU62 Cluster: High-affinity D-ribose transport protei...    42   0.008
UniRef50_A0ZZW2 Cluster: ATP binding protein of ABC transporter;...    42   0.008
UniRef50_UPI0000498F17 Cluster: beta-galactosidase; n=3; Eukaryo...    42   0.011
UniRef50_Q7MZW6 Cluster: Similarities with ABC-type transport pr...    42   0.011
UniRef50_Q48635 Cluster: NisF protein; n=3; Streptococcaceae|Rep...    42   0.011
UniRef50_Q1F0D9 Cluster: Iron ABC transporter, ATP-binding prote...    42   0.011
UniRef50_A0V1J8 Cluster: ABC transporter related; n=1; Clostridi...    42   0.011
UniRef50_A0JVY1 Cluster: ABC transporter related precursor; n=1;...    42   0.011
UniRef50_A1D1C9 Cluster: ABC transporter, putative; n=6; Trichoc...    42   0.011
UniRef50_Q5N1U4 Cluster: ABC-type manganese transport system ATP...    42   0.014
UniRef50_Q3K8V2 Cluster: ABC transporter-like; n=2; Bacteria|Rep...    42   0.014
UniRef50_Q03J68 Cluster: ABC-type molybdenum transport system, A...    42   0.014
UniRef50_A7B2V3 Cluster: Putative uncharacterized protein; n=1; ...    42   0.014
UniRef50_A2W9Y9 Cluster: ATPase component of ABC transporter; n=...    42   0.014
UniRef50_A7PL10 Cluster: Chromosome chr7 scaffold_20, whole geno...    42   0.014
UniRef50_A7S693 Cluster: Predicted protein; n=3; Nematostella ve...    42   0.014
UniRef50_P25997 Cluster: Elongation factor 3; n=21; Ascomycota|R...    42   0.014
UniRef50_Q7U496 Cluster: ABC transporter, ATP binding component;...    41   0.019
UniRef50_Q140N0 Cluster: ABC branched chain amino acid family tr...    41   0.019
UniRef50_A6PEV0 Cluster: ABC transporter related; n=1; Shewanell...    41   0.019
UniRef50_A2VBJ9 Cluster: Non-ribosomal peptide synthetase; n=1; ...    41   0.019
UniRef50_A1RG94 Cluster: ABC transporter, transmembrane region, ...    41   0.019
UniRef50_Q01BE6 Cluster: ABC transporter family protein; n=2; Os...    41   0.019
UniRef50_Q08972 Cluster: [NU+] prion formation protein 1; n=16; ...    41   0.019
UniRef50_Q7VHQ0 Cluster: ABC transport system; n=25; Epsilonprot...    41   0.025
UniRef50_O83157 Cluster: Amino acid ABC transporter, ATP-binding...    41   0.025
UniRef50_Q2PY73 Cluster: ABC transporter ATP-binding protein; n=...    41   0.025
UniRef50_A5G6M6 Cluster: ABC transporter related; n=3; Geobacter...    41   0.025
UniRef50_A4VSC8 Cluster: ABC-type multidrug transport system, AT...    41   0.025
UniRef50_A0VU39 Cluster: ABC transporter related; n=1; Dinoroseo...    41   0.025
UniRef50_Q5KIM6 Cluster: Elongation factor 3; n=3; Basidiomycota...    41   0.025
UniRef50_P63390 Cluster: Uncharacterized ABC transporter ATP-bin...    41   0.025
UniRef50_UPI0000DAFA73 Cluster: protein YabJ; n=1; Campylobacter...    40   0.033
UniRef50_Q8YBT8 Cluster: NITRATE TRANSPORT ATP-BINDING PROTEIN N...    40   0.033
UniRef50_Q73MV4 Cluster: ABC transporter, ATP-binding protein; n...    40   0.033
UniRef50_Q1NTN9 Cluster: ABC transporter related; n=2; delta pro...    40   0.033
UniRef50_A6VQ22 Cluster: ABC transporter related; n=2; Pasteurel...    40   0.033
UniRef50_A4TCW4 Cluster: ABC transporter related; n=1; Mycobacte...    40   0.033
UniRef50_A1A0N6 Cluster: ABC transporter; n=1; Bifidobacterium a...    40   0.033
UniRef50_A1WXT0 Cluster: Zinc import ATP-binding protein znuC; n...    40   0.033
UniRef50_P48334 Cluster: Probable ABC transporter ATP-binding pr...    40   0.033
UniRef50_P36028 Cluster: ABC transporter NFT1; n=5; Eukaryota|Re...    40   0.033
UniRef50_Q97RU9 Cluster: ABC transporter, ATP-binding protein; n...    40   0.043
UniRef50_Q8YP88 Cluster: ATP-binding protein of ABC transporter;...    40   0.043
UniRef50_Q7NTS2 Cluster: Probable cystine transport ATP-binding ...    40   0.043
UniRef50_Q749P0 Cluster: ABC transporter, ATP-binding protein; n...    40   0.043
UniRef50_Q6MHH8 Cluster: ABC transporter, ATP-binding protein; n...    40   0.043
UniRef50_Q5P0U5 Cluster: ABC efflux transporter, permease/ATP-bi...    40   0.043
UniRef50_A7HJ39 Cluster: ABC transporter related; n=6; Bacteria|...    40   0.043
UniRef50_A6DPZ9 Cluster: ABC transporter ATP-binding protein; n=...    40   0.043
UniRef50_A5TSC3 Cluster: ABC superfamily ATP binding cassette tr...    40   0.043
UniRef50_A5MTT3 Cluster: ABC transporter, ATP-binding protein; n...    40   0.043
UniRef50_A0YTM3 Cluster: ABC transporter-like protein; n=1; Lyng...    40   0.043
UniRef50_Q2FN01 Cluster: ABC transporter related; n=1; Methanosp...    40   0.043
UniRef50_P15031 Cluster: Iron(III) dicitrate transport ATP-bindi...    40   0.043
UniRef50_Q8YTX9 Cluster: ATP-binding protein of ferrichrome ABC ...    40   0.057
UniRef50_Q6ART0 Cluster: Probable Fe(III) ABC transporter, ATP-b...    40   0.057
UniRef50_Q31GF4 Cluster: ABC transporter ATP-binding protein hom...    40   0.057
UniRef50_Q2LUX6 Cluster: ABC transporter ATP-binding protein; n=...    40   0.057
UniRef50_O51684 Cluster: ABC transporter, ATP-binding protein; n...    40   0.057
UniRef50_Q24QN1 Cluster: Putative uncharacterized protein; n=1; ...    40   0.057
UniRef50_Q1FH41 Cluster: ABC transporter related; n=1; Clostridi...    40   0.057
UniRef50_Q0LHV4 Cluster: ABC transporter related; n=1; Herpetosi...    40   0.057
UniRef50_A4EER1 Cluster: Iron ABC transporter, ATP-binding prote...    40   0.057
UniRef50_A1IG86 Cluster: ATPase; n=4; Vibrionaceae|Rep: ATPase -...    40   0.057
UniRef50_A0Q5B6 Cluster: (Putative) drug resistance ATPase-1 (Dr...    40   0.057
UniRef50_Q5T3U5 Cluster: Multidrug resistance-associated protein...    40   0.057
UniRef50_Q7WEH6 Cluster: Hemin import ATP-binding protein hmuV; ...    40   0.057
UniRef50_Q9KGC5 Cluster: ABC transporter; n=4; Firmicutes|Rep: A...    39   0.075
UniRef50_Q8CP91 Cluster: ABC transporter protein; n=1; Staphyloc...    39   0.075
UniRef50_Q67QH3 Cluster: ABC transporter ATP-binding protein; n=...    39   0.075
UniRef50_Q5FS63 Cluster: Ferrichrome ABC transporter ATP-binding...    39   0.075
UniRef50_Q8KVZ2 Cluster: RC198; n=1; Ruegeria sp. PR1b|Rep: RC19...    39   0.075
UniRef50_Q8GEG0 Cluster: Putative uncharacterized protein; n=1; ...    39   0.075
UniRef50_Q47336 Cluster: LacZ-alpha peptide; n=2; cellular organ...    39   0.075
UniRef50_Q1QTW7 Cluster: ABC transporter related; n=2; Oceanospi...    39   0.075
UniRef50_Q18YK1 Cluster: ABC transporter related; n=2; Desulfito...    39   0.075
UniRef50_Q0STW8 Cluster: Iron compound ABC transporter, ATP-bind...    39   0.075
UniRef50_Q0AZU0 Cluster: ABC-type sugar (Aldose) transport syste...    39   0.075
UniRef50_A7IE56 Cluster: ABC transporter related precursor; n=7;...    39   0.075
UniRef50_A5Y460 Cluster: Mel; n=19; Bacteria|Rep: Mel - Acinetob...    39   0.075
UniRef50_A3VGA6 Cluster: Ribose ABC transporter, ATP-binding pro...    39   0.075
UniRef50_A1SIE5 Cluster: ABC transporter related precursor; n=1;...    39   0.075
UniRef50_A0RRP7 Cluster: Ferrichrome transport ATP-binding prote...    39   0.075
UniRef50_Q37953 Cluster: LacZ protein; n=1; Phage M13mp18|Rep: L...    39   0.075
UniRef50_P57445 Cluster: ABC transporter ATP-binding protein uup...    39   0.075
UniRef50_P00722 Cluster: Beta-galactosidase; n=35; root|Rep: Bet...    39   0.075
UniRef50_Q8RF38 Cluster: Hemin transport system ATP-binding prot...    39   0.100
UniRef50_Q8A8C5 Cluster: ABC transporter ATP-binding protein; n=...    39   0.100
UniRef50_Q45593 Cluster: YydI protein; n=13; Bacillales|Rep: Yyd...    39   0.100
UniRef50_Q39ML3 Cluster: ABC transporter, duplicated ATPase doma...    39   0.100
UniRef50_Q2RW13 Cluster: ABC transporter component; n=1; Rhodosp...    39   0.100
UniRef50_Q26HC0 Cluster: ABC transporter, ATP binding component;...    39   0.100
UniRef50_A6ULC5 Cluster: ABC transporter related; n=1; Sinorhizo...    39   0.100
UniRef50_A6EDK3 Cluster: ABC transporter ATP-binding protein; n=...    39   0.100
UniRef50_A6EA96 Cluster: Putative ABC transporter ATP-binding pr...    39   0.100
UniRef50_A3TJ17 Cluster: Putative ABC transporter ATP-binding pr...    39   0.100
UniRef50_A1G3R5 Cluster: ABC transporter related; n=2; Salinispo...    39   0.100
UniRef50_Q8GU66 Cluster: MRP-like ABC transporter; n=2; Oryza sa...    39   0.100
UniRef50_Q6GYA9 Cluster: ABCF-type protein; n=4; cellular organi...    39   0.100
UniRef50_Q24809 Cluster: P-glycoprotein 6; n=3; Entamoeba histol...    39   0.100
UniRef50_A4QWE4 Cluster: Putative uncharacterized protein; n=1; ...    39   0.100
UniRef50_Q0PAB6 Cluster: Methionine import ATP-binding protein m...    39   0.100
UniRef50_Q9HT70 Cluster: Methionine import ATP-binding protein m...    39   0.100
UniRef50_UPI00015BE7EC Cluster: UPI00015BE7EC related cluster; n...    38   0.13 
UniRef50_Q8GH71 Cluster: MtsC; n=2; Lactobacillus|Rep: MtsC - La...    38   0.13 
UniRef50_Q7UMP5 Cluster: ABC transporter ATP binding protein; n=...    38   0.13 
UniRef50_Q5L3A4 Cluster: ABC transporter; n=1; Geobacillus kaust...    38   0.13 
UniRef50_Q2RMD1 Cluster: ABC transporter related; n=1; Moorella ...    38   0.13 
UniRef50_Q4HDR6 Cluster: Iron (III) ABC transporter, ATP-binding...    38   0.13 
UniRef50_Q2IRS5 Cluster: ABC transporter related; n=3; Proteobac...    38   0.13 
UniRef50_Q1VK95 Cluster: Branched-chain amino acid ABC transport...    38   0.13 
UniRef50_A6GU25 Cluster: ABC transporter related protein; n=1; L...    38   0.13 
UniRef50_A5TVU5 Cluster: Cation ABC superfamily ATP binding cass...    38   0.13 
UniRef50_A1T072 Cluster: ABC transporter for cysteine ATP-bindin...    38   0.13 
UniRef50_A7SSK8 Cluster: Predicted protein; n=6; Nematostella ve...    38   0.13 
UniRef50_Q8SR22 Cluster: ABC TRANSPORTER; n=1; Encephalitozoon c...    38   0.13 
UniRef50_Q7Z991 Cluster: CCR4-Not complex subunit Caf16; n=3; Di...    38   0.13 
UniRef50_Q6BJS4 Cluster: Similar to tr|Q8H0V6 Arabidopsis thalia...    38   0.13 
UniRef50_Q06034 Cluster: Multidrug resistance protein 1; n=8; Le...    38   0.13 
UniRef50_Q9KNX2 Cluster: ABC transporter, ATP-binding protein; n...    38   0.17 
UniRef50_Q929U5 Cluster: Lin2179 protein; n=44; Bacilli|Rep: Lin...    38   0.17 
UniRef50_Q8A7I1 Cluster: Putative ABC transporter ATP-binding pr...    38   0.17 
UniRef50_Q6MAV3 Cluster: Putative tylosin resistance protein; n=...    38   0.17 
UniRef50_Q6MA69 Cluster: Probable zinc ABC transporter ATP-bindi...    38   0.17 
UniRef50_Q6G1Y4 Cluster: ABC transporter, ATP-binding protein; n...    38   0.17 
UniRef50_Q6ANU8 Cluster: Related to ABC transporter, ATP-binding...    38   0.17 
UniRef50_Q31NM2 Cluster: ATPase; n=2; Synechococcus elongatus|Re...    38   0.17 
UniRef50_Q3Y302 Cluster: ABC transporter; n=1; Enterococcus faec...    38   0.17 
UniRef50_Q1EMI3 Cluster: Putative ABC-type transport system, ATP...    38   0.17 
UniRef50_Q11CV0 Cluster: ABC transporter related; n=13; Alphapro...    38   0.17 
UniRef50_Q0HTC9 Cluster: ABC transporter related; n=50; Proteoba...    38   0.17 
UniRef50_Q0AUT2 Cluster: Putative uncharacterized protein; n=1; ...    38   0.17 
UniRef50_A7HFR8 Cluster: ABC transporter related; n=4; Cystobact...    38   0.17 
UniRef50_A6GTJ2 Cluster: Phosphonate ABC transporter PhnC, ATP-b...    38   0.17 
UniRef50_A5IRS0 Cluster: ABC transporter related; n=12; Staphylo...    38   0.17 
UniRef50_A5G419 Cluster: ABC transporter related; n=1; Geobacter...    38   0.17 
UniRef50_A4NWK5 Cluster: Probable amino-acid ABC transporter ATP...    38   0.17 
UniRef50_A3X9H3 Cluster: ABC ferric siderophore transporter, ATP...    38   0.17 
UniRef50_A3K6R5 Cluster: Spermidine/putrescine ABC transporter, ...    38   0.17 
UniRef50_A3DG94 Cluster: ABC transporter related protein; n=1; C...    38   0.17 
UniRef50_A1WJA0 Cluster: ABC transporter related; n=4; Proteobac...    38   0.17 
UniRef50_A0RLZ5 Cluster: Ferric cations import ATP-binding prote...    38   0.17 
UniRef50_A2WUM4 Cluster: Putative uncharacterized protein; n=2; ...    38   0.17 
UniRef50_Q5CXX8 Cluster: ABC ATpase (2 ABC domains) with 10 tran...    38   0.17 
UniRef50_A7SC94 Cluster: Predicted protein; n=2; Nematostella ve...    38   0.17 
UniRef50_A7RVD2 Cluster: Predicted protein; n=3; Nematostella ve...    38   0.17 
UniRef50_Q2GMU1 Cluster: Putative uncharacterized protein; n=1; ...    38   0.17 
UniRef50_Q3AXX4 Cluster: Phosphate import ATP-binding protein ps...    38   0.17 
UniRef50_Q98EP4 Cluster: Sugar ABC transportor, ATP-binding prot...    38   0.23 
UniRef50_Q8EYQ7 Cluster: ABC transporter ATP-binding protein; n=...    38   0.23 
UniRef50_Q8ET71 Cluster: ABC transporter ATP-binding protein; n=...    38   0.23 
UniRef50_Q83LS4 Cluster: ATP-binding component of putrescine tra...    38   0.23 
UniRef50_Q7VBA1 Cluster: ATPase components of ABC transporters, ...    38   0.23 
UniRef50_Q74KW2 Cluster: ABC transporter ATPase and permease com...    38   0.23 
UniRef50_Q73MU0 Cluster: ABC transporter, ATP-binding protein; n...    38   0.23 
UniRef50_Q6NJW1 Cluster: Putative ABC transport system ATP-bindi...    38   0.23 
UniRef50_Q6LHH9 Cluster: Hypothetical ATP-binding protein ofiron...    38   0.23 
UniRef50_Q64NR2 Cluster: Putative ABC transporter ATP-binding pr...    38   0.23 
UniRef50_Q47S93 Cluster: ABC transporter, ATP-binding protein pr...    38   0.23 
UniRef50_P72884 Cluster: ABC transporter; n=3; Bacteria|Rep: ABC...    38   0.23 
UniRef50_O54119 Cluster: ABC-transporter ATP-binding protein; n=...    38   0.23 
UniRef50_Q8GDS4 Cluster: ABC transporter ATP-binding protein Uup...    38   0.23 
UniRef50_Q8GAL3 Cluster: Putative ATP binding component of ABC t...    38   0.23 
UniRef50_Q4HQ94 Cluster: Hemin ABC transporter, ATP-binding prot...    38   0.23 
UniRef50_Q44477 Cluster: Orf1; n=1; Azotobacter vinelandii|Rep: ...    38   0.23 
UniRef50_Q41F48 Cluster: IMP dehydrogenase/GMP reductase:ABC tra...    38   0.23 
UniRef50_Q11M34 Cluster: ABC transporter related; n=1; Mesorhizo...    38   0.23 
UniRef50_Q08QR0 Cluster: Abc transporter ATP-binding protein; n=...    38   0.23 
UniRef50_Q04G57 Cluster: ABC-type cobalt transport system, ATPas...    38   0.23 
UniRef50_A7I2P4 Cluster: Methionine import ATP-binding protein M...    38   0.23 
UniRef50_A7HTD4 Cluster: Spermidine/putrescine ABC transporter A...    38   0.23 
UniRef50_A7HCQ9 Cluster: ABC transporter related; n=2; Proteobac...    38   0.23 
UniRef50_A7B848 Cluster: Putative uncharacterized protein; n=1; ...    38   0.23 
UniRef50_A6TKG7 Cluster: ABC transporter related; n=1; Alkaliphi...    38   0.23 
UniRef50_A6G9D3 Cluster: ABC transporter-related protein; n=1; P...    38   0.23 
UniRef50_A6CBU7 Cluster: ABC transporter, ATP-binding protein; n...    38   0.23 
UniRef50_A6BFH1 Cluster: Putative uncharacterized protein; n=2; ...    38   0.23 
UniRef50_A4X2X7 Cluster: ABC transporter related; n=3; Actinomyc...    38   0.23 
UniRef50_A4VZ04 Cluster: ABC-type multidrug transport system, AT...    38   0.23 
UniRef50_A4M7U0 Cluster: ABC transporter related precursor; n=1;...    38   0.23 
UniRef50_A4IP40 Cluster: ABC transporter ATP-binding protein; n=...    38   0.23 
UniRef50_A3I8Q3 Cluster: ABC transporter; n=1; Bacillus sp. B149...    38   0.23 
UniRef50_A3I7H2 Cluster: ABC transporter; n=1; Bacillus sp. B149...    38   0.23 
UniRef50_A3DI70 Cluster: ABC transporter related protein; n=1; C...    38   0.23 
UniRef50_A0K129 Cluster: ABC transporter related; n=1; Arthrobac...    38   0.23 
UniRef50_Q7YZ42 Cluster: ATP-binding cassette transporter; n=5; ...    38   0.23 
UniRef50_P31134 Cluster: Putrescine transport ATP-binding protei...    38   0.23 
UniRef50_Q9I1C8 Cluster: Methionine import ATP-binding protein m...    38   0.23 
UniRef50_UPI0000F5173B Cluster: hypothetical protein Faci_030009...    37   0.30 
UniRef50_Q9KRY4 Cluster: ABC transporter, ATP-binding protein; n...    37   0.30 
UniRef50_Q8R7P9 Cluster: ABC-type multidrug/protein/lipid transp...    37   0.30 
UniRef50_Q8ET36 Cluster: ABC transporter ATP-binding protein; n=...    37   0.30 
UniRef50_Q6G2J0 Cluster: ABC transporter, ATP-binding protein; n...    37   0.30 
UniRef50_Q65S42 Cluster: MglA protein; n=5; Pasteurellaceae|Rep:...    37   0.30 
UniRef50_Q65EZ3 Cluster: MntB; n=2; Bacillaceae|Rep: MntB - Baci...    37   0.30 
UniRef50_Q5NRB9 Cluster: ABC transporter; n=8; Sphingomonadales|...    37   0.30 
UniRef50_Q3M2C1 Cluster: ABC transporter-like; n=1; Anabaena var...    37   0.30 
UniRef50_Q2S314 Cluster: Hemin ABC transporter, ATP-binding prot...    37   0.30 
UniRef50_Q41CK5 Cluster: ABC transporter related; n=1; Exiguobac...    37   0.30 
UniRef50_Q1IKX0 Cluster: ABC transporter, ATPase subunit; n=6; B...    37   0.30 
UniRef50_Q1IHR4 Cluster: ABC transporter, ATPase subunit; n=38; ...    37   0.30 
UniRef50_Q1FLB9 Cluster: ABC transporter related; n=1; Clostridi...    37   0.30 
UniRef50_Q1EYK4 Cluster: ABC transporter related; n=1; Clostridi...    37   0.30 
UniRef50_Q11GL6 Cluster: ABC transporter related; n=1; Mesorhizo...    37   0.30 
UniRef50_Q0SUV1 Cluster: Iron(III) dicitrate transport permease-...    37   0.30 
UniRef50_Q03DG5 Cluster: ABC-type multidrug transport system, AT...    37   0.30 
UniRef50_A7A4P9 Cluster: Putative uncharacterized protein; n=1; ...    37   0.30 
UniRef50_A6Y0X3 Cluster: ABC-type multidrug transport system, AT...    37   0.30 
UniRef50_A6W158 Cluster: ABC transporter related; n=12; Proteoba...    37   0.30 
UniRef50_A6LX63 Cluster: ABC transporter related precursor; n=3;...    37   0.30 
UniRef50_A6CJR7 Cluster: ABC transporter; n=1; Bacillus sp. SG-1...    37   0.30 
UniRef50_A5LZE4 Cluster: ABC-type antimicrobial peptide transpor...    37   0.30 
UniRef50_A5CXW0 Cluster: Zinc ABC transporter ATP-binding protei...    37   0.30 
UniRef50_A4M5K6 Cluster: ABC transporter related; n=1; Petrotoga...    37   0.30 
UniRef50_A4S010 Cluster: Predicted protein; n=1; Ostreococcus lu...    37   0.30 
UniRef50_Q584D6 Cluster: Multidrug resistance-associated protein...    37   0.30 
UniRef50_Q4Z0C1 Cluster: Putative uncharacterized protein; n=3; ...    37   0.30 
UniRef50_Q9RZK6 Cluster: Iron ABC transporter, ATP-binding prote...    37   0.40 
UniRef50_Q9KAL7 Cluster: ABC transporter; n=2; Bacillus|Rep: ABC...    37   0.40 
UniRef50_Q8ESE1 Cluster: Erythromycin resistance protein; n=2; B...    37   0.40 
UniRef50_Q74LW0 Cluster: ABC transporter ATPase component; n=2; ...    37   0.40 
UniRef50_Q6NIY8 Cluster: Iron-related transport system ATP-bindi...    37   0.40 
UniRef50_Q6LJW5 Cluster: Hypothetical ABC transporter, ATP-bindi...    37   0.40 
UniRef50_Q2SKE9 Cluster: ABC-type multidrug transport system, AT...    37   0.40 
UniRef50_Q2JQ87 Cluster: ABC transporter, ATP-binding protein; n...    37   0.40 
UniRef50_Q6W1Z1 Cluster: Branched-chain amino acid transport ATP...    37   0.40 
UniRef50_Q2MF75 Cluster: Transport protein; n=8; Bacteria|Rep: T...    37   0.40 
UniRef50_Q1GCE8 Cluster: Iron compound ABC transporter; ATP-bind...    37   0.40 
UniRef50_Q04QD1 Cluster: ATP-binding protein of an ABC transport...    37   0.40 
UniRef50_Q04PB0 Cluster: Permease and ATP-binding protein of an ...    37   0.40 
UniRef50_A7GAV7 Cluster: ABC transporter, ATP-binding protein; n...    37   0.40 
UniRef50_A7BEJ2 Cluster: Putative uncharacterized protein; n=1; ...    37   0.40 
UniRef50_A7B5D4 Cluster: Putative uncharacterized protein; n=1; ...    37   0.40 
UniRef50_A5Z9P9 Cluster: Putative uncharacterized protein; n=2; ...    37   0.40 
UniRef50_A5I143 Cluster: ABC transporter, ATP-binding protein; n...    37   0.40 
UniRef50_A4J9J1 Cluster: ABC transporter related; n=3; Clostridi...    37   0.40 
UniRef50_A1FW35 Cluster: ABC transporter related; n=1; Stenotrop...    37   0.40 
UniRef50_Q7RAN7 Cluster: ABC transporter, putative; n=1; Plasmod...    37   0.40 
UniRef50_A7SFS6 Cluster: Predicted protein; n=2; Nematostella ve...    37   0.40 
UniRef50_A7RMU2 Cluster: Predicted protein; n=1; Nematostella ve...    37   0.40 
UniRef50_A2F672 Cluster: ABC transporter family protein; n=1; Tr...    37   0.40 
UniRef50_Q4WV21 Cluster: ABC transporter, putative; n=3; Trichoc...    37   0.40 
UniRef50_Q4PBE5 Cluster: Putative uncharacterized protein; n=1; ...    37   0.40 
UniRef50_Q2GQD2 Cluster: Putative uncharacterized protein; n=1; ...    37   0.40 
UniRef50_Q0W3S4 Cluster: Putative ABC-type cobalt import system,...    37   0.40 
UniRef50_A0B6B3 Cluster: ABC transporter related; n=1; Methanosa...    37   0.40 
UniRef50_Q8ELA5 Cluster: Methionine import ATP-binding protein m...    37   0.40 
UniRef50_Q9LHK4 Cluster: Putative multidrug resistance protein 2...    37   0.40 
UniRef50_P07821 Cluster: Ferrichrome transport ATP-binding prote...    37   0.40 
UniRef50_UPI00015B53B9 Cluster: PREDICTED: similar to CG4562-PA;...    36   0.53 
UniRef50_UPI00006DBD6A Cluster: COG1129: ABC-type sugar transpor...    36   0.53 
UniRef50_UPI0000383731 Cluster: COG1120: ABC-type cobalamin/Fe3+...    36   0.53 
UniRef50_Q9CMF2 Cluster: Uup1; n=23; Proteobacteria|Rep: Uup1 - ...    36   0.53 
UniRef50_Q98J20 Cluster: ATP-binding protein of ribose ABC trans...    36   0.53 
UniRef50_Q97QY0 Cluster: ABC transporter, ATP-binding protein; n...    36   0.53 
UniRef50_Q893X2 Cluster: ABC transporter ATP-binding protein; n=...    36   0.53 
UniRef50_Q7NR85 Cluster: Ferric citrate transport system ATP-bin...    36   0.53 
UniRef50_Q74H00 Cluster: ABC transporter, ATP-binding/permease p...    36   0.53 
UniRef50_Q6N7R6 Cluster: ABC transporter, with duplicated ATPase...    36   0.53 
UniRef50_Q6MP69 Cluster: ABC transporter ATP-binding protein; n=...    36   0.53 
UniRef50_Q6APJ5 Cluster: Related to ABC transporter, ATP-binding...    36   0.53 
UniRef50_Q30UI1 Cluster: ABC transporter-related protein; n=1; T...    36   0.53 
UniRef50_Q2YAN5 Cluster: ABC transporter related; n=1; Nitrososp...    36   0.53 
UniRef50_Q4AI44 Cluster: ABC transporter; n=1; Chlorobium phaeob...    36   0.53 
UniRef50_Q1M9H9 Cluster: Putative branched-chain amino acid ABC ...    36   0.53 
UniRef50_Q1JW61 Cluster: ABC transporter related; n=1; Desulfuro...    36   0.53 
UniRef50_Q18C24 Cluster: ABC transporter, ATP-binding protein; n...    36   0.53 
UniRef50_Q11L32 Cluster: ABC transporter related; n=1; Mesorhizo...    36   0.53 
UniRef50_Q0S0C1 Cluster: Fe(3+) enterobactin transport ATP-bindi...    36   0.53 
UniRef50_Q0LPW5 Cluster: ABC transporter related; n=1; Herpetosi...    36   0.53 
UniRef50_O69156 Cluster: ABC transporter ATP-binding protein hom...    36   0.53 
UniRef50_A6UK59 Cluster: ABC transporter related; n=7; Alphaprot...    36   0.53 
UniRef50_A6TMB3 Cluster: Oligopeptide/dipeptide ABC transporter,...    36   0.53 
UniRef50_A6PV19 Cluster: ABC transporter, fused ATPase subunits;...    36   0.53 
UniRef50_A6DH10 Cluster: ABC transporter, ATPase subunit; n=1; L...    36   0.53 
UniRef50_A4XD44 Cluster: ABC transporter related; n=2; Salinispo...    36   0.53 
UniRef50_A4G7V4 Cluster: High-affinity branched-chain amino acid...    36   0.53 
UniRef50_A4EFI2 Cluster: ABC-type cobalamin/Fe3+-siderophores tr...    36   0.53 
UniRef50_A3K763 Cluster: ABC branched chain amino acid transport...    36   0.53 
UniRef50_A3HVU9 Cluster: ABC transporter ATP-binding protein; n=...    36   0.53 
UniRef50_A3DGE1 Cluster: ABC transporter related protein; n=2; C...    36   0.53 
UniRef50_A2RI58 Cluster: Ferrichrome ABC transporter fhuC; n=2; ...    36   0.53 
UniRef50_A1ZYX6 Cluster: ABC transporter, ATP-binding protein; n...    36   0.53 
UniRef50_A1BID7 Cluster: ABC transporter related; n=3; Bacteroid...    36   0.53 
UniRef50_A0JYW9 Cluster: ABC transporter related; n=1; Arthrobac...    36   0.53 
UniRef50_Q9VC63 Cluster: CG5789-PA; n=5; Diptera|Rep: CG5789-PA ...    36   0.53 
UniRef50_A2G4U7 Cluster: ABC transporter family protein; n=2; Tr...    36   0.53 
UniRef50_Q7M8M4 Cluster: Phosphonates import ATP-binding protein...    36   0.53 
UniRef50_Q6MIP7 Cluster: Phosphonates import ATP-binding protein...    36   0.53 
UniRef50_Q4FS42 Cluster: Lipid A export ATP-binding/permease pro...    36   0.53 
UniRef50_Q6ME20 Cluster: Methionine import ATP-binding protein m...    36   0.53 
UniRef50_Q832Y6 Cluster: Methionine import ATP-binding protein m...    36   0.53 
UniRef50_Q50966 Cluster: Fe(3+) ions import ATP-binding protein ...    36   0.53 
UniRef50_Q9RX40 Cluster: ABC transporter, ATP-binding protein, E...    36   0.70 
UniRef50_Q9FC01 Cluster: Putative branched amino acid transport ...    36   0.70 
UniRef50_Q9CIN1 Cluster: ABC transporter ATP binding protein; n=...    36   0.70 
UniRef50_Q930N6 Cluster: Putative ABC transporter; n=1; Sinorhiz...    36   0.70 
UniRef50_Q8YHY5 Cluster: METAL CHELATE TRANSPORT ATP-BINDING PRO...    36   0.70 
UniRef50_Q895V4 Cluster: Transporter; n=22; Firmicutes|Rep: Tran...    36   0.70 
UniRef50_Q83AE9 Cluster: ABC transporter, ATP-binding protein; n...    36   0.70 
UniRef50_Q74D14 Cluster: ABC transporter, ATP-binding protein; n...    36   0.70 
UniRef50_Q6NJ28 Cluster: Putative iron transport system ATP-bind...    36   0.70 
UniRef50_Q6F0H1 Cluster: Putative multidrug ABC transporter ATP-...    36   0.70 
UniRef50_Q67P05 Cluster: Ferrichrome ABC transporter ATP-binding...    36   0.70 
UniRef50_Q65IP7 Cluster: ExpZ; n=3; Firmicutes|Rep: ExpZ - Bacil...    36   0.70 
UniRef50_Q64RV9 Cluster: Iron(III) ABC transporter ATP-binding p...    36   0.70 
UniRef50_Q5LSD9 Cluster: Branched-chain amino acid ABC transport...    36   0.70 
UniRef50_Q487K2 Cluster: Iron(III) ABC transporter, ATP-binding ...    36   0.70 
UniRef50_Q3AK81 Cluster: ATPase; n=19; Bacteria|Rep: ATPase - Sy...    36   0.70 
UniRef50_Q2NWB1 Cluster: Putative branched-chain amino acid ABC ...    36   0.70 
UniRef50_Q2JHQ8 Cluster: Manganese/zinc/iron chelate ABC ranspor...    36   0.70 
UniRef50_Q2J5Y3 Cluster: ABC transporter related; n=8; Actinomyc...    36   0.70 
UniRef50_Q9RC21 Cluster: MrsT protein; n=1; Bacillus sp. HIL-Y85...    36   0.70 
UniRef50_Q6W2C0 Cluster: Transporter; n=8; Proteobacteria|Rep: T...    36   0.70 
UniRef50_Q2AGK5 Cluster: ABC transporter related; n=1; Halotherm...    36   0.70 
UniRef50_Q1NX97 Cluster: ABC transporter related; n=2; delta pro...    36   0.70 
UniRef50_Q1FM24 Cluster: ABC transporter related; n=2; Clostridi...    36   0.70 
UniRef50_Q1AWX0 Cluster: ABC transporter related; n=1; Rubrobact...    36   0.70 
UniRef50_Q12C20 Cluster: ABC transporter related; n=5; Bacteria|...    36   0.70 
UniRef50_Q0S4S2 Cluster: ABC drug resistance transporter, ATP-bi...    36   0.70 
UniRef50_Q0C461 Cluster: ABC transporter, ATP-binding protein; n...    36   0.70 
UniRef50_Q0A710 Cluster: ABC transporter related; n=1; Alkalilim...    36   0.70 
UniRef50_Q03BW1 Cluster: ABC-type uncharacterized transport syst...    36   0.70 
UniRef50_A7II58 Cluster: ABC transporter CydDC cysteine exporter...    36   0.70 
UniRef50_A6PT15 Cluster: ABC transporter related; n=1; Victivall...    36   0.70 
UniRef50_A6EER2 Cluster: Possible ABC-type molybdenum transporte...    36   0.70 
UniRef50_A5UW48 Cluster: ABC transporter related; n=4; Bacteria|...    36   0.70 
UniRef50_A5TSL2 Cluster: ABC superfamily ATP binding cassette tr...    36   0.70 
UniRef50_A4Z1T9 Cluster: Putative ABC transporter; n=1; Bradyrhi...    36   0.70 
UniRef50_A4TKL8 Cluster: Iron-siderophore transport system, ATP-...    36   0.70 
UniRef50_A4A446 Cluster: Vitamin B12 import ATP-binding protein ...    36   0.70 
UniRef50_A3X9P3 Cluster: ABC spermidine/putrescine transporter, ...    36   0.70 
UniRef50_A3VYA0 Cluster: Spermidine/putrescine ABC transporter, ...    36   0.70 
UniRef50_A2RIL0 Cluster: ABC transporter ATP binding protein; n=...    36   0.70 
UniRef50_A1ZLF7 Cluster: ABC-type multidrug transport system, AT...    36   0.70 
UniRef50_A1TSE7 Cluster: ABC transporter-related protein precurs...    36   0.70 
UniRef50_A1GEA0 Cluster: ABC transporter related; n=2; Salinispo...    36   0.70 
UniRef50_A1A3D4 Cluster: ABC transporter; n=1; Bifidobacterium a...    36   0.70 
UniRef50_A0NXJ9 Cluster: ABC transporter, ATPase subunit; n=1; S...    36   0.70 
UniRef50_A0JU89 Cluster: ABC transporter related; n=25; Actinoba...    36   0.70 
UniRef50_A0HDV9 Cluster: ABC transporter related precursor; n=1;...    36   0.70 
UniRef50_Q7PPR5 Cluster: ENSANGP00000016267; n=1; Anopheles gamb...    36   0.70 
UniRef50_Q16I11 Cluster: ATP-binding cassette transporter; n=3; ...    36   0.70 
UniRef50_A7T029 Cluster: Predicted protein; n=2; Nematostella ve...    36   0.70 
UniRef50_Q0U1T8 Cluster: Putative uncharacterized protein; n=1; ...    36   0.70 
UniRef50_Q8ZUN2 Cluster: Iron (III) ABC transporter ATP-binding ...    36   0.70 
UniRef50_Q5JEZ9 Cluster: ABC-type multidrug transport system, AT...    36   0.70 
UniRef50_A2ST02 Cluster: ABC transporter related; n=1; Methanoco...    36   0.70 
UniRef50_P0A9U5 Cluster: Uncharacterized ABC transporter ATP-bin...    36   0.70 
UniRef50_Q39BJ8 Cluster: Arabinose import ATP-binding protein ar...    36   0.70 
UniRef50_Q9WYV3 Cluster: ABC transporter, ATP-binding protein; n...    36   0.93 
UniRef50_Q9RTW7 Cluster: ABC transporter, ATP-binding protein, E...    36   0.93 
UniRef50_Q97RP6 Cluster: Branched-chain amino acid ABC transport...    36   0.93 
UniRef50_Q8RI16 Cluster: Export ABC transporter; n=4; Fusobacter...    36   0.93 
UniRef50_Q8FP61 Cluster: Putative ABC transporter ATP-binding pr...    36   0.93 
UniRef50_Q89J77 Cluster: ABC transporter; n=9; Bradyrhizobiaceae...    36   0.93 
UniRef50_Q81N68 Cluster: ABC transporter, ATP-binding protein; n...    36   0.93 
UniRef50_Q74I96 Cluster: ABC transporter ATPase component; n=5; ...    36   0.93 
UniRef50_Q6NKE2 Cluster: ABC transport system ATP-binding protei...    36   0.93 
UniRef50_Q6F264 Cluster: Multidrug ABC transporter ATP-binding c...    36   0.93 
UniRef50_Q6A894 Cluster: Dipeptide ABC transporter ATP-binding; ...    36   0.93 
UniRef50_Q67PX5 Cluster: Iron-siderophore uptake ABC system ATP-...    36   0.93 
UniRef50_Q60CL3 Cluster: ABC transporter, ATP-binding family pro...    36   0.93 
UniRef50_Q5FR78 Cluster: ABC transporter ATP-binding protein; n=...    36   0.93 
UniRef50_Q5FNA6 Cluster: Transport ATP-binding protein CydD; n=1...    36   0.93 
UniRef50_Q47PT9 Cluster: ABC-type cobalamin/Fe3+-siderophores tr...    36   0.93 
UniRef50_Q2JGL4 Cluster: ABC transporter related; n=1; Frankia s...    36   0.93 
UniRef50_O34641 Cluster: Transporter; n=3; Bacillus|Rep: Transpo...    36   0.93 
UniRef50_Q8D132 Cluster: ATP-binding component of D-ribose high-...    36   0.93 
UniRef50_Q48868 Cluster: ABC exporter; n=10; Lactobacillus|Rep: ...    36   0.93 
UniRef50_Q3WCR1 Cluster: ABC transporter; n=1; Frankia sp. EAN1p...    36   0.93 
UniRef50_Q3W9H0 Cluster: Inner-membrane translocator:ABC transpo...    36   0.93 
UniRef50_Q1PZJ8 Cluster: Similar to ATP-binding protein, ABC tra...    36   0.93 
UniRef50_Q1IBK0 Cluster: Putative ABC transporter with duplicate...    36   0.93 
UniRef50_Q13RU8 Cluster: ABC branched chain amino acid family tr...    36   0.93 
UniRef50_Q0S975 Cluster: ABC O-antigen transporter, ATP-binding ...    36   0.93 
UniRef50_Q03D01 Cluster: ABC-type multidrug transport system, AT...    36   0.93 
UniRef50_Q033Z3 Cluster: ABC-type sugar transport system, ATPase...    36   0.93 
UniRef50_A7HFY4 Cluster: ABC transporter related precursor; n=1;...    36   0.93 
UniRef50_A6SZR7 Cluster: ATPase components of ABC transporters w...    36   0.93 
UniRef50_A6QBA4 Cluster: ABC transporter, ATP-binding protein; n...    36   0.93 
UniRef50_A6Q6Y0 Cluster: Multidrug ABC transporter; n=2; unclass...    36   0.93 
UniRef50_A6NX36 Cluster: Putative uncharacterized protein; n=2; ...    36   0.93 
UniRef50_A5ZYN8 Cluster: Putative uncharacterized protein; n=1; ...    36   0.93 
UniRef50_A5USN5 Cluster: ABC transporter related; n=5; Chlorofle...    36   0.93 
UniRef50_A5GJ68 Cluster: ABC-type multidrug transport system, AT...    36   0.93 
UniRef50_A5G290 Cluster: ABC transporter related; n=1; Acidiphil...    36   0.93 
UniRef50_A5CZ09 Cluster: ABC-type polysaccharide/polyol phosphat...    36   0.93 
UniRef50_A4IQ09 Cluster: Lantibiotic mersacidin transporter syst...    36   0.93 
UniRef50_A3WNT6 Cluster: Iron ABC transporter, ATP-binding prote...    36   0.93 
UniRef50_A1WTI4 Cluster: ABC transporter related; n=1; Halorhodo...    36   0.93 
UniRef50_A0YJY3 Cluster: ABC transporter; n=1; Lyngbya sp. PCC 8...    36   0.93 
UniRef50_A0UUT0 Cluster: ABC transporter related precursor; n=1;...    36   0.93 
UniRef50_A0T547 Cluster: ABC transporter related; n=1; Burkholde...    36   0.93 
UniRef50_A0QRS2 Cluster: ABC-type transport system ATP-binding p...    36   0.93 
UniRef50_Q4Q3L0 Cluster: ABC transporter family-like protein; n=...    36   0.93 
UniRef50_O01495 Cluster: P-glycoprotein related protein 2; n=5; ...    36   0.93 
UniRef50_Q5KJN9 Cluster: Metal resistance protein ycf1, putative...    36   0.93 
UniRef50_Q2H2U8 Cluster: Putative uncharacterized protein; n=1; ...    36   0.93 
UniRef50_P54591 Cluster: Uncharacterized ABC transporter ATP-bin...    36   0.93 
UniRef50_Q8RBQ1 Cluster: Putative ribose/galactose/methyl galact...    36   0.93 
UniRef50_Q9SYI3 Cluster: Putative multidrug resistance protein 5...    36   0.93 
UniRef50_Q0SIB7 Cluster: Hemin import ATP-binding protein hmuV; ...    36   0.93 
UniRef50_P23878 Cluster: Ferric enterobactin transport ATP-bindi...    36   0.93 
UniRef50_Q98G43 Cluster: Fe(3+) ions import ATP-binding protein ...    36   0.93 
UniRef50_Q03ZL6 Cluster: Cobalt import ATP-binding protein cbiO ...    36   0.93 
UniRef50_UPI0000E488BE Cluster: PREDICTED: hypothetical protein,...    35   1.2  
UniRef50_Q9KFM8 Cluster: Lantibiotic mersacidin transporter syst...    35   1.2  
UniRef50_Q9KBX4 Cluster: Oligopeptide ABC transporter; n=3; Firm...    35   1.2  
UniRef50_Q98JX3 Cluster: ATP-binding protein of polyamine ABC tr...    35   1.2  
UniRef50_Q8FYC8 Cluster: Amino acid ABC transporter, ATP-binding...    35   1.2  
UniRef50_Q89QD8 Cluster: ABC transporter ATP-binding protein; n=...    35   1.2  
UniRef50_Q89E99 Cluster: Bll7188 protein; n=17; Bacteria|Rep: Bl...    35   1.2  
UniRef50_Q89CH4 Cluster: ABC transporter ATP-binding protein; n=...    35   1.2  
UniRef50_Q88T02 Cluster: Amino acid ABC transporter, ATP-binding...    35   1.2  
UniRef50_Q83H10 Cluster: Iron ABC transporter ATP-binding protei...    35   1.2  
UniRef50_Q823U0 Cluster: ABC transporter, ATP-binding protein; n...    35   1.2  
UniRef50_Q81L57 Cluster: Bacitracin ABC transporter, ATP-binding...    35   1.2  
UniRef50_Q7VC54 Cluster: ABC-type molybdenum transport system AT...    35   1.2  
UniRef50_Q6NEW5 Cluster: Putative ABC transport system, ATP-bind...    35   1.2  
UniRef50_Q6GES4 Cluster: ABC transporter ATP-binding protein; n=...    35   1.2  
UniRef50_Q6D8G9 Cluster: ABC transporter, ATP-binding protein; n...    35   1.2  
UniRef50_Q6D3M5 Cluster: ABC transporter, ATP-binding protein; n...    35   1.2  
UniRef50_Q65NK8 Cluster: Putative uncharacterized protein; n=1; ...    35   1.2  
UniRef50_Q5FQN3 Cluster: Amino acid ABC transporter ATP-binding ...    35   1.2  
UniRef50_Q4L7T1 Cluster: Vga protein; n=16; Staphylococcus|Rep: ...    35   1.2  

>UniRef50_UPI00015B4309 Cluster: PREDICTED: similar to ATP-binding
           cassette sub-family F member 2; n=3; Apocrita|Rep:
           PREDICTED: similar to ATP-binding cassette sub-family F
           member 2 - Nasonia vitripennis
          Length = 637

 Score =  118 bits (283), Expect = 1e-25
 Identities = 53/69 (76%), Positives = 62/69 (89%)
 Frame = +2

Query: 251 PCSRDIKIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVPIPE 430
           P SRDIKI+NFS+TF+G EL+QDT+LELNCGRRYGL+GLNG GKS+LL+ L  REVPIP+
Sbjct: 92  PRSRDIKISNFSVTFHGCELMQDTMLELNCGRRYGLLGLNGSGKSTLLSVLGNREVPIPD 151

Query: 431 HIDIFHLTR 457
            IDIFHLTR
Sbjct: 152 AIDIFHLTR 160



 Score = 32.7 bits (71), Expect = 6.5
 Identities = 12/17 (70%), Positives = 16/17 (94%)
 Frame = +3

Query: 204 KMNSEARSCTGSLAVHP 254
           ++N+EAR+CTGSLA HP
Sbjct: 76  RLNAEARACTGSLASHP 92


>UniRef50_Q9UG63 Cluster: ATP-binding cassette sub-family F member
           2; n=57; Eukaryota|Rep: ATP-binding cassette sub-family
           F member 2 - Homo sapiens (Human)
          Length = 623

 Score =  108 bits (259), Expect = 1e-22
 Identities = 49/69 (71%), Positives = 57/69 (82%)
 Frame = +2

Query: 251 PCSRDIKIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVPIPE 430
           P S D+ I N S+TF+G ELL DT LELN GRRYGL+GLNG GKS LL+A+ +REVPIPE
Sbjct: 81  PNSTDVHIINLSLTFHGQELLSDTKLELNSGRRYGLIGLNGIGKSMLLSAIGKREVPIPE 140

Query: 431 HIDIFHLTR 457
           HIDI+HLTR
Sbjct: 141 HIDIYHLTR 149


>UniRef50_Q802V8 Cluster: ATP-binding cassette, sub-family F
           (GCN20), member 2; n=20; Eukaryota|Rep: ATP-binding
           cassette, sub-family F (GCN20), member 2 - Danio rerio
           (Zebrafish) (Brachydanio rerio)
          Length = 613

 Score =  106 bits (255), Expect = 3e-22
 Identities = 48/69 (69%), Positives = 57/69 (82%)
 Frame = +2

Query: 251 PCSRDIKIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVPIPE 430
           P S D+ I++ S+TF+G ELL DT LELN GRRYGL+GLNG GKS LL+A+  REVPIPE
Sbjct: 78  PNSTDVHISSLSLTFHGQELLSDTSLELNSGRRYGLIGLNGTGKSMLLSAISHREVPIPE 137

Query: 431 HIDIFHLTR 457
           HIDI+HLTR
Sbjct: 138 HIDIYHLTR 146


>UniRef50_Q9FJH6 Cluster: ABC transporter; n=7; Eukaryota|Rep: ABC
           transporter - Arabidopsis thaliana (Mouse-ear cress)
          Length = 595

 Score =  101 bits (243), Expect = 9e-21
 Identities = 43/68 (63%), Positives = 59/68 (86%)
 Frame = +2

Query: 251 PCSRDIKIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVPIPE 430
           P SRDI+I + S+TF+G +L+ D++LELN GRRYGL+GLNGCGKS+LL A+ RRE+PIP+
Sbjct: 64  PQSRDIRIESLSVTFHGYDLIVDSMLELNYGRRYGLLGLNGCGKSTLLTAIGRREIPIPD 123

Query: 431 HIDIFHLT 454
            +DI+HL+
Sbjct: 124 QMDIYHLS 131


>UniRef50_Q5BXN0 Cluster: SJCHGC05385 protein; n=1; Schistosoma
           japonicum|Rep: SJCHGC05385 protein - Schistosoma
           japonicum (Blood fluke)
          Length = 196

 Score = 96.3 bits (229), Expect = 5e-19
 Identities = 43/69 (62%), Positives = 53/69 (76%)
 Frame = +2

Query: 251 PCSRDIKIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVPIPE 430
           P +RD++ +N SITF+G  LL DT LELN GRRYGL+G NGCGKS+LLA +   E+P+P 
Sbjct: 105 PQARDVQFSNLSITFHGKALLADTQLELNNGRRYGLIGANGCGKSTLLAVIANGELPVPP 164

Query: 431 HIDIFHLTR 457
           HIDIF L R
Sbjct: 165 HIDIFLLQR 173


>UniRef50_A6QZU7 Cluster: ATP-binding cassette sub-family F member
           2; n=5; Pezizomycotina|Rep: ATP-binding cassette
           sub-family F member 2 - Ajellomyces capsulatus NAm1
          Length = 627

 Score = 95.1 bits (226), Expect = 1e-18
 Identities = 43/75 (57%), Positives = 55/75 (73%)
 Frame = +2

Query: 236 VTGCAPCSRDIKIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRRE 415
           V    P SRD+KI + S+ F+G  L+ DT+LEL  GRRYGL+G NGCGKS+L+ A+ +RE
Sbjct: 85  VLASLPSSRDVKINSASLVFHGRVLITDTILELTYGRRYGLLGENGCGKSTLMKAIDKRE 144

Query: 416 VPIPEHIDIFHLTRG 460
            PIPEHIDI+ L  G
Sbjct: 145 FPIPEHIDIYLLNEG 159


>UniRef50_P40024 Cluster: Probable ATP-dependent transporter
           YER036C; n=20; Dikarya|Rep: Probable ATP-dependent
           transporter YER036C - Saccharomyces cerevisiae (Baker's
           yeast)
          Length = 610

 Score = 91.1 bits (216), Expect = 2e-17
 Identities = 42/65 (64%), Positives = 52/65 (80%)
 Frame = +2

Query: 257 SRDIKIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVPIPEHI 436
           SRDIK+++ S+ F+G  L+QD+ LELN GRRYGL+G NGCGKS+ L AL  RE PIPEHI
Sbjct: 79  SRDIKLSSVSLLFHGKVLIQDSGLELNYGRRYGLLGENGCGKSTFLKALATREYPIPEHI 138

Query: 437 DIFHL 451
           DI+ L
Sbjct: 139 DIYLL 143


>UniRef50_Q015J6 Cluster: Non-transporter ABC protein; n=2;
           Eukaryota|Rep: Non-transporter ABC protein -
           Ostreococcus tauri
          Length = 1066

 Score = 87.0 bits (206), Expect = 3e-16
 Identities = 36/63 (57%), Positives = 50/63 (79%)
 Frame = +2

Query: 263 DIKIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVPIPEHIDI 442
           D++    S++  G EL++D +LELN GRRYGL+G NGCGKS LL A+ RRE+P+P+H+DI
Sbjct: 534 DMRFEQVSMSVSGVELIKDCVLELNVGRRYGLLGANGCGKSMLLEAIARRELPVPKHVDI 593

Query: 443 FHL 451
           +HL
Sbjct: 594 YHL 596


>UniRef50_A4S7V5 Cluster: Predicted protein; n=1; Ostreococcus
           lucimarinus CCE9901|Rep: Predicted protein -
           Ostreococcus lucimarinus CCE9901
          Length = 685

 Score = 75.8 bits (178), Expect = 7e-13
 Identities = 35/62 (56%), Positives = 46/62 (74%)
 Frame = +2

Query: 257 SRDIKIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVPIPEHI 436
           SRDIKI  FS++  G  LL +T L +  GRRYGLVG NG GK++++  L RR++P+PEHI
Sbjct: 98  SRDIKIDGFSVSARGKPLLTNTSLTIAHGRRYGLVGPNGTGKTTVMKLLARRKIPVPEHI 157

Query: 437 DI 442
           DI
Sbjct: 158 DI 159


>UniRef50_Q00UV4 Cluster: Multidrug/pheromone exporter, ABC
           superfamily; n=1; Ostreococcus tauri|Rep:
           Multidrug/pheromone exporter, ABC superfamily -
           Ostreococcus tauri
          Length = 554

 Score = 74.9 bits (176), Expect = 1e-12
 Identities = 34/62 (54%), Positives = 46/62 (74%)
 Frame = +2

Query: 257 SRDIKIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVPIPEHI 436
           S+DIKI  FS++  G  LL +T L +  GRRYGLVG NG GK++++  L RR++P+PEHI
Sbjct: 7   SKDIKIDGFSVSARGKPLLNNTSLTIAHGRRYGLVGPNGTGKTTVMKLLARRKIPVPEHI 66

Query: 437 DI 442
           DI
Sbjct: 67  DI 68


>UniRef50_Q5KAU0 Cluster: Regulation of translational
           elongation-related protein, putative; n=1;
           Filobasidiella neoformans|Rep: Regulation of
           translational elongation-related protein, putative -
           Cryptococcus neoformans (Filobasidiella neoformans)
          Length = 732

 Score = 67.3 bits (157), Expect = 2e-10
 Identities = 30/65 (46%), Positives = 42/65 (64%)
 Frame = +2

Query: 257 SRDIKIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVPIPEHI 436
           S+DI + N  ++F  + +L    L +  GRRYGL+G NG GKS+LL  L  REVPIP HI
Sbjct: 181 SKDIHLLNIDVSFGSNRILSGATLSMAHGRRYGLIGRNGIGKSTLLRHLALREVPIPTHI 240

Query: 437 DIFHL 451
            + ++
Sbjct: 241 SVLYV 245


>UniRef50_Q9M1H3 Cluster: ABC transporter-like protein; n=15;
           Magnoliophyta|Rep: ABC transporter-like protein -
           Arabidopsis thaliana (Mouse-ear cress)
          Length = 723

 Score = 66.5 bits (155), Expect = 4e-10
 Identities = 28/61 (45%), Positives = 46/61 (75%)
 Frame = +2

Query: 260 RDIKIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVPIPEHID 439
           +DI I +FS++  G ELL++  + ++ G+RYGL+G NG GKS+LL  L  R++P+P++ID
Sbjct: 161 KDITIESFSVSARGKELLKNASVRISHGKRYGLIGPNGMGKSTLLKLLAWRKIPVPKNID 220

Query: 440 I 442
           +
Sbjct: 221 V 221


>UniRef50_Q3YB25 Cluster: ABC transporter ABCF1; n=2;
           Arthropoda|Rep: ABC transporter ABCF1 - Sarcoptes
           scabiei type hominis
          Length = 715

 Score = 65.7 bits (153), Expect = 8e-10
 Identities = 32/64 (50%), Positives = 41/64 (64%)
 Frame = +2

Query: 260 RDIKIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVPIPEHID 439
           +DIKI NF I+F  + LL++  L LN G RYGL G NG GKS+LL  +    + IP HI 
Sbjct: 187 KDIKIENFDISFGSNILLKNANLNLNYGERYGLCGRNGIGKSTLLKMISNGSLVIPSHIR 246

Query: 440 IFHL 451
           I H+
Sbjct: 247 ILHV 250


>UniRef50_Q4SB38 Cluster: Chromosome undetermined SCAF14677, whole
           genome shotgun sequence; n=3; Coelomata|Rep: Chromosome
           undetermined SCAF14677, whole genome shotgun sequence -
           Tetraodon nigroviridis (Green puffer)
          Length = 805

 Score = 65.3 bits (152), Expect = 1e-09
 Identities = 32/65 (49%), Positives = 41/65 (63%)
 Frame = +2

Query: 257 SRDIKIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVPIPEHI 436
           S DI+I NF ++F    LLQ   L L  GRRYGL+G NG GK++LL  L  R + +P HI
Sbjct: 200 SYDIRIENFDVSFGERCLLQGAELSLAFGRRYGLIGRNGLGKTTLLKMLASRNLRVPAHI 259

Query: 437 DIFHL 451
            I H+
Sbjct: 260 SILHV 264


>UniRef50_P43535 Cluster: Protein GCN20; n=27; Ascomycota|Rep:
           Protein GCN20 - Saccharomyces cerevisiae (Baker's yeast)
          Length = 752

 Score = 64.9 bits (151), Expect = 1e-09
 Identities = 32/66 (48%), Positives = 43/66 (65%), Gaps = 1/66 (1%)
 Frame = +2

Query: 257 SRDIKIANFSITFY-GSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVPIPEH 433
           S+DI I  F +    G  +L +  L L+ G RYGLVG NG GKS+LL AL RRE+ +P+H
Sbjct: 196 SKDIHIDTFDLYVGDGQRILSNAQLTLSFGHRYGLVGQNGIGKSTLLRALSRRELNVPKH 255

Query: 434 IDIFHL 451
           + I H+
Sbjct: 256 VSILHV 261



 Score = 35.5 bits (78), Expect = 0.93
 Identities = 16/39 (41%), Positives = 24/39 (61%)
 Frame = +2

Query: 308 LLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVPI 424
           LL+D  L++    R  LVG NGCGK++LL  +  +  P+
Sbjct: 547 LLKDVNLDVQMDSRIALVGANGCGKTTLLKIMMEQLRPL 585


>UniRef50_Q4TGK5 Cluster: Chromosome undetermined SCAF3640, whole
           genome shotgun sequence; n=3; Tetraodon
           nigroviridis|Rep: Chromosome undetermined SCAF3640,
           whole genome shotgun sequence - Tetraodon nigroviridis
           (Green puffer)
          Length = 242

 Score = 62.9 bits (146), Expect = 5e-09
 Identities = 31/71 (43%), Positives = 45/71 (63%)
 Frame = +2

Query: 263 DIKIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVPIPEHIDI 442
           DIK+  FSI+ +G EL  +  L +  GRRYGLVG NG GK++LL  +  R + IP +ID+
Sbjct: 40  DIKLERFSISAHGKELFVNADLLIVAGRRYGLVGPNGKGKTTLLKHIANRALSIPPNIDV 99

Query: 443 FHLTRGGARYP 475
               +G + +P
Sbjct: 100 LLCEQGESAWP 110


>UniRef50_A3ACW9 Cluster: Putative uncharacterized protein; n=1;
           Oryza sativa (japonica cultivar-group)|Rep: Putative
           uncharacterized protein - Oryza sativa subsp. japonica
           (Rice)
          Length = 691

 Score = 62.9 bits (146), Expect = 5e-09
 Identities = 31/68 (45%), Positives = 42/68 (61%), Gaps = 1/68 (1%)
 Frame = +2

Query: 251 PCSRDIKIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVP-IP 427
           P  RDI + NFS+T  G +L+QD  + L  GR YGLVG NG GK+S L A+    +  IP
Sbjct: 177 PAVRDIHMENFSVTVGGRDLIQDCTVTLAFGRHYGLVGRNGTGKTSFLRAMAMHAIDGIP 236

Query: 428 EHIDIFHL 451
           ++  I H+
Sbjct: 237 KNCQILHV 244


>UniRef50_Q9NUQ8 Cluster: ATP-binding cassette sub-family F member
           3; n=38; Eumetazoa|Rep: ATP-binding cassette sub-family
           F member 3 - Homo sapiens (Human)
          Length = 709

 Score = 61.7 bits (143), Expect = 1e-08
 Identities = 29/65 (44%), Positives = 40/65 (61%)
 Frame = +2

Query: 257 SRDIKIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVPIPEHI 436
           S D++I NF ++F    LL    + L  GRRYGLVG NG GK++LL  L  R + +P HI
Sbjct: 175 SYDVRIENFDVSFGDRVLLAGADVNLAWGRRYGLVGRNGLGKTTLLKMLATRSLRVPAHI 234

Query: 437 DIFHL 451
            + H+
Sbjct: 235 SLLHV 239


>UniRef50_Q00V30 Cluster: ENSANGP00000010790; n=2; Ostreococcus|Rep:
           ENSANGP00000010790 - Ostreococcus tauri
          Length = 846

 Score = 61.3 bits (142), Expect = 2e-08
 Identities = 27/66 (40%), Positives = 41/66 (62%)
 Frame = +2

Query: 254 CSRDIKIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVPIPEH 433
           C+ DI +    +     EL+QD  L+L  G +YGLVG NGCGKS+LL A+  + + +P+ 
Sbjct: 215 CNMDIHMTGIQLYGGRDELIQDGTLKLVFGTKYGLVGRNGCGKSTLLRAISEKTIKLPDF 274

Query: 434 IDIFHL 451
           + I H+
Sbjct: 275 LHIIHV 280


>UniRef50_Q54MF1 Cluster: Non-transporter ABC protein; n=2;
           Dictyostelium discoideum|Rep: Non-transporter ABC
           protein - Dictyostelium discoideum AX4
          Length = 708

 Score = 61.3 bits (142), Expect = 2e-08
 Identities = 27/65 (41%), Positives = 45/65 (69%)
 Frame = +2

Query: 257 SRDIKIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVPIPEHI 436
           SRDI +  F++T+  ++L+ ++ L LN GR+YGL+G NG GK++LL  +  RE+ I  ++
Sbjct: 179 SRDIHVDAFNVTYGKNDLIINSDLNLNYGRKYGLIGRNGTGKTTLLRHIASREIGIDNNL 238

Query: 437 DIFHL 451
            I H+
Sbjct: 239 SILHV 243


>UniRef50_Q9USH9 Cluster: Ribosome biogenesis ATPase, Arb family;
           n=1; Schizosaccharomyces pombe|Rep: Ribosome biogenesis
           ATPase, Arb family - Schizosaccharomyces pombe (Fission
           yeast)
          Length = 822

 Score = 61.3 bits (142), Expect = 2e-08
 Identities = 29/69 (42%), Positives = 44/69 (63%)
 Frame = +2

Query: 251 PCSRDIKIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVPIPE 430
           P SRD+++   S++ +G  L++D+ L L  GRRYGL+  NG GKS+LL A+    +P P 
Sbjct: 271 PNSRDLQVEKLSVSAWGKLLIKDSELNLINGRRYGLIAPNGSGKSTLLHAIACGLIPTPS 330

Query: 431 HIDIFHLTR 457
            +D + L R
Sbjct: 331 SLDFYLLDR 339


>UniRef50_Q4P7Y9 Cluster: Putative uncharacterized protein; n=1;
           Ustilago maydis|Rep: Putative uncharacterized protein -
           Ustilago maydis (Smut fungus)
          Length = 769

 Score = 60.5 bits (140), Expect = 3e-08
 Identities = 26/65 (40%), Positives = 40/65 (61%)
 Frame = +2

Query: 257 SRDIKIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVPIPEHI 436
           ++DI + N  + F  + +L +  L +  GRR GL+G NG GKS+LL  +  RE+PIP  I
Sbjct: 186 NKDIHLPNIDVNFGSNRILSNATLTIKAGRRAGLIGRNGVGKSTLLRNMALREIPIPTQI 245

Query: 437 DIFHL 451
            I ++
Sbjct: 246 SILYV 250


>UniRef50_Q8NE71 Cluster: ATP-binding cassette sub-family F member
           1; n=18; Tetrapoda|Rep: ATP-binding cassette sub-family
           F member 1 - Homo sapiens (Human)
          Length = 845

 Score = 59.7 bits (138), Expect = 5e-08
 Identities = 29/60 (48%), Positives = 40/60 (66%)
 Frame = +2

Query: 263 DIKIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVPIPEHIDI 442
           DIK+  FSI+ +G EL  +  L +  GRRYGLVG NG GK++LL  +  R + IP +ID+
Sbjct: 303 DIKLEKFSISAHGKELFVNADLYIVAGRRYGLVGPNGKGKTTLLKHIANRALSIPPNIDV 362


>UniRef50_A4RV42 Cluster: Predicted protein; n=1; Ostreococcus
           lucimarinus CCE9901|Rep: Predicted protein -
           Ostreococcus lucimarinus CCE9901
          Length = 533

 Score = 59.3 bits (137), Expect = 7e-08
 Identities = 32/70 (45%), Positives = 44/70 (62%), Gaps = 3/70 (4%)
 Frame = +2

Query: 257 SRDIKIANFSITFY--GSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVP-IP 427
           SRDI ++ FS+     G +LL+ T L L  G RYGL G NGCGKS+LL  L ++ VP IP
Sbjct: 20  SRDISVSEFSMPHPRGGDDLLEGTTLSLMHGHRYGLCGRNGCGKSTLLRLLAQKRVPGIP 79

Query: 428 EHIDIFHLTR 457
             + I ++ +
Sbjct: 80  ADLRIMYVAQ 89


>UniRef50_UPI0000499068 Cluster: non-transporter ABC protein; n=3;
           Entamoeba histolytica HM-1:IMSS|Rep: non-transporter ABC
           protein - Entamoeba histolytica HM-1:IMSS
          Length = 724

 Score = 58.8 bits (136), Expect = 9e-08
 Identities = 27/59 (45%), Positives = 39/59 (66%)
 Frame = +2

Query: 260 RDIKIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVPIPEHI 436
           +D+K  N SI +    +L+D  L L  GRRYGL+G NGCGKS+L+  +  R V IP+++
Sbjct: 202 KDVKQDNISIAYGKHLILEDADLTLAHGRRYGLIGRNGCGKSTLMRVIATRNVAIPDNM 260


>UniRef50_Q4Q4I8 Cluster: ATP-binding cassette protein, putative;
           n=5; Trypanosomatidae|Rep: ATP-binding cassette protein,
           putative - Leishmania major
          Length = 667

 Score = 58.4 bits (135), Expect = 1e-07
 Identities = 26/62 (41%), Positives = 41/62 (66%)
 Frame = +2

Query: 257 SRDIKIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVPIPEHI 436
           SR+I     S++  G  L +DT ++L+ G RYGL+G NG GKS++L  L  RE+P+  ++
Sbjct: 66  SRNITFNKVSVSVNGKTLFKDTTVKLSAGSRYGLMGPNGRGKSTILRLLASRELPVQSNL 125

Query: 437 DI 442
           D+
Sbjct: 126 DL 127


>UniRef50_Q4FAB6 Cluster: ATP-binding cassette sub-family F member
           1; n=1; Toxoplasma gondii|Rep: ATP-binding cassette
           sub-family F member 1 - Toxoplasma gondii
          Length = 811

 Score = 57.6 bits (133), Expect = 2e-07
 Identities = 30/51 (58%), Positives = 37/51 (72%)
 Frame = +2

Query: 266 IKIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREV 418
           I + +FSI   G ELL D  L+L  GRRYGLVG NG GKS+LL+AL R+E+
Sbjct: 222 ILVDSFSIAVAGRELLIDAQLKLVKGRRYGLVGRNGIGKSTLLSALVRQEI 272


>UniRef50_Q5CJV9 Cluster: ABC transporter-like protein; n=3;
           Cryptosporidium|Rep: ABC transporter-like protein -
           Cryptosporidium hominis
          Length = 750

 Score = 57.2 bits (132), Expect = 3e-07
 Identities = 29/62 (46%), Positives = 38/62 (61%), Gaps = 1/62 (1%)
 Frame = +2

Query: 260 RDIKIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVP-IPEHI 436
           +DI+I N +I   G  LL D  L L    +YGL+G NG GKS+LL  + RRE+P IP  +
Sbjct: 195 KDIQIPNITIFISGRALLSDASLNLTLKHKYGLIGRNGIGKSTLLTYIVRREIPGIPADV 254

Query: 437 DI 442
            I
Sbjct: 255 SI 256


>UniRef50_Q7YR37 Cluster: ATP-binding cassette sub-family F member
           1; n=30; Eumetazoa|Rep: ATP-binding cassette sub-family
           F member 1 - Pan troglodytes (Chimpanzee)
          Length = 807

 Score = 57.2 bits (132), Expect = 3e-07
 Identities = 28/60 (46%), Positives = 39/60 (65%)
 Frame = +2

Query: 263 DIKIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVPIPEHIDI 442
           DIK+  FSI+ +G EL  +  L +   RRYGLVG NG GK++LL  +  R + IP +ID+
Sbjct: 265 DIKLEKFSISAHGKELFVNADLYIVASRRYGLVGPNGKGKTTLLKHIANRALSIPPNIDV 324


>UniRef50_Q26026 Cluster: Elongation factor 3 related protein; n=7;
           Plasmodium|Rep: Elongation factor 3 related protein -
           Plasmodium falciparum
          Length = 816

 Score = 56.4 bits (130), Expect = 5e-07
 Identities = 27/52 (51%), Positives = 36/52 (69%)
 Frame = +2

Query: 263 DIKIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREV 418
           DI+I NF+I+     LL DT L++N   +YGL+G NG GKS+LLA L R E+
Sbjct: 195 DIEIDNFNISIGQRSLLSDTTLKINVMNKYGLIGKNGIGKSTLLAKLARYEI 246


>UniRef50_UPI000049993C Cluster: non-transporter ABC protein; n=1;
           Entamoeba histolytica HM-1:IMSS|Rep: non-transporter ABC
           protein - Entamoeba histolytica HM-1:IMSS
          Length = 487

 Score = 54.8 bits (126), Expect = 1e-06
 Identities = 31/70 (44%), Positives = 43/70 (61%), Gaps = 5/70 (7%)
 Frame = +2

Query: 257 SRDIKIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRRE--VP--- 421
           ++DIKI NF++   G  LL ++ L +  G +YGLVG NG GKS L+ A+  RE   P   
Sbjct: 87  AKDIKIENFTLQVPGKVLLNNSSLTMGFGSKYGLVGKNGIGKSVLMCAISGRESGTPFGN 146

Query: 422 IPEHIDIFHL 451
           IP +I I H+
Sbjct: 147 IPANIRILHV 156


>UniRef50_Q22KG9 Cluster: ABC transporter family protein; n=5;
            Oligohymenophorea|Rep: ABC transporter family protein -
            Tetrahymena thermophila SB210
          Length = 1785

 Score = 54.4 bits (125), Expect = 2e-06
 Identities = 25/63 (39%), Positives = 40/63 (63%), Gaps = 1/63 (1%)
 Frame = +2

Query: 257  SRDIKIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVP-IPEH 433
            ++D+++ N ++   G  LL+D  L L  GR+YGL+G NG GK+  + AL R E   +P+H
Sbjct: 1261 TQDLQLDNVNVIIGGRALLEDAKLRLTYGRKYGLIGRNGIGKTCFMNALARSEFENMPKH 1320

Query: 434  IDI 442
            + I
Sbjct: 1321 LQI 1323


>UniRef50_Q8H0V6 Cluster: GCN20-type ATP-binding cassette protein
           GCN3; n=1; Arabidopsis thaliana|Rep: GCN20-type
           ATP-binding cassette protein GCN3 - Arabidopsis thaliana
           (Mouse-ear cress)
          Length = 715

 Score = 53.2 bits (122), Expect = 4e-06
 Identities = 27/72 (37%), Positives = 41/72 (56%), Gaps = 1/72 (1%)
 Frame = +2

Query: 239 TGCAPCSRDIKIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREV 418
           TG     RDI + NF+++  G +L+ D  + L+ GR YGLVG NG GK++ L  +    +
Sbjct: 166 TGGGSAIRDIHMDNFNVSVGGRDLIVDGSITLSFGRHYGLVGRNGTGKTTFLRYMAMHAI 225

Query: 419 P-IPEHIDIFHL 451
             IP +  I H+
Sbjct: 226 EGIPTNCQILHV 237


>UniRef50_Q2UG40 Cluster: RIB40 genomic DNA, SC023; n=2;
           Pezizomycotina|Rep: RIB40 genomic DNA, SC023 -
           Aspergillus oryzae
          Length = 576

 Score = 52.4 bits (120), Expect = 8e-06
 Identities = 27/49 (55%), Positives = 32/49 (65%)
 Frame = +2

Query: 257 SRDIKIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAAL 403
           S+DIKI +   +  G  +L D  L L  GRRYGLVG NG GKS+LL AL
Sbjct: 87  SKDIKIDSIDTSVGGHRILTDASLTLAYGRRYGLVGQNGIGKSTLLRAL 135


>UniRef50_Q8W1S2 Cluster: ABC transporter-like protein; n=5;
           Magnoliophyta|Rep: ABC transporter-like protein -
           Glycine max (Soybean)
          Length = 636

 Score = 51.6 bits (118), Expect = 1e-05
 Identities = 25/68 (36%), Positives = 40/68 (58%), Gaps = 1/68 (1%)
 Frame = +2

Query: 251 PCSRDIKIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVP-IP 427
           P  +DI + NF+I+  G +L+ D  + L+ GR YGLVG NG GK++ L  +    +  +P
Sbjct: 170 PNVKDIHMENFNISVGGRDLIVDGCVTLSFGRHYGLVGRNGTGKTTFLRHMAMHAIDGVP 229

Query: 428 EHIDIFHL 451
            +  I H+
Sbjct: 230 RNCQILHV 237


>UniRef50_Q8SRV5 Cluster: BELONGS TO THE ABC TRANSPORTER
           SUPERFAMILY; n=1; Encephalitozoon cuniculi|Rep: BELONGS
           TO THE ABC TRANSPORTER SUPERFAMILY - Encephalitozoon
           cuniculi
          Length = 554

 Score = 49.6 bits (113), Expect = 5e-05
 Identities = 22/49 (44%), Positives = 34/49 (69%)
 Frame = +2

Query: 299 GSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVPIPEHIDIF 445
           G E++++  L +  GR+YGLVG NG GK++LL A+R+R   IP  + I+
Sbjct: 101 GKEIIREAPLTIVRGRKYGLVGRNGIGKTTLLKAIRKRRFGIPRGMRIY 149


>UniRef50_Q9N6L4 Cluster: ABC transporter protein, putative; n=6;
           Trypanosomatidae|Rep: ABC transporter protein, putative
           - Leishmania major
          Length = 724

 Score = 48.8 bits (111), Expect = 9e-05
 Identities = 30/83 (36%), Positives = 44/83 (53%), Gaps = 4/83 (4%)
 Frame = +2

Query: 257 SRDIKIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVP-IPEH 433
           S DI+     I      LL DT L L  G +YGL+G NG GK++LL AL  RE+  +   
Sbjct: 200 STDIRCEAIHIQLGKQVLLDDTDLVLLTGHKYGLIGRNGAGKTTLLRALAERELEGVSPF 259

Query: 434 IDIFHLTR---GGARYPIRPIVS 493
           + I H+ +    GA  P+  +++
Sbjct: 260 MQILHVEQEIVAGAETPLEVLLA 282


>UniRef50_Q4PCL5 Cluster: Putative uncharacterized protein; n=1;
           Ustilago maydis|Rep: Putative uncharacterized protein -
           Ustilago maydis (Smut fungus)
          Length = 867

 Score = 48.8 bits (111), Expect = 9e-05
 Identities = 23/55 (41%), Positives = 33/55 (60%)
 Frame = +2

Query: 257 SRDIKIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVP 421
           S +I + N ++T  G +LL D  L +     YGLVG NG GKS+LL A+  + +P
Sbjct: 190 SLEIDLHNVTLTLAGHDLLTDAHLRMKPATHYGLVGRNGAGKSTLLTAIGEKLIP 244


>UniRef50_Q20306 Cluster: Putative uncharacterized protein; n=2;
           Caenorhabditis|Rep: Putative uncharacterized protein -
           Caenorhabditis elegans
          Length = 712

 Score = 48.4 bits (110), Expect = 1e-04
 Identities = 24/62 (38%), Positives = 38/62 (61%)
 Frame = +2

Query: 257 SRDIKIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVPIPEHI 436
           S+DIK+ +  I+    +LL    + +  GRRYGLVG NG GK++LL  +  +++ IP  I
Sbjct: 176 SKDIKLESVDISIGTKQLLSCADVTMAFGRRYGLVGRNGIGKTTLLKMISSQQLKIPAGI 235

Query: 437 DI 442
            +
Sbjct: 236 SM 237


>UniRef50_O14134 Cluster: mRNA export factor elf1; n=1;
           Schizosaccharomyces pombe|Rep: mRNA export factor elf1 -
           Schizosaccharomyces pombe (Fission yeast)
          Length = 1057

 Score = 48.4 bits (110), Expect = 1e-04
 Identities = 26/56 (46%), Positives = 35/56 (62%), Gaps = 3/56 (5%)
 Frame = +2

Query: 278 NFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREV---PIPEHI 436
           +FS+ + G  LL  T L L  G RYG+VG NGCGKS+LL A+   +V   P P+ +
Sbjct: 449 DFSLAYGGRLLLSHTNLHLYRGHRYGVVGHNGCGKSTLLRAIGDYKVENFPSPDEV 504


>UniRef50_Q0U533 Cluster: Putative uncharacterized protein; n=1;
           Phaeosphaeria nodorum|Rep: Putative uncharacterized
           protein - Phaeosphaeria nodorum (Septoria nodorum)
          Length = 728

 Score = 48.0 bits (109), Expect = 2e-04
 Identities = 27/58 (46%), Positives = 34/58 (58%)
 Frame = +2

Query: 248 APCSRDIKIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVP 421
           AP S++I + + SI+    ELL  T L L   R Y LVG NG GKS+LL A+    VP
Sbjct: 37  APASKEIMVKDLSISVSNRELLSRTTLHLVEARHYVLVGRNGTGKSTLLKAMGDGLVP 94


>UniRef50_Q00VE5 Cluster: Peptide exporter, ABC superfamily; n=2;
           Ostreococcus|Rep: Peptide exporter, ABC superfamily -
           Ostreococcus tauri
          Length = 1079

 Score = 47.6 bits (108), Expect = 2e-04
 Identities = 24/61 (39%), Positives = 36/61 (59%), Gaps = 3/61 (4%)
 Frame = +2

Query: 263 DIKIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREV---PIPEH 433
           D+   +FS+ +    LL +  L +  G+RYGL G NGCGKS+L+ A+   +V   P PE 
Sbjct: 441 DLCKCDFSLAYGALILLNNATLHMKKGKRYGLCGPNGCGKSTLMKAINNGQVENFPPPEE 500

Query: 434 I 436
           +
Sbjct: 501 L 501


>UniRef50_A4RKM7 Cluster: Putative uncharacterized protein; n=4;
           Pezizomycotina|Rep: Putative uncharacterized protein -
           Magnaporthe grisea (Rice blast fungus) (Pyricularia
           grisea)
          Length = 761

 Score = 47.2 bits (107), Expect = 3e-04
 Identities = 24/45 (53%), Positives = 30/45 (66%), Gaps = 1/45 (2%)
 Frame = +2

Query: 299 GSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVP-IPE 430
           G E+L D  L L  G+RY LVG NG GKS+LL A+  + +P IPE
Sbjct: 68  GLEILTDAKLRLKAGQRYVLVGKNGSGKSTLLKAIAEKLIPGIPE 112



 Score = 37.5 bits (83), Expect = 0.23
 Identities = 16/37 (43%), Positives = 23/37 (62%)
 Frame = +2

Query: 311 LQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVP 421
           LQD  + +  G R G++GLNG GKS+L+  L   + P
Sbjct: 526 LQDVTVSVGMGDRIGIIGLNGAGKSTLIRLLVEADKP 562


>UniRef50_A2R321 Cluster: Similarity to ABC transporters; n=1;
           Aspergillus niger|Rep: Similarity to ABC transporters -
           Aspergillus niger
          Length = 686

 Score = 46.8 bits (106), Expect = 4e-04
 Identities = 24/49 (48%), Positives = 32/49 (65%), Gaps = 1/49 (2%)
 Frame = +2

Query: 299 GSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVP-IPEHIDI 442
           G E+L +  L L  GRRY LVG NG GKS+LL ++  + +P IPE+  I
Sbjct: 68  GIEILSNAELSLKEGRRYALVGRNGTGKSTLLTSIAEKLIPGIPENTKI 116



 Score = 33.9 bits (74), Expect = 2.8
 Identities = 14/32 (43%), Positives = 22/32 (68%)
 Frame = +2

Query: 308 LLQDTLLELNCGRRYGLVGLNGCGKSSLLAAL 403
           +++D  L +  G R G++GLNG GKS+L+  L
Sbjct: 453 VIRDVDLSVGMGDRIGILGLNGAGKSTLIQTL 484


>UniRef50_Q015Q4 Cluster: ABC transporter protein 1; n=2;
           Ostreococcus|Rep: ABC transporter protein 1 -
           Ostreococcus tauri
          Length = 632

 Score = 46.4 bits (105), Expect = 5e-04
 Identities = 21/40 (52%), Positives = 28/40 (70%)
 Frame = +2

Query: 299 GSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREV 418
           G++L++D  L +  GRRYGL+G NG GKS+LL  L  R V
Sbjct: 94  GADLIEDASLTVTPGRRYGLIGRNGSGKSTLLRHLAARRV 133


>UniRef50_Q8T6B4 Cluster: Non-transporter ABC protein AbcF4; n=3;
           Eukaryota|Rep: Non-transporter ABC protein AbcF4 -
           Dictyostelium discoideum (Slime mold)
          Length = 1142

 Score = 46.4 bits (105), Expect = 5e-04
 Identities = 24/64 (37%), Positives = 37/64 (57%), Gaps = 1/64 (1%)
 Frame = +2

Query: 263 DIKIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRR-EVPIPEHID 439
           DIK  N  ++  G  LL +  L L  G++YG VG NG GKS+L+  +  R E+ I  H+ 
Sbjct: 603 DIKFDNLILSVPGRILLNNASLTLAYGQKYGFVGRNGIGKSTLVKKIAMRDEITIAPHLR 662

Query: 440 IFHL 451
           + ++
Sbjct: 663 VLYV 666


>UniRef50_A2R4X2 Cluster: Function: the translational elongation
           factor 3; n=17; Pezizomycotina|Rep: Function: the
           translational elongation factor 3 - Aspergillus niger
          Length = 1117

 Score = 46.4 bits (105), Expect = 5e-04
 Identities = 24/56 (42%), Positives = 33/56 (58%)
 Frame = +2

Query: 251 PCSRDIKIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREV 418
           P   +I  ANFS+ + G  LL  T L L  G RYGL G NG GKS+L+ ++   ++
Sbjct: 479 PNEVEIVNANFSLAYGGMLLLSHTNLRLLKGHRYGLCGRNGAGKSTLMRSIANEKL 534


>UniRef50_A3U5B5 Cluster: ABC transporter ATP-binding protein; n=15;
           cellular organisms|Rep: ABC transporter ATP-binding
           protein - Croceibacter atlanticus HTCC2559
          Length = 643

 Score = 46.0 bits (104), Expect = 7e-04
 Identities = 22/48 (45%), Positives = 28/48 (58%)
 Frame = +2

Query: 266 IKIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRR 409
           + I   SI+F G  L +D    LN G R GLVG NG GKS++L  L +
Sbjct: 2   LNIHELSISFQGEFLFEDITFRLNAGDRVGLVGKNGAGKSTMLKILSK 49


>UniRef50_Q1MRG4 Cluster: ATPase components of ABC transporters with
           duplicated ATPase domains; n=4; Desulfovibrionaceae|Rep:
           ATPase components of ABC transporters with duplicated
           ATPase domains - Lawsonia intracellularis (strain
           PHE/MN1-00)
          Length = 665

 Score = 45.6 bits (103), Expect = 9e-04
 Identities = 25/66 (37%), Positives = 37/66 (56%)
 Frame = +2

Query: 266 IKIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVPIPEHIDIF 445
           I I NFS +F G ++  D  L+++ G R  + G NGCGKS+LL  +   ++P    + I 
Sbjct: 3   ITIQNFSKSFGGQDIFSDFSLDIDSGIRLCVSGPNGCGKSTLLRIIAEVDIPDSGRVIIP 62

Query: 446 HLTRGG 463
             TR G
Sbjct: 63  KGTRIG 68



 Score = 32.7 bits (71), Expect = 6.5
 Identities = 16/32 (50%), Positives = 19/32 (59%)
 Frame = +2

Query: 299 GSELLQDTLLELNCGRRYGLVGLNGCGKSSLL 394
           G +L       L  G+R  LVG NGCGKS+LL
Sbjct: 335 GRQLWPSLTFSLLNGQRIALVGPNGCGKSTLL 366


>UniRef50_Q5KQ02 Cluster: MRNA export factor elf1, putative; n=2;
           Basidiomycota|Rep: MRNA export factor elf1, putative -
           Cryptococcus neoformans (Filobasidiella neoformans)
          Length = 1100

 Score = 45.2 bits (102), Expect = 0.001
 Identities = 22/46 (47%), Positives = 30/46 (65%)
 Frame = +2

Query: 281 FSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREV 418
           FS+ + G  LL  T L+L  GRRYG+   NG GKS+L+ A+R  +V
Sbjct: 462 FSLAYGGLLLLNHTNLKLRRGRRYGICAANGAGKSTLMKAIRDGKV 507



 Score = 34.7 bits (76), Expect = 1.6
 Identities = 18/54 (33%), Positives = 30/54 (55%), Gaps = 2/54 (3%)
 Frame = +2

Query: 266 IKIANFSITFYGSEL--LQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVP 421
           +K+ N + T+ G+    +++    L+   R G+VG NG GKS+L+  L    VP
Sbjct: 697 LKLTNCTFTYPGAPRPSIKNASCSLSLSSRVGIVGPNGAGKSTLIKLLTGETVP 750


>UniRef50_A6QXS0 Cluster: Putative uncharacterized protein; n=1;
           Ajellomyces capsulatus NAm1|Rep: Putative
           uncharacterized protein - Ajellomyces capsulatus NAm1
          Length = 651

 Score = 45.2 bits (102), Expect = 0.001
 Identities = 23/49 (46%), Positives = 31/49 (63%), Gaps = 1/49 (2%)
 Frame = +2

Query: 299 GSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVP-IPEHIDI 442
           G E+L +  L L  G  YGLVG NG GKS++L AL  + +P IP+ I +
Sbjct: 72  GVEILSNADLHLKAGVHYGLVGRNGTGKSTILRALAEKLIPSIPDSIRV 120



 Score = 33.5 bits (73), Expect = 3.7
 Identities = 15/32 (46%), Positives = 22/32 (68%)
 Frame = +2

Query: 308 LLQDTLLELNCGRRYGLVGLNGCGKSSLLAAL 403
           +L D  L ++ G R G++GLNG GK++LL  L
Sbjct: 461 ILNDIDLVIHVGDRVGIMGLNGSGKTTLLKVL 492


>UniRef50_P44808 Cluster: Uncharacterized ABC transporter
           ATP-binding protein HI0658; n=58; Proteobacteria|Rep:
           Uncharacterized ABC transporter ATP-binding protein
           HI0658 - Haemophilus influenzae
          Length = 638

 Score = 44.8 bits (101), Expect = 0.002
 Identities = 22/52 (42%), Positives = 33/52 (63%)
 Frame = +2

Query: 266 IKIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVP 421
           I  +N S+    +ELL++    +N  ++ GLVG NGCGKSSL A L++  +P
Sbjct: 2   IIFSNLSLKRGQTELLENASATINPKQKVGLVGKNGCGKSSLFALLKKELMP 53



 Score = 32.7 bits (71), Expect = 6.5
 Identities = 18/43 (41%), Positives = 23/43 (53%)
 Frame = +2

Query: 275 ANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAAL 403
           A + I     E+L    L L  G R GL+G NG GKS+L+  L
Sbjct: 320 AGYGIGESAVEILSKIKLNLVPGSRIGLLGKNGAGKSTLIKLL 362


>UniRef50_Q1H8S1 Cluster: Putative ABC transporter; n=1; Chenopodium
           rubrum|Rep: Putative ABC transporter - Chenopodium
           rubrum (Red goosefoot) (Pigweed)
          Length = 93

 Score = 44.4 bits (100), Expect = 0.002
 Identities = 17/37 (45%), Positives = 29/37 (78%)
 Frame = +2

Query: 251 PCSRDIKIANFSITFYGSELLQDTLLELNCGRRYGLV 361
           P SRD++I + S+TF+G +L+ D++LELN  R+ G++
Sbjct: 55  PMSRDVRIESLSVTFHGHDLIVDSMLELNLRRQLGML 91


>UniRef50_A7SEN5 Cluster: Predicted protein; n=1; Nematostella
            vectensis|Rep: Predicted protein - Nematostella vectensis
          Length = 1281

 Score = 44.4 bits (100), Expect = 0.002
 Identities = 24/62 (38%), Positives = 37/62 (59%), Gaps = 2/62 (3%)
 Frame = +2

Query: 251  PCSRDIKIANFSITFY--GSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVPI 424
            P   ++K  N S+ +Y  G ++L +  +++  G R G+ G  G GKSSL+AAL R  +P 
Sbjct: 1036 PAHGNVKFENVSLRYYEGGPQVLHNLNIDIKGGERVGVAGRTGAGKSSLVAALFR--MPD 1093

Query: 425  PE 430
            PE
Sbjct: 1094 PE 1095


>UniRef50_P53978 Cluster: Elongation factor 3B; n=25;
           Ascomycota|Rep: Elongation factor 3B - Saccharomyces
           cerevisiae (Baker's yeast)
          Length = 1044

 Score = 44.4 bits (100), Expect = 0.002
 Identities = 22/52 (42%), Positives = 30/52 (57%)
 Frame = +2

Query: 263 DIKIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREV 418
           D+    FS+ +    LL  T L L  GRRYGL G NG GKS+L+ ++   +V
Sbjct: 430 DLCNCEFSLAYGAKILLNKTQLRLKRGRRYGLCGPNGAGKSTLMRSIANGQV 481


>UniRef50_Q66093 Cluster: Translation elongation factor-3; n=8;
           root|Rep: Translation elongation factor-3 - Chlorella
           virus
          Length = 1120

 Score = 44.0 bits (99), Expect = 0.003
 Identities = 21/47 (44%), Positives = 28/47 (59%)
 Frame = +2

Query: 263 DIKIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAAL 403
           D+    FS+ + G  LL +T   L  G RYGL G NG GKS+L+ A+
Sbjct: 532 DLCDCEFSLAYGGKILLNNTRFNLKRGNRYGLCGPNGAGKSTLMRAI 578


>UniRef50_Q01BZ9 Cluster: ABC transporter family protein; n=1;
           Ostreococcus tauri|Rep: ABC transporter family protein -
           Ostreococcus tauri
          Length = 1102

 Score = 44.0 bits (99), Expect = 0.003
 Identities = 20/38 (52%), Positives = 27/38 (71%), Gaps = 1/38 (2%)
 Frame = +2

Query: 347 RYGLVGLNGCGKSSLLAALRRREVP-IPEHIDIFHLTR 457
           RYGLVG NGCGKS+LL  L R+ VP +P  + I ++ +
Sbjct: 556 RYGLVGRNGCGKSTLLRLLARKRVPGVPADLRIMYVAQ 593


>UniRef50_Q7QWE0 Cluster: GLP_336_33150_35495; n=1; Giardia lamblia
           ATCC 50803|Rep: GLP_336_33150_35495 - Giardia lamblia
           ATCC 50803
          Length = 781

 Score = 43.6 bits (98), Expect = 0.003
 Identities = 21/51 (41%), Positives = 31/51 (60%)
 Frame = +2

Query: 266 IKIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREV 418
           IK+   ++ +  + LL+D     + GRRY L+G NG GKSSLL A+   E+
Sbjct: 184 IKLDRVTLAYGKNILLEDCDFTFHFGRRYSLIGRNGTGKSSLLRAIAHGEI 234


>UniRef50_Q6MCG4 Cluster: Putative uncharacterized protein; n=1;
           Candidatus Protochlamydia amoebophila UWE25|Rep:
           Putative uncharacterized protein - Protochlamydia
           amoebophila (strain UWE25)
          Length = 646

 Score = 43.2 bits (97), Expect = 0.005
 Identities = 19/46 (41%), Positives = 27/46 (58%)
 Frame = +2

Query: 266 IKIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAAL 403
           I +   ++ F    L +   L+ N G RYGL+G NGCGKS+L+  L
Sbjct: 2   IALIELTMRFGAKILFKQVNLQFNPGNRYGLIGANGCGKSTLIKIL 47


>UniRef50_Q0RX60 Cluster: ABC sugar transporter, ATP-binding
           component; n=1; Rhodococcus sp. RHA1|Rep: ABC sugar
           transporter, ATP-binding component - Rhodococcus sp.
           (strain RHA1)
          Length = 511

 Score = 43.2 bits (97), Expect = 0.005
 Identities = 21/54 (38%), Positives = 30/54 (55%)
 Frame = +2

Query: 266 IKIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVPIP 427
           +++++ S+TF     L    L L  G  +GLVG NGCGKS+L+  L     P P
Sbjct: 5   LELSSLSMTFDSGRALDGADLSLTVGEIHGLVGQNGCGKSTLIKILSGYHSPDP 58


>UniRef50_A6NZJ2 Cluster: Putative uncharacterized protein; n=1;
           Bacteroides capillosus ATCC 29799|Rep: Putative
           uncharacterized protein - Bacteroides capillosus ATCC
           29799
          Length = 256

 Score = 43.2 bits (97), Expect = 0.005
 Identities = 24/86 (27%), Positives = 45/86 (52%)
 Frame = +2

Query: 242 GCAPCSRDIKIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVP 421
           GCA     +++ +  +   G+++L+D    L+CG+   L+G NG GKSSL  A+   ++P
Sbjct: 12  GCAGACC-LRVEHLGVDMGGADILRDVSFHLHCGQIVALIGPNGAGKSSLFKAV-LGQIP 69

Query: 422 IPEHIDIFHLTRGGARYPIRPIVSRI 499
              H       + G ++  RP++  +
Sbjct: 70  ---HSGTIEFQKAGGKH-TRPLIGYV 91


>UniRef50_A0L0D5 Cluster: ABC transporter related; n=20;
           Alteromonadales|Rep: ABC transporter related -
           Shewanella sp. (strain ANA-3)
          Length = 326

 Score = 43.2 bits (97), Expect = 0.005
 Identities = 23/60 (38%), Positives = 30/60 (50%)
 Frame = +2

Query: 266 IKIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVPIPEHIDIF 445
           +K++  S    G  +L +    L  G   GL+G NG GKSSLL  L R   P   HI +F
Sbjct: 21  LKVSQLSWAIEGKTILSEISFALPQGEMLGLIGPNGAGKSSLLRCLYRFIRPAKGHISLF 80


>UniRef50_Q93ZN6 Cluster: AT5g64840/MXK3_6; n=10; cellular
           organisms|Rep: AT5g64840/MXK3_6 - Arabidopsis thaliana
           (Mouse-ear cress)
          Length = 692

 Score = 43.2 bits (97), Expect = 0.005
 Identities = 20/60 (33%), Positives = 34/60 (56%)
 Frame = +2

Query: 242 GCAPCSRDIKIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVP 421
           G +  S  +K+ N   ++ G  +L+D   E+  G + GLVG+NG GK++ L  +  +E P
Sbjct: 90  GASGISSGVKLENIRKSYKGVTVLKDVTWEVKRGEKVGLVGVNGAGKTTQLRIITGQEEP 149



 Score = 36.3 bits (80), Expect = 0.53
 Identities = 16/53 (30%), Positives = 26/53 (49%)
 Frame = +2

Query: 266 IKIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVPI 424
           + + N    F    L +   L +  G +  ++G NGCGKS+LL  +   E P+
Sbjct: 425 VNVKNIDFGFEDKMLFKKANLSIERGEKIAILGPNGCGKSTLLKLIMGLEKPV 477


>UniRef50_Q01DK5 Cluster: Protein containing adaptin N-terminal
            region; n=3; Ostreococcus|Rep: Protein containing adaptin
            N-terminal region - Ostreococcus tauri
          Length = 2002

 Score = 43.2 bits (97), Expect = 0.005
 Identities = 20/63 (31%), Positives = 35/63 (55%), Gaps = 1/63 (1%)
 Frame = +2

Query: 266  IKIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVP-IPEHIDI 442
            + +    + F G  LLQ T   L  GR YG+VG NG GK++LL  +  +++   P  + +
Sbjct: 1373 VDLQGIILAFAGRVLLQRTNFTLERGRTYGIVGQNGTGKTTLLNRVAAKDIAGFPADVSV 1432

Query: 443  FHL 451
            +++
Sbjct: 1433 YYI 1435


>UniRef50_Q8G7G7 Cluster: ATP binding protein of ABC transporter;
           n=2; Bifidobacterium longum|Rep: ATP binding protein of
           ABC transporter - Bifidobacterium longum
          Length = 758

 Score = 42.7 bits (96), Expect = 0.006
 Identities = 20/52 (38%), Positives = 29/52 (55%)
 Frame = +2

Query: 287 ITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVPIPEHIDI 442
           +T  G E+L D    +  G R+G+VG NG GKS+LL  +     P   H++I
Sbjct: 417 VTVSGREILDDVTWLIGPGDRFGIVGANGAGKSTLLKLIDGTLTPTAGHVNI 468



 Score = 34.3 bits (75), Expect = 2.1
 Identities = 19/53 (35%), Positives = 27/53 (50%)
 Frame = +2

Query: 263 DIKIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVP 421
           DI + + S+ F    +  D    +  G R G+VG NG GKS+LL   R  + P
Sbjct: 5   DIGLEHVSLAFATKTIFTDVTQGVFEGDRIGIVGKNGDGKSTLLHLFRGAQEP 57


>UniRef50_Q0RZ01 Cluster: Monosaccharide-transporting ATPase; n=1;
           Rhodococcus sp. RHA1|Rep: Monosaccharide-transporting
           ATPase - Rhodococcus sp. (strain RHA1)
          Length = 503

 Score = 42.7 bits (96), Expect = 0.006
 Identities = 22/52 (42%), Positives = 29/52 (55%)
 Frame = +2

Query: 266 IKIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVP 421
           ++I +FS TF G   L D  L L  G  + LVG NGCGKS+ +  L   + P
Sbjct: 4   VEIRSFSKTFPGQRALTDFDLVLEPGEIHALVGENGCGKSTFIKCLSGYQAP 55


>UniRef50_A4TWA3 Cluster: ABC-type multidrug transport system,
           ATPase component; n=4; Proteobacteria|Rep: ABC-type
           multidrug transport system, ATPase component -
           Magnetospirillum gryphiswaldense
          Length = 286

 Score = 42.7 bits (96), Expect = 0.006
 Identities = 21/46 (45%), Positives = 27/46 (58%)
 Frame = +2

Query: 266 IKIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAAL 403
           I   N + TF  S +L D  LE+N G R  LVG NG GK++L+  L
Sbjct: 2   ISFKNVTKTFKRSRVLDDVSLEMNKGERIALVGSNGAGKTTLIRCL 47


>UniRef50_Q45W09 Cluster: Putative ATP-binding cassette protein;
           n=1; Toxoplasma gondii|Rep: Putative ATP-binding
           cassette protein - Toxoplasma gondii
          Length = 1179

 Score = 42.7 bits (96), Expect = 0.006
 Identities = 19/47 (40%), Positives = 31/47 (65%)
 Frame = +2

Query: 266 IKIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALR 406
           +++++FS++  G+ L+ D  L L  G R  LVG NG GK+S L A++
Sbjct: 79  LRVSDFSLSISGNALVSDANLLLRGGERVALVGPNGAGKTSFLRAIK 125


>UniRef50_Q02151 Cluster: Uncharacterized ABC transporter
           ATP-binding protein ymeB; n=9; Streptococcaceae|Rep:
           Uncharacterized ABC transporter ATP-binding protein ymeB
           - Lactococcus lactis subsp. lactis (Streptococcus
           lactis)
          Length = 259

 Score = 42.7 bits (96), Expect = 0.006
 Identities = 25/82 (30%), Positives = 41/82 (50%)
 Frame = +2

Query: 266 IKIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVPIPEHIDIF 445
           I + N ++T    E+L+D   ++N G  + ++GLNG GKSSLL  +   E      I + 
Sbjct: 4   INLKNINLTRNKKEILKDITWKVNPGENWVILGLNGSGKSSLLKLILAEEWKTSGEITVL 63

Query: 446 HLTRGGARYPIRPIVSRITIHG 511
           +   G    P   +  RI++ G
Sbjct: 64  NTQFGNGEIP--KLRKRISVVG 83


>UniRef50_Q899L1 Cluster: ABC-type multidrug transport system; n=9;
           Bacteria|Rep: ABC-type multidrug transport system -
           Clostridium tetani
          Length = 307

 Score = 42.3 bits (95), Expect = 0.008
 Identities = 20/63 (31%), Positives = 35/63 (55%)
 Frame = +2

Query: 266 IKIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVPIPEHIDIF 445
           +K+ N +  ++    + +  +E+N G  YGLVG NG GK++LL  +    +P    I +F
Sbjct: 6   LKVKNITKKYHNHLAVNNVSMEINQGEIYGLVGKNGAGKTTLLKMICGLTIPSIGEISLF 65

Query: 446 HLT 454
           + T
Sbjct: 66  NET 68


>UniRef50_Q83GA5 Cluster: ABC transporter ATP-binding protein; n=2;
           Tropheryma whipplei|Rep: ABC transporter ATP-binding
           protein - Tropheryma whipplei (strain Twist) (Whipple's
           bacillus)
          Length = 515

 Score = 42.3 bits (95), Expect = 0.008
 Identities = 18/47 (38%), Positives = 31/47 (65%)
 Frame = +2

Query: 263 DIKIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAAL 403
           D++I+N+S +  G  ++ +  L +  G R  ++G +GCGKS+LL AL
Sbjct: 16  DVEISNWSFSHSGETIINNLSLSIRQGERVLIIGPSGCGKSTLLLAL 62


>UniRef50_Q5FPN2 Cluster: ABC transporter ATP-binding protein; n=37;
           Alphaproteobacteria|Rep: ABC transporter ATP-binding
           protein - Gluconobacter oxydans (Gluconobacter
           suboxydans)
          Length = 635

 Score = 42.3 bits (95), Expect = 0.008
 Identities = 19/46 (41%), Positives = 30/46 (65%)
 Frame = +2

Query: 266 IKIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAAL 403
           + I + ++   G  LL +  L ++ GR+ GL+G NG GKS+LLAA+
Sbjct: 4   LTITDLTLRIAGRTLLDNASLSVDPGRKIGLIGKNGAGKSTLLAAI 49


>UniRef50_Q9RDZ5 Cluster: Wzt protein; n=5; Legionella
           pneumophila|Rep: Wzt protein - Legionella pneumophila
          Length = 474

 Score = 42.3 bits (95), Expect = 0.008
 Identities = 19/33 (57%), Positives = 23/33 (69%)
 Frame = +2

Query: 311 LQDTLLELNCGRRYGLVGLNGCGKSSLLAALRR 409
           L+D  LE+  G R G+VG NGCGKS+LL  L R
Sbjct: 80  LRDINLEIEAGERLGIVGQNGCGKSTLLKILSR 112


>UniRef50_Q0RU62 Cluster: High-affinity D-ribose transport protein;
           n=1; Frankia alni ACN14a|Rep: High-affinity D-ribose
           transport protein - Frankia alni (strain ACN14a)
          Length = 505

 Score = 42.3 bits (95), Expect = 0.008
 Identities = 21/54 (38%), Positives = 31/54 (57%)
 Frame = +2

Query: 266 IKIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVPIP 427
           +++ N + TF G+  L+D  LE+  G  +GLVG NG GKS+ +  L     P P
Sbjct: 9   LRVVNLAKTFGGARALKDISLEIAPGEIHGLVGENGSGKSTFVKILSGYHSPEP 62


>UniRef50_A0ZZW2 Cluster: ATP binding protein of ABC transporter;
           n=2; Bifidobacterium adolescentis|Rep: ATP binding
           protein of ABC transporter - Bifidobacterium
           adolescentis (strain ATCC 15703 / DSM 20083)
          Length = 718

 Score = 42.3 bits (95), Expect = 0.008
 Identities = 21/60 (35%), Positives = 32/60 (53%)
 Frame = +2

Query: 263 DIKIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVPIPEHIDI 442
           ++  A   +T  G ++L D    +  G R+G+VG NG GKS+LL  L     P   H++I
Sbjct: 383 EVTSAAQKVTVTGRKILDDVTWLIGPGDRFGIVGANGAGKSTLLKILDGTITPTAGHVNI 442


>UniRef50_UPI0000498F17 Cluster: beta-galactosidase; n=3;
           Eukaryota|Rep: beta-galactosidase - Entamoeba
           histolytica HM-1:IMSS
          Length = 86

 Score = 41.9 bits (94), Expect = 0.011
 Identities = 20/26 (76%), Positives = 20/26 (76%)
 Frame = +2

Query: 506 HGRRFTNVVTGKTLAFPNLIALQDIP 583
           H   F NVVTGKTLA PNLIALQ IP
Sbjct: 5   HWPSFYNVVTGKTLALPNLIALQHIP 30


>UniRef50_Q7MZW6 Cluster: Similarities with ABC-type transport
           protein; n=1; Photorhabdus luminescens subsp.
           laumondii|Rep: Similarities with ABC-type transport
           protein - Photorhabdus luminescens subsp. laumondii
          Length = 617

 Score = 41.9 bits (94), Expect = 0.011
 Identities = 21/57 (36%), Positives = 33/57 (57%)
 Frame = +2

Query: 251 PCSRDIKIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVP 421
           P    I ++N   ++  + +L+D  L +  G + G+VG +G GKS+LLA LR   VP
Sbjct: 363 PVPGQIVLSNVCSSYGATSVLRDVSLRIEPGTKVGIVGPSGSGKSTLLAVLRGDMVP 419


>UniRef50_Q48635 Cluster: NisF protein; n=3; Streptococcaceae|Rep:
           NisF protein - Lactococcus lactis
          Length = 225

 Score = 41.9 bits (94), Expect = 0.011
 Identities = 19/46 (41%), Positives = 29/46 (63%)
 Frame = +2

Query: 266 IKIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAAL 403
           +KI N S T+   ++LQD   ++  G   GL+G+NG GKS+L+  L
Sbjct: 3   VKIQNLSKTYKEKQVLQDISFDIKSGTVCGLLGVNGAGKSTLMKIL 48


>UniRef50_Q1F0D9 Cluster: Iron ABC transporter, ATP-binding protein;
           n=2; Clostridiales|Rep: Iron ABC transporter,
           ATP-binding protein - Clostridium oremlandii OhILAs
          Length = 271

 Score = 41.9 bits (94), Expect = 0.011
 Identities = 19/43 (44%), Positives = 28/43 (65%)
 Frame = +2

Query: 266 IKIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLL 394
           IK+ N S  +  +E+  D  L+LN G+   L+G NGCGK++LL
Sbjct: 7   IKVKNASFHYEKTEVFNDLSLKLNAGQVLCLIGSNGCGKTTLL 49


>UniRef50_A0V1J8 Cluster: ABC transporter related; n=1; Clostridium
           cellulolyticum H10|Rep: ABC transporter related -
           Clostridium cellulolyticum H10
          Length = 269

 Score = 41.9 bits (94), Expect = 0.011
 Identities = 18/45 (40%), Positives = 29/45 (64%)
 Frame = +2

Query: 269 KIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAAL 403
           KI NF +    +++LQ+  L L+CG    ++G NG GKS+LL ++
Sbjct: 25  KIENFGVKVGRTQILQNVNLHLHCGELTAIIGPNGAGKSTLLKSI 69


>UniRef50_A0JVY1 Cluster: ABC transporter related precursor; n=1;
           Arthrobacter sp. FB24|Rep: ABC transporter related
           precursor - Arthrobacter sp. (strain FB24)
          Length = 516

 Score = 41.9 bits (94), Expect = 0.011
 Identities = 19/46 (41%), Positives = 26/46 (56%)
 Frame = +2

Query: 266 IKIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAAL 403
           + +   S TF G + L    LEL  G  + L+G NGCGKS+L+  L
Sbjct: 11  LTLRGLSKTFVGQKALDTVALELRAGEVHALLGQNGCGKSTLIKCL 56


>UniRef50_A1D1C9 Cluster: ABC transporter, putative; n=6;
           Trichocomaceae|Rep: ABC transporter, putative -
           Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / NRRL
           181)(Aspergillus fischerianus (strain ATCC 1020 / DSM
           3700 / NRRL 181))
          Length = 752

 Score = 41.9 bits (94), Expect = 0.011
 Identities = 20/39 (51%), Positives = 25/39 (64%)
 Frame = +2

Query: 305 ELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVP 421
           EL+ D  L L  G  YGL+G NG GKS+LL A+  + VP
Sbjct: 75  ELIVDAHLRLKAGVHYGLIGRNGTGKSTLLRAMADKLVP 113


>UniRef50_Q5N1U4 Cluster: ABC-type manganese transport system
           ATP-binding protein MntA; n=3; Cyanobacteria|Rep:
           ABC-type manganese transport system ATP-binding protein
           MntA - Synechococcus sp. (strain ATCC 27144 / PCC 6301 /
           SAUG 1402/1)(Anacystis nidulans)
          Length = 251

 Score = 41.5 bits (93), Expect = 0.014
 Identities = 21/52 (40%), Positives = 31/52 (59%)
 Frame = +2

Query: 248 APCSRDIKIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAAL 403
           AP    ++  + S ++   E+LQD  L+L  G+  G+VG NG GKS+ L AL
Sbjct: 6   APNPPTLQAHHLSASYRDREVLQDVNLQLRAGQVVGIVGPNGAGKSTFLKAL 57


>UniRef50_Q3K8V2 Cluster: ABC transporter-like; n=2; Bacteria|Rep:
           ABC transporter-like - Pseudomonas fluorescens (strain
           PfO-1)
          Length = 252

 Score = 41.5 bits (93), Expect = 0.014
 Identities = 20/38 (52%), Positives = 25/38 (65%)
 Frame = +2

Query: 290 TFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAAL 403
           T Y  E L+   LE+N G R GL+GLNG GKS+LL  +
Sbjct: 42  TNYRIEALKGINLEINHGERVGLIGLNGAGKSTLLKVM 79


>UniRef50_Q03J68 Cluster: ABC-type molybdenum transport system,
           ATPase component/photorepair protein PhrA; n=3;
           Streptococcus thermophilus|Rep: ABC-type molybdenum
           transport system, ATPase component/photorepair protein
           PhrA - Streptococcus thermophilus (strain ATCC BAA-491 /
           LMD-9)
          Length = 260

 Score = 41.5 bits (93), Expect = 0.014
 Identities = 22/65 (33%), Positives = 33/65 (50%)
 Frame = +2

Query: 266 IKIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVPIPEHIDIF 445
           I++ N S+   G  LL +    +  G+ + ++GLNG GKS+LL  L     P   H +I 
Sbjct: 4   IRLENVSLARQGKTLLSNLNWSVEKGQTWAILGLNGAGKSTLLRLLTAEFFPSEGHAEIL 63

Query: 446 HLTRG 460
             T G
Sbjct: 64  GYTFG 68


>UniRef50_A7B2V3 Cluster: Putative uncharacterized protein; n=1;
           Ruminococcus gnavus ATCC 29149|Rep: Putative
           uncharacterized protein - Ruminococcus gnavus ATCC 29149
          Length = 258

 Score = 41.5 bits (93), Expect = 0.014
 Identities = 19/32 (59%), Positives = 24/32 (75%)
 Frame = +2

Query: 299 GSELLQDTLLELNCGRRYGLVGLNGCGKSSLL 394
           G+E+LQD  LE+  G   GL+G NGCGKS+LL
Sbjct: 17  GTEILQDVSLEVPEGTFVGLIGPNGCGKSTLL 48


>UniRef50_A2W9Y9 Cluster: ATPase component of ABC transporter; n=1;
           Burkholderia dolosa AUO158|Rep: ATPase component of ABC
           transporter - Burkholderia dolosa AUO158
          Length = 521

 Score = 41.5 bits (93), Expect = 0.014
 Identities = 22/59 (37%), Positives = 33/59 (55%)
 Frame = +2

Query: 227 LYWVTGCAPCSRDIKIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAAL 403
           +Y +TG A  S     AN ++ F    L ++  ++   G RYGL+G NGCGKS+ +  L
Sbjct: 20  IYLLTGPAVLST----ANITMQFGPKPLFENISVKFGEGNRYGLIGANGCGKSTFMKIL 74


>UniRef50_A7PL10 Cluster: Chromosome chr7 scaffold_20, whole genome
           shotgun sequence; n=1; Vitis vinifera|Rep: Chromosome
           chr7 scaffold_20, whole genome shotgun sequence - Vitis
           vinifera (Grape)
          Length = 718

 Score = 41.5 bits (93), Expect = 0.014
 Identities = 20/61 (32%), Positives = 34/61 (55%)
 Frame = +2

Query: 239 TGCAPCSRDIKIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREV 418
           +G +  S  +++ N S  + G  +L+D   E+  G + GLVG+NG GK++ L  +   E 
Sbjct: 115 SGASSISSGVRLENVSKGYKGVTVLKDVSWEVKKGEKVGLVGVNGAGKTTQLRIITGLEE 174

Query: 419 P 421
           P
Sbjct: 175 P 175



 Score = 35.1 bits (77), Expect = 1.2
 Identities = 17/53 (32%), Positives = 26/53 (49%)
 Frame = +2

Query: 266 IKIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVPI 424
           + I N    +    L +   L +  G +  ++G NGCGKS+LL  +   E PI
Sbjct: 451 LAIKNLEFGYGDKVLFKKANLTIERGEKIAIIGPNGCGKSTLLKLIMGLEKPI 503


>UniRef50_A7S693 Cluster: Predicted protein; n=3; Nematostella
            vectensis|Rep: Predicted protein - Nematostella vectensis
          Length = 1259

 Score = 41.5 bits (93), Expect = 0.014
 Identities = 22/57 (38%), Positives = 33/57 (57%), Gaps = 2/57 (3%)
 Frame = +2

Query: 266  IKIANFSITFY--GSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVPIPE 430
            + + N S+ +Y    E+L+D    +N   R G+ G  G GKSSL++AL R  +P PE
Sbjct: 1019 VDLVNVSLAYYPGAPEVLKDVTFSINPAERVGIAGRTGAGKSSLVSALFR--MPDPE 1073


>UniRef50_P25997 Cluster: Elongation factor 3; n=21; Ascomycota|Rep:
           Elongation factor 3 - Candida albicans (Yeast)
          Length = 1049

 Score = 41.5 bits (93), Expect = 0.014
 Identities = 21/52 (40%), Positives = 28/52 (53%)
 Frame = +2

Query: 263 DIKIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREV 418
           D+    FS+ +    LL  T   L   RRYGL G NG GKS+L+ A+   +V
Sbjct: 432 DLCNCEFSLAYGAKILLNKTQFRLKRNRRYGLCGPNGAGKSTLMRAIANGQV 483



 Score = 32.7 bits (71), Expect = 6.5
 Identities = 16/54 (29%), Positives = 29/54 (53%), Gaps = 2/54 (3%)
 Frame = +2

Query: 266 IKIANFSITFYGSEL--LQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVP 421
           +K++N S  + G+    +QD   + +   R  ++G NG GKS+L+  L    +P
Sbjct: 671 VKVSNMSFQYPGTSKPQIQDINFQCSLSSRIAVIGPNGAGKSTLINVLTGELLP 724


>UniRef50_Q7U496 Cluster: ABC transporter, ATP binding component;
           n=33; Cyanobacteria|Rep: ABC transporter, ATP binding
           component - Synechococcus sp. (strain WH8102)
          Length = 583

 Score = 41.1 bits (92), Expect = 0.019
 Identities = 21/57 (36%), Positives = 34/57 (59%), Gaps = 1/57 (1%)
 Frame = +2

Query: 254 CSRDI-KIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVP 421
           CSR + ++ N S  +   E+L++   E+  G R GLVG+NG GKS+ +  +  +E P
Sbjct: 6   CSRPVLRLENVSKIYPTGEVLRNVTWEVKPGDRIGLVGVNGAGKSTQMRLIAGQEEP 62


>UniRef50_Q140N0 Cluster: ABC branched chain amino acid family
           transporter, ATPase subunit; n=1; Burkholderia
           xenovorans LB400|Rep: ABC branched chain amino acid
           family transporter, ATPase subunit - Burkholderia
           xenovorans (strain LB400)
          Length = 260

 Score = 41.1 bits (92), Expect = 0.019
 Identities = 21/46 (45%), Positives = 27/46 (58%)
 Frame = +2

Query: 257 SRDIKIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLL 394
           S  + I + S++F G   LQD  L L  G   GL+G NG GKS+LL
Sbjct: 4   SATLSIESISVSFGGVHALQDVSLTLEPGSIVGLIGPNGAGKSTLL 49


>UniRef50_A6PEV0 Cluster: ABC transporter related; n=1; Shewanella
           sediminis HAW-EB3|Rep: ABC transporter related -
           Shewanella sediminis HAW-EB3
          Length = 241

 Score = 41.1 bits (92), Expect = 0.019
 Identities = 20/46 (43%), Positives = 31/46 (67%)
 Frame = +2

Query: 272 IANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRR 409
           + N SI F  +++L+D  L+L  G+ + L G +GCGK++LL AL R
Sbjct: 16  LENVSIQFADTKILRDVNLQLLKGQLHMLTGPSGCGKTTLLRALNR 61


>UniRef50_A2VBJ9 Cluster: Non-ribosomal peptide synthetase; n=1;
           uncultured bacterium|Rep: Non-ribosomal peptide
           synthetase - uncultured bacterium
          Length = 338

 Score = 41.1 bits (92), Expect = 0.019
 Identities = 19/24 (79%), Positives = 19/24 (79%)
 Frame = -2

Query: 512 GREL*YDSL*GELGTGPPLESDGI 441
           GR   YDSL GELGTGPPLE DGI
Sbjct: 273 GRRAYYDSLYGELGTGPPLEVDGI 296


>UniRef50_A1RG94 Cluster: ABC transporter, transmembrane region,
           type 1 precursor; n=12; Shewanella|Rep: ABC transporter,
           transmembrane region, type 1 precursor - Shewanella sp.
           (strain W3-18-1)
          Length = 583

 Score = 41.1 bits (92), Expect = 0.019
 Identities = 18/37 (48%), Positives = 24/37 (64%)
 Frame = +2

Query: 299 GSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRR 409
           G  +LQ   LE+  G++  L+G  GCGKSSLLA + R
Sbjct: 353 GQSVLQGLSLEIKAGQKVALLGATGCGKSSLLALITR 389


>UniRef50_Q01BE6 Cluster: ABC transporter family protein; n=2;
           Ostreococcus|Rep: ABC transporter family protein -
           Ostreococcus tauri
          Length = 903

 Score = 41.1 bits (92), Expect = 0.019
 Identities = 21/61 (34%), Positives = 35/61 (57%), Gaps = 4/61 (6%)
 Frame = +2

Query: 254 CSRDIKIA----NFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVP 421
           CSR  +I     N +  +    L ++T L++  G R  ++G NGCGKS+L+  ++ RE P
Sbjct: 626 CSRSAQIVARVENVTHGYDEKTLFKNTSLQIERGERVAMIGDNGCGKSTLMRLIQGRERP 685

Query: 422 I 424
           +
Sbjct: 686 L 686


>UniRef50_Q08972 Cluster: [NU+] prion formation protein 1; n=16;
           Saccharomycetales|Rep: [NU+] prion formation protein 1 -
           Saccharomyces cerevisiae (Baker's yeast)
          Length = 1196

 Score = 41.1 bits (92), Expect = 0.019
 Identities = 23/48 (47%), Positives = 29/48 (60%), Gaps = 2/48 (4%)
 Frame = +2

Query: 266 IKIAN--FSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAAL 403
           I+I N  FS+ +    LL  T L L  G RYGL G NG GKS+L+ A+
Sbjct: 570 IEIVNTDFSLAYGSRMLLNKTNLRLLKGHRYGLCGRNGAGKSTLMRAI 617


>UniRef50_Q7VHQ0 Cluster: ABC transport system; n=25;
           Epsilonproteobacteria|Rep: ABC transport system -
           Helicobacter hepaticus
          Length = 536

 Score = 40.7 bits (91), Expect = 0.025
 Identities = 17/46 (36%), Positives = 30/46 (65%)
 Frame = +2

Query: 266 IKIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAAL 403
           ++  N S+ +   +L ++  ++L+  +RYGL+G NG GKS+LL  L
Sbjct: 2   LQTINLSMRYATKKLFENVNIKLDAHKRYGLIGANGAGKSTLLKIL 47


>UniRef50_O83157 Cluster: Amino acid ABC transporter, ATP-binding
           protein; n=1; Treponema pallidum|Rep: Amino acid ABC
           transporter, ATP-binding protein - Treponema pallidum
          Length = 269

 Score = 40.7 bits (91), Expect = 0.025
 Identities = 21/64 (32%), Positives = 34/64 (53%)
 Frame = +2

Query: 266 IKIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVPIPEHIDIF 445
           +++     T+ G  +L+D  LE+     YG++G +G GKS+LL  +   E P  E    +
Sbjct: 2   VRLERLKKTYAGVPILRDISLEIPAHGMYGIIGKSGAGKSTLLRIMSLLEKP-DEGAVFY 60

Query: 446 HLTR 457
           H TR
Sbjct: 61  HTTR 64


>UniRef50_Q2PY73 Cluster: ABC transporter ATP-binding protein; n=2;
           Bacteria|Rep: ABC transporter ATP-binding protein -
           uncultured marine bacterium Ant29B7
          Length = 663

 Score = 40.7 bits (91), Expect = 0.025
 Identities = 17/43 (39%), Positives = 28/43 (65%)
 Frame = +2

Query: 266 IKIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLL 394
           + +    ++F G++L +D   ++  G+R GLVG NG GKS+LL
Sbjct: 11  LSVHQLGLSFGGTDLFKDISFQVTPGQRLGLVGRNGAGKSTLL 53


>UniRef50_A5G6M6 Cluster: ABC transporter related; n=3;
           Geobacter|Rep: ABC transporter related - Geobacter
           uraniumreducens Rf4
          Length = 636

 Score = 40.7 bits (91), Expect = 0.025
 Identities = 18/52 (34%), Positives = 28/52 (53%)
 Frame = +2

Query: 266 IKIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVP 421
           ++ A  S  +   +LL D    +  G R G++G NGCGK++LL  +   E P
Sbjct: 321 LEFAGLSKAYGPKQLLSDVTFRMKRGDRVGIIGPNGCGKTTLLKMIMGEESP 372


>UniRef50_A4VSC8 Cluster: ABC-type multidrug transport system,
           ATPase component; n=3; Streptococcus suis|Rep: ABC-type
           multidrug transport system, ATPase component -
           Streptococcus suis (strain 05ZYH33)
          Length = 290

 Score = 40.7 bits (91), Expect = 0.025
 Identities = 22/54 (40%), Positives = 32/54 (59%), Gaps = 2/54 (3%)
 Frame = +2

Query: 266 IKIANFSITFYGSEL--LQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVP 421
           +KI + S  F G+E   L+D  LE+N G   GL+G NG GKS+L+  + +   P
Sbjct: 2   LKINHLSKQFAGNEFYSLKDVSLEINKGEIVGLIGKNGAGKSTLMKLMAKSLKP 55


>UniRef50_A0VU39 Cluster: ABC transporter related; n=1;
           Dinoroseobacter shibae DFL 12|Rep: ABC transporter
           related - Dinoroseobacter shibae DFL 12
          Length = 611

 Score = 40.7 bits (91), Expect = 0.025
 Identities = 19/52 (36%), Positives = 29/52 (55%)
 Frame = +2

Query: 266 IKIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVP 421
           I   N S+   GSE+L+D  + +  G R  + G +G GKS+LL+   R + P
Sbjct: 366 IAFENVSLNLGGSEILKDISISIRAGERVAITGPSGSGKSTLLSLAMRLQDP 417


>UniRef50_Q5KIM6 Cluster: Elongation factor 3; n=3;
           Basidiomycota|Rep: Elongation factor 3 - Cryptococcus
           neoformans (Filobasidiella neoformans)
          Length = 1055

 Score = 40.7 bits (91), Expect = 0.025
 Identities = 22/63 (34%), Positives = 33/63 (52%), Gaps = 3/63 (4%)
 Frame = +2

Query: 272 IANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREV---PIPEHIDI 442
           I  F++ +    LL    + L  G RYGL G NG GKS+L+ A+   +V   P P  +  
Sbjct: 449 IEQFNLAYGAKILLHHANMRLKRGHRYGLCGRNGSGKSTLMNAIINNQVEGFPPPTEVRT 508

Query: 443 FHL 451
           F++
Sbjct: 509 FYV 511


>UniRef50_P63390 Cluster: Uncharacterized ABC transporter
           ATP-binding protein yheS; n=46; cellular organisms|Rep:
           Uncharacterized ABC transporter ATP-binding protein yheS
           - Escherichia coli O157:H7
          Length = 637

 Score = 40.7 bits (91), Expect = 0.025
 Identities = 18/33 (54%), Positives = 24/33 (72%)
 Frame = +2

Query: 308 LLQDTLLELNCGRRYGLVGLNGCGKSSLLAALR 406
           LL +    +N G++ GLVG NGCGKS+LLA L+
Sbjct: 16  LLDNATATINPGQKVGLVGKNGCGKSTLLALLK 48



 Score = 36.7 bits (81), Expect = 0.40
 Identities = 19/50 (38%), Positives = 28/50 (56%), Gaps = 1/50 (2%)
 Frame = +2

Query: 296 YGSELLQDTL-LELNCGRRYGLVGLNGCGKSSLLAALRRREVPIPEHIDI 442
           YG  ++ D++ L L  G R GL+G NG GKS+L+  L     P+   I +
Sbjct: 322 YGDRIILDSIKLNLVPGSRIGLLGRNGAGKSTLIKLLAGELAPVSGEIGL 371


>UniRef50_UPI0000DAFA73 Cluster: protein YabJ; n=1; Campylobacter
           concisus 13826|Rep: protein YabJ - Campylobacter
           concisus 13826
          Length = 317

 Score = 40.3 bits (90), Expect = 0.033
 Identities = 21/60 (35%), Positives = 34/60 (56%)
 Frame = +2

Query: 266 IKIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVPIPEHIDIF 445
           IKI N  +++  SE+L    L++N  +   L+G NG GKS+L+  L R + P    I ++
Sbjct: 2   IKIRNLHLSYGKSEILNIPSLDINTKKITALMGSNGSGKSTLIRVLSRLQSPDSGEISLW 61


>UniRef50_Q8YBT8 Cluster: NITRATE TRANSPORT ATP-BINDING PROTEIN
           NRTC; n=9; Alphaproteobacteria|Rep: NITRATE TRANSPORT
           ATP-BINDING PROTEIN NRTC - Brucella melitensis
          Length = 266

 Score = 40.3 bits (90), Expect = 0.033
 Identities = 24/54 (44%), Positives = 34/54 (62%), Gaps = 1/54 (1%)
 Frame = +2

Query: 263 DIKIANFSITFYGS-ELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVP 421
           D+K+ N S  FYG  E+L+D  L++  G+   L+G +GCGKS+LL  L   E P
Sbjct: 13  DLKLQNIS-HFYGKVEVLKDISLDIPQGQIVCLIGPSGCGKSTLLRFLGGLERP 65


>UniRef50_Q73MV4 Cluster: ABC transporter, ATP-binding protein; n=1;
           Treponema denticola|Rep: ABC transporter, ATP-binding
           protein - Treponema denticola
          Length = 667

 Score = 40.3 bits (90), Expect = 0.033
 Identities = 17/43 (39%), Positives = 27/43 (62%)
 Frame = +2

Query: 266 IKIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLL 394
           I+++  S+ F   ++L+D  L L  G +  L G NGCGKS+L+
Sbjct: 4   IQLSKISLAFGDRDILKDITLILTAGTKAALTGANGCGKSTLM 46


>UniRef50_Q1NTN9 Cluster: ABC transporter related; n=2; delta
           proteobacterium MLMS-1|Rep: ABC transporter related -
           delta proteobacterium MLMS-1
          Length = 275

 Score = 40.3 bits (90), Expect = 0.033
 Identities = 20/45 (44%), Positives = 29/45 (64%)
 Frame = +2

Query: 269 KIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAAL 403
           ++ N    +  + +L++  LEL  GR YGLVG NGCGK++LL  L
Sbjct: 8   QLHNVFFAYDETTVLEEINLELAPGRFYGLVGPNGCGKTTLLDLL 52


>UniRef50_A6VQ22 Cluster: ABC transporter related; n=2;
           Pasteurellaceae|Rep: ABC transporter related -
           Actinobacillus succinogenes 130Z
          Length = 357

 Score = 40.3 bits (90), Expect = 0.033
 Identities = 21/48 (43%), Positives = 30/48 (62%)
 Frame = +2

Query: 278 NFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVP 421
           N S TF  +E+L++  L +N G  + L+G +GCGK+ LL  L   EVP
Sbjct: 8   NISKTFGSNEVLENLSLVVNNGECFTLLGPSGCGKTVLLRLLAGFEVP 55


>UniRef50_A4TCW4 Cluster: ABC transporter related; n=1;
           Mycobacterium gilvum PYR-GCK|Rep: ABC transporter
           related - Mycobacterium gilvum PYR-GCK
          Length = 267

 Score = 40.3 bits (90), Expect = 0.033
 Identities = 17/46 (36%), Positives = 27/46 (58%)
 Frame = +2

Query: 266 IKIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAAL 403
           +  A   +   G  +++D  +++  GR  G+VG NGCGKS+LL  L
Sbjct: 6   LSTAGLCVDLGGRRIVEDVSMDVPAGRVVGIVGPNGCGKSTLLRTL 51


>UniRef50_A1A0N6 Cluster: ABC transporter; n=1; Bifidobacterium
           adolescentis ATCC 15703|Rep: ABC transporter -
           Bifidobacterium adolescentis (strain ATCC 15703 / DSM
           20083)
          Length = 302

 Score = 40.3 bits (90), Expect = 0.033
 Identities = 22/54 (40%), Positives = 31/54 (57%)
 Frame = +2

Query: 257 SRDIKIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREV 418
           S  + I++ S + +G+ LL    LEL  G  +GL G NG GKS+LL  +  R V
Sbjct: 13  SMSLVISDLSKSRHGTSLLNGVNLELRSGAIHGLFGRNGAGKSTLLNIIANRLV 66


>UniRef50_A1WXT0 Cluster: Zinc import ATP-binding protein znuC; n=2;
           Ectothiorhodospiraceae|Rep: Zinc import ATP-binding
           protein znuC - Halorhodospira halophila (strain DSM 244
           / SL1) (Ectothiorhodospirahalophila (strain DSM 244 /
           SL1))
          Length = 260

 Score = 40.3 bits (90), Expect = 0.033
 Identities = 20/43 (46%), Positives = 28/43 (65%)
 Frame = +2

Query: 266 IKIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLL 394
           I++   ++TF G  +LQD  LE+  GR   LVG NG GK++LL
Sbjct: 18  IRLQEVAVTFGGRSILQDVRLEVVPGRITTLVGNNGAGKTTLL 60


>UniRef50_P48334 Cluster: Probable ABC transporter ATP-binding
           protein in ycf23-apcF intergenic region; n=1; Cyanophora
           paradoxa|Rep: Probable ABC transporter ATP-binding
           protein in ycf23-apcF intergenic region - Cyanophora
           paradoxa
          Length = 244

 Score = 40.3 bits (90), Expect = 0.033
 Identities = 18/59 (30%), Positives = 34/59 (57%)
 Frame = +2

Query: 260 RDIKIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVPIPEHI 436
           + ++I N ++++    +LQ+  L +  G+  G++G NG GKS+LL  +  +  PI   I
Sbjct: 7   KQLEINNLTVSYPHGTVLQNIFLTIESGKLIGIIGPNGAGKSTLLKTIIEQIKPISGEI 65


>UniRef50_P36028 Cluster: ABC transporter NFT1; n=5; Eukaryota|Rep:
            ABC transporter NFT1 - Saccharomyces cerevisiae (Baker's
            yeast)
          Length = 1558

 Score = 40.3 bits (90), Expect = 0.033
 Identities = 18/55 (32%), Positives = 34/55 (61%), Gaps = 2/55 (3%)
 Frame = +2

Query: 251  PCSRDIKIANFSITF--YGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRR 409
            P + D+++ N S+ +  + S+ L +   ++  G + G+VG  G GKSS++AA+ R
Sbjct: 1280 PQTGDVELKNLSLRYSPHSSKALDNVSFKVKAGTKVGIVGRTGAGKSSIIAAIYR 1334


>UniRef50_Q97RU9 Cluster: ABC transporter, ATP-binding protein;
           n=41; Streptococcaceae|Rep: ABC transporter, ATP-binding
           protein - Streptococcus pneumoniae
          Length = 213

 Score = 39.9 bits (89), Expect = 0.043
 Identities = 19/50 (38%), Positives = 28/50 (56%)
 Frame = +2

Query: 266 IKIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRRE 415
           I++ N S  F   +L  D  L    G+ Y L+G +GCGK++LL  + R E
Sbjct: 2   IELKNISKKFGSRQLFSDMNLHFEGGKIYALIGTSGCGKTTLLNMIGRLE 51


>UniRef50_Q8YP88 Cluster: ATP-binding protein of ABC transporter;
           n=5; Cyanobacteria|Rep: ATP-binding protein of ABC
           transporter - Anabaena sp. (strain PCC 7120)
          Length = 251

 Score = 39.9 bits (89), Expect = 0.043
 Identities = 28/100 (28%), Positives = 48/100 (48%), Gaps = 3/100 (3%)
 Frame = +2

Query: 275 ANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVPIPEHIDIFHLT 454
           A       G  +LQD   E+N G R  ++G +G GK+SLL  + R  +  P    IF   
Sbjct: 14  AKLKTQLQGYPILQDISFEINSGDRLAIIGPSGAGKTSLLRLINR--LSEPNSGKIFLEN 71

Query: 455 RGGARYPI---RPIVSRITIHGRRFTNVVTGKTLAFPNLI 565
           +   + P+   R IV+ + +   +F  +   + LA+P ++
Sbjct: 72  QEYPQIPVIQLRQIVT-LVLQEPKFLGMTVQQALAYPLIL 110


>UniRef50_Q7NTS2 Cluster: Probable cystine transport ATP-binding
           protein; n=1; Chromobacterium violaceum|Rep: Probable
           cystine transport ATP-binding protein - Chromobacterium
           violaceum
          Length = 255

 Score = 39.9 bits (89), Expect = 0.043
 Identities = 32/106 (30%), Positives = 49/106 (46%), Gaps = 1/106 (0%)
 Frame = +2

Query: 266 IKIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVPIPEHIDIF 445
           IK+++   +F G E+L D  L L  G    L+G +G GKS+LL      E P    + + 
Sbjct: 2   IKLSHIVKSFGGQEVLHDVSLALAEGGVTALIGPSGSGKSTLLRCANLLETPDGGELQLA 61

Query: 446 HLTRGGARY-PIRPIVSRITIHGRRFTNVVTGKTLAFPNLIALQDI 580
             T    R+ P R +     +  RR T +V      FP+   LQ++
Sbjct: 62  GET---LRFEPGRKLSRDAILRVRRVTGMVFQSFQLFPHQTVLQNV 104


>UniRef50_Q749P0 Cluster: ABC transporter, ATP-binding protein; n=3;
           Geobacter|Rep: ABC transporter, ATP-binding protein -
           Geobacter sulfurreducens
          Length = 246

 Score = 39.9 bits (89), Expect = 0.043
 Identities = 22/55 (40%), Positives = 28/55 (50%)
 Frame = +2

Query: 257 SRDIKIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVP 421
           S  I++ N   T+ G  +L    L L  GR Y L G NG GKS+LL+ L     P
Sbjct: 2   SECIRLTNIRTTYAGRTVLAIDRLTLRSGRIYTLTGANGAGKSTLLSHLALLTAP 56


>UniRef50_Q6MHH8 Cluster: ABC transporter, ATP-binding protein; n=1;
           Bdellovibrio bacteriovorus|Rep: ABC transporter,
           ATP-binding protein - Bdellovibrio bacteriovorus
          Length = 622

 Score = 39.9 bits (89), Expect = 0.043
 Identities = 19/53 (35%), Positives = 31/53 (58%)
 Frame = +2

Query: 266 IKIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVPI 424
           +++ N    +    +L+D  L L  G   G+VGLNG GKS+LL +L   ++P+
Sbjct: 296 LEVENVECGYGDKVILKDVTLRLERGNHLGIVGLNGAGKSTLLKSL-GEQIPL 347


>UniRef50_Q5P0U5 Cluster: ABC efflux transporter,
           permease/ATP-binding protein; n=1; Azoarcus sp.
           EbN1|Rep: ABC efflux transporter, permease/ATP-binding
           protein - Azoarcus sp. (strain EbN1) (Aromatoleum
           aromaticum (strain EbN1))
          Length = 572

 Score = 39.9 bits (89), Expect = 0.043
 Identities = 19/62 (30%), Positives = 33/62 (53%)
 Frame = +2

Query: 251 PCSRDIKIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVPIPE 430
           P   D+++ +    +  + +L    L++  GR+  LVG +G GKS+L+  L+R   P   
Sbjct: 342 PVRGDLRLVDVYFGYGETRVLDGASLDIPAGRKLALVGASGAGKSTLIDLLQRHYDPAAG 401

Query: 431 HI 436
           HI
Sbjct: 402 HI 403


>UniRef50_A7HJ39 Cluster: ABC transporter related; n=6;
           Bacteria|Rep: ABC transporter related - Fervidobacterium
           nodosum Rt17-B1
          Length = 535

 Score = 39.9 bits (89), Expect = 0.043
 Identities = 18/46 (39%), Positives = 30/46 (65%)
 Frame = +2

Query: 266 IKIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAAL 403
           +++ N S  +YG+++L++  + L  G   GLVG NG GKS+L+  L
Sbjct: 9   LEMRNISKFYYGNQVLKNVSISLKPGEILGLVGENGAGKSTLMNIL 54


>UniRef50_A6DPZ9 Cluster: ABC transporter ATP-binding protein; n=1;
           Lentisphaera araneosa HTCC2155|Rep: ABC transporter
           ATP-binding protein - Lentisphaera araneosa HTCC2155
          Length = 538

 Score = 39.9 bits (89), Expect = 0.043
 Identities = 18/46 (39%), Positives = 28/46 (60%)
 Frame = +2

Query: 266 IKIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAAL 403
           I ++N SI F    L ++  ++ + G RYGL+G NG GKS+ +  L
Sbjct: 2   IAVSNLSIRFGKRTLFEEVSVKFSPGCRYGLIGANGVGKSTFMKIL 47


>UniRef50_A5TSC3 Cluster: ABC superfamily ATP binding cassette
           transporter ABC protein; n=3; Fusobacterium
           nucleatum|Rep: ABC superfamily ATP binding cassette
           transporter ABC protein - Fusobacterium nucleatum subsp.
           polymorphum ATCC 10953
          Length = 633

 Score = 39.9 bits (89), Expect = 0.043
 Identities = 21/50 (42%), Positives = 28/50 (56%)
 Frame = +2

Query: 266 IKIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRRE 415
           + I N S TF    L +D  L++  G R GL+G NG GKS+LL  +   E
Sbjct: 332 LDIKNLSKTFEDKLLFKDLNLKVYRGERIGLIGKNGTGKSTLLKIINNLE 381


>UniRef50_A5MTT3 Cluster: ABC transporter, ATP-binding protein; n=1;
           Streptococcus pneumoniae SP23-BS72|Rep: ABC transporter,
           ATP-binding protein - Streptococcus pneumoniae SP23-BS72
          Length = 242

 Score = 39.9 bits (89), Expect = 0.043
 Identities = 21/63 (33%), Positives = 35/63 (55%)
 Frame = +2

Query: 266 IKIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVPIPEHIDIF 445
           ++I N + +F   E++ +T   LN G+ YG VG NG GK++++  +     P    I IF
Sbjct: 4   VEIINLTKSFKDIEVIHNTSFYLNKGKVYGFVGPNGAGKTTIIKMILGILKPDSGKITIF 63

Query: 446 HLT 454
           + T
Sbjct: 64  NQT 66


>UniRef50_A0YTM3 Cluster: ABC transporter-like protein; n=1; Lyngbya
           sp. PCC 8106|Rep: ABC transporter-like protein - Lyngbya
           sp. PCC 8106
          Length = 267

 Score = 39.9 bits (89), Expect = 0.043
 Identities = 27/87 (31%), Positives = 49/87 (56%), Gaps = 2/87 (2%)
 Frame = +2

Query: 248 APCSRDIKIANFSI-TFYGSE-LLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVP 421
           AP +  +++ N S+ +  G + +LQ+  LE+  G R  L+G++G GK+SLL  L R  + 
Sbjct: 17  APVNPQLQLNNVSLQSKIGFQPILQEISLEVQPGDRIALIGISGAGKTSLLRLLNR--LN 74

Query: 422 IPEHIDIFHLTRGGARYPIRPIVSRIT 502
            P + +IF   +   + P+  +  +IT
Sbjct: 75  SPSNGEIFFEGQNYTQIPVVQLRQQIT 101


>UniRef50_Q2FN01 Cluster: ABC transporter related; n=1;
           Methanospirillum hungatei JF-1|Rep: ABC transporter
           related - Methanospirillum hungatei (strain JF-1 / DSM
           864)
          Length = 254

 Score = 39.9 bits (89), Expect = 0.043
 Identities = 17/42 (40%), Positives = 25/42 (59%)
 Frame = +2

Query: 266 IKIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSL 391
           +++ N S TF   ++ +D    LN G   GL G +GCGKS+L
Sbjct: 5   LQVTNLSKTFGHGDIFRDVSFTLNAGETIGLFGPSGCGKSTL 46


>UniRef50_P15031 Cluster: Iron(III) dicitrate transport ATP-binding
           protein fecE; n=11; Gammaproteobacteria|Rep: Iron(III)
           dicitrate transport ATP-binding protein fecE -
           Escherichia coli (strain K12)
          Length = 255

 Score = 39.9 bits (89), Expect = 0.043
 Identities = 18/52 (34%), Positives = 30/52 (57%)
 Frame = +2

Query: 266 IKIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVP 421
           ++  N ++++   ++L D  L L  G+   L+G NGCGKS+LL    R  +P
Sbjct: 3   LRTENLTVSYGTDKVLNDVSLSLPTGKITALIGPNGCGKSTLLNCFSRLLMP 54


>UniRef50_Q8YTX9 Cluster: ATP-binding protein of ferrichrome ABC
           transporter; n=14; Bacteria|Rep: ATP-binding protein of
           ferrichrome ABC transporter - Anabaena sp. (strain PCC
           7120)
          Length = 289

 Score = 39.5 bits (88), Expect = 0.057
 Identities = 18/50 (36%), Positives = 29/50 (58%)
 Frame = +2

Query: 260 RDIKIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRR 409
           + +   + S+ + G  +++D  L +  G+   LVG NGCGKS+LL  L R
Sbjct: 26  KGLSTQSLSLAYDGVPIIRDLNLAIPTGKISALVGANGCGKSTLLRGLAR 75


>UniRef50_Q6ART0 Cluster: Probable Fe(III) ABC transporter,
           ATP-binding protein; n=1; Desulfotalea psychrophila|Rep:
           Probable Fe(III) ABC transporter, ATP-binding protein -
           Desulfotalea psychrophila
          Length = 282

 Score = 39.5 bits (88), Expect = 0.057
 Identities = 26/83 (31%), Positives = 39/83 (46%)
 Frame = +2

Query: 272 IANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVPIPEHIDIFHL 451
           + N S     +  + D  L L  G+ YG VG NGCGK++LL  L     P    I +   
Sbjct: 27  LENVSYAHGPNRAVDDISLRLEAGKFYGFVGPNGCGKTTLLDLLCGYRTPDQGRI-LLDG 85

Query: 452 TRGGARYPIRPIVSRITIHGRRF 520
            + GA YP + +  +I +  + F
Sbjct: 86  KKIGA-YPRKELAKKIALAPQEF 107


>UniRef50_Q31GF4 Cluster: ABC transporter ATP-binding protein
           homolog; n=1; Thiomicrospira crunogena XCL-2|Rep: ABC
           transporter ATP-binding protein homolog - Thiomicrospira
           crunogena (strain XCL-2)
          Length = 654

 Score = 39.5 bits (88), Expect = 0.057
 Identities = 19/38 (50%), Positives = 24/38 (63%)
 Frame = +2

Query: 308 LLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVP 421
           +L+D  L L  G R GLVG+NG GKS+LL  L +   P
Sbjct: 327 ILKDVDLTLRAGDRIGLVGVNGSGKSTLLKLLIKENTP 364



 Score = 37.5 bits (83), Expect = 0.23
 Identities = 17/32 (53%), Positives = 24/32 (75%)
 Frame = +2

Query: 308 LLQDTLLELNCGRRYGLVGLNGCGKSSLLAAL 403
           LLQ+  L L+ G++ GL+G NG GKS+LL A+
Sbjct: 16  LLQNASLTLHPGQKIGLIGQNGAGKSTLLKAI 47


>UniRef50_Q2LUX6 Cluster: ABC transporter ATP-binding protein; n=1;
           Syntrophus aciditrophicus SB|Rep: ABC transporter
           ATP-binding protein - Syntrophus aciditrophicus (strain
           SB)
          Length = 675

 Score = 39.5 bits (88), Expect = 0.057
 Identities = 21/60 (35%), Positives = 30/60 (50%), Gaps = 1/60 (1%)
 Frame = +2

Query: 245 CAPCSRD-IKIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVP 421
           C P  RD I +   S  +  +E+  +    +  G +  LVG+NG GKS+L   L R E P
Sbjct: 319 CPPSGRDAISVRGLSKAYGDNEVFSNVNFTVTRGEKIALVGMNGAGKSTLSRLLSRIEEP 378


>UniRef50_O51684 Cluster: ABC transporter, ATP-binding protein;
           n=143; Bacteria|Rep: ABC transporter, ATP-binding
           protein - Borrelia burgdorferi (Lyme disease spirochete)
          Length = 565

 Score = 39.5 bits (88), Expect = 0.057
 Identities = 25/105 (23%), Positives = 48/105 (45%), Gaps = 6/105 (5%)
 Frame = +2

Query: 266 IKIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAAL------RRREVPIP 427
           I ++N  + F    L +D  ++ + G  YG++G NG GKS+ L  L       + E+ IP
Sbjct: 24  ITVSNLEVAFGERVLFKDVNIKFSPGNCYGIIGANGAGKSTFLKVLGGMIEASKGEISIP 83

Query: 428 EHIDIFHLTRGGARYPIRPIVSRITIHGRRFTNVVTGKTLAFPNL 562
           ++  +  L +    Y    ++  + +  +R  +V   K   +  L
Sbjct: 84  KNQRVAALEQDQFAYDGYKVIDTVIMGHKRLYSVQKEKDEIYSKL 128


>UniRef50_Q24QN1 Cluster: Putative uncharacterized protein; n=1;
           Desulfitobacterium hafniense Y51|Rep: Putative
           uncharacterized protein - Desulfitobacterium hafniense
           (strain Y51)
          Length = 265

 Score = 39.5 bits (88), Expect = 0.057
 Identities = 15/52 (28%), Positives = 31/52 (59%)
 Frame = +2

Query: 266 IKIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVP 421
           ++I   ++ + G +++ D  L +  G+ Y ++G NGCGK++L+  + R   P
Sbjct: 9   LEIKGLTVGYKGRKIIDDLDLVIEKGKIYSIIGPNGCGKTTLMRTMSRNLKP 60


>UniRef50_Q1FH41 Cluster: ABC transporter related; n=1; Clostridium
           phytofermentans ISDg|Rep: ABC transporter related -
           Clostridium phytofermentans ISDg
          Length = 476

 Score = 39.5 bits (88), Expect = 0.057
 Identities = 18/45 (40%), Positives = 29/45 (64%)
 Frame = +2

Query: 269 KIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAAL 403
           K  + SI+F    +L+DT + +  G++  L+G NG GKSSL+ A+
Sbjct: 286 KAEDISISFGARSILEDTSIAIETGKKTFLLGENGTGKSSLIKAI 330


>UniRef50_Q0LHV4 Cluster: ABC transporter related; n=1;
           Herpetosiphon aurantiacus ATCC 23779|Rep: ABC
           transporter related - Herpetosiphon aurantiacus ATCC
           23779
          Length = 547

 Score = 39.5 bits (88), Expect = 0.057
 Identities = 20/50 (40%), Positives = 30/50 (60%)
 Frame = +2

Query: 266 IKIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRRE 415
           ++I N +  +   ++L D  L +N G R GLVG NG GKS+LL  +  +E
Sbjct: 3   LQINNLNKAYGPQQILSDIALIINRGERIGLVGPNGVGKSTLLRLIIGQE 52


>UniRef50_A4EER1 Cluster: Iron ABC transporter, ATP-binding protein,
           putative; n=3; Roseobacter|Rep: Iron ABC transporter,
           ATP-binding protein, putative - Roseobacter sp. CCS2
          Length = 260

 Score = 39.5 bits (88), Expect = 0.057
 Identities = 20/45 (44%), Positives = 27/45 (60%)
 Frame = +2

Query: 308 LLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVPIPEHIDI 442
           +L+ T  E+  G   G+VG NG GKS+LL  L R +VP   H+ I
Sbjct: 22  VLRTTSFEVQKGHVLGVVGPNGAGKSTLLRLLYRFQVPTTGHVKI 66


>UniRef50_A1IG86 Cluster: ATPase; n=4; Vibrionaceae|Rep: ATPase -
           Photobacterium phosphoreum
          Length = 345

 Score = 39.5 bits (88), Expect = 0.057
 Identities = 16/46 (34%), Positives = 29/46 (63%)
 Frame = +2

Query: 266 IKIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAAL 403
           + + + + ++YG  +LQD  L +  G    L+G +GCGK++LL A+
Sbjct: 5   LSVTDLTCSYYGQPILQDLSLAVERGEIVCLLGASGCGKTTLLKAI 50


>UniRef50_A0Q5B6 Cluster: (Putative) drug resistance ATPase-1 (Drug
           RA1) family protein; n=16; Francisella tularensis|Rep:
           (Putative) drug resistance ATPase-1 (Drug RA1) family
           protein - Francisella tularensis subsp. novicida (strain
           U112)
          Length = 613

 Score = 39.5 bits (88), Expect = 0.057
 Identities = 20/52 (38%), Positives = 30/52 (57%)
 Frame = +2

Query: 266 IKIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVP 421
           I + N S+ F    +L +  LE++ G+R  L+G NG GKSSLL  +    +P
Sbjct: 4   ISVKNVSLNFGTQIVLDNVNLEISKGQRICLIGRNGTGKSSLLKIIEGGVIP 55



 Score = 37.5 bits (83), Expect = 0.23
 Identities = 17/52 (32%), Positives = 28/52 (53%)
 Frame = +2

Query: 266 IKIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVP 421
           I+  N +  + G  L +D   E+  G +  ++G NGCGK++LL  L   + P
Sbjct: 314 IQAENIAFEYTGKYLFKDFSTEIQKGDKIAIIGQNGCGKTTLLNCLLGLDKP 365


>UniRef50_Q5T3U5 Cluster: Multidrug resistance-associated protein 7;
           n=27; Tetrapoda|Rep: Multidrug resistance-associated
           protein 7 - Homo sapiens (Human)
          Length = 1492

 Score = 39.5 bits (88), Expect = 0.057
 Identities = 26/73 (35%), Positives = 37/73 (50%)
 Frame = +2

Query: 326 LELNCGRRYGLVGLNGCGKSSLLAALRRREVPIPEHIDIFHLTRGGARYPIRPIVSRITI 505
           LE+  G   G+VG  GCGKSSLLAA+      +  H+ +  L++G       P +   TI
Sbjct: 621 LEVKKGMLVGIVGKVGCGKSSLLAAIAGELHRLRGHVAVRGLSKGFGLATQEPWIQFATI 680

Query: 506 HGRRFTNVVTGKT 544
                 N++ GKT
Sbjct: 681 R----DNILFGKT 689


>UniRef50_Q7WEH6 Cluster: Hemin import ATP-binding protein hmuV;
           n=6; Burkholderiales|Rep: Hemin import ATP-binding
           protein hmuV - Bordetella bronchiseptica (Alcaligenes
           bronchisepticus)
          Length = 262

 Score = 39.5 bits (88), Expect = 0.057
 Identities = 21/52 (40%), Positives = 29/52 (55%)
 Frame = +2

Query: 266 IKIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVP 421
           ++  N ++   G+ +L D  L L  G   GL+G NG GKS+LLAAL     P
Sbjct: 3   LQARNLTLARGGAPILTDVSLTLAPGTLVGLLGANGAGKSTLLAALAGELAP 54


>UniRef50_Q9KGC5 Cluster: ABC transporter; n=4; Firmicutes|Rep: ABC
           transporter - Bacillus halodurans
          Length = 220

 Score = 39.1 bits (87), Expect = 0.075
 Identities = 21/70 (30%), Positives = 34/70 (48%)
 Frame = +2

Query: 266 IKIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVPIPEHIDIF 445
           I++ N S    G  LL+   L+++  + YG+VG NG GKS     +    VP    + +F
Sbjct: 5   IEVQNLSKVVKGHHLLKKVQLKIDQPKVYGIVGRNGSGKSVFFKTIAGLLVPTEGTVKVF 64

Query: 446 HLTRGGARYP 475
               G  ++P
Sbjct: 65  GEDIGKGKFP 74


>UniRef50_Q8CP91 Cluster: ABC transporter protein; n=1;
           Staphylococcus epidermidis ATCC 12228|Rep: ABC
           transporter protein - Staphylococcus epidermidis (strain
           ATCC 12228)
          Length = 290

 Score = 39.1 bits (87), Expect = 0.075
 Identities = 17/52 (32%), Positives = 31/52 (59%)
 Frame = +2

Query: 266 IKIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVP 421
           ++  N   +F   E+L D   +L+ G + GL+G NG GKS+L+  + + ++P
Sbjct: 5   LEFRNVYKSFKKKEVLCDVNYKLSAGEKVGLIGSNGSGKSTLMKLIAKTQLP 56


>UniRef50_Q67QH3 Cluster: ABC transporter ATP-binding protein; n=1;
           Symbiobacterium thermophilum|Rep: ABC transporter
           ATP-binding protein - Symbiobacterium thermophilum
          Length = 561

 Score = 39.1 bits (87), Expect = 0.075
 Identities = 20/52 (38%), Positives = 26/52 (50%)
 Frame = +2

Query: 266 IKIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVP 421
           +++ N    F    +L     +L  G R GLVG NGCGKS+LL  L     P
Sbjct: 4   LQVRNLRKEFANRTVLDGVSFDLAQGERVGLVGRNGCGKSTLLRILAGELAP 55


>UniRef50_Q5FS63 Cluster: Ferrichrome ABC transporter ATP-binding
           protein; n=1; Gluconobacter oxydans|Rep: Ferrichrome ABC
           transporter ATP-binding protein - Gluconobacter oxydans
           (Gluconobacter suboxydans)
          Length = 256

 Score = 39.1 bits (87), Expect = 0.075
 Identities = 18/37 (48%), Positives = 24/37 (64%)
 Frame = +2

Query: 284 SITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLL 394
           S+T  G+ LL D  L++  G   GL+G NG GKS+LL
Sbjct: 9   SLTLQGNRLLNDIALDVRPGEVLGLIGPNGAGKSTLL 45


>UniRef50_Q8KVZ2 Cluster: RC198; n=1; Ruegeria sp. PR1b|Rep: RC198 -
           Ruegeria sp. PR1b
          Length = 287

 Score = 39.1 bits (87), Expect = 0.075
 Identities = 19/46 (41%), Positives = 27/46 (58%)
 Frame = +2

Query: 266 IKIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAAL 403
           +K  N  + +    +++D  L LN G    L+G NGCGKS+LL AL
Sbjct: 3   LKAENVKLCYGSRTVIEDLNLTLNEGEITALIGPNGCGKSTLLHAL 48


>UniRef50_Q8GEG0 Cluster: Putative uncharacterized protein; n=1;
           Erwinia amylovora|Rep: Putative uncharacterized protein
           - Erwinia amylovora (Fire blight bacteria)
          Length = 123

 Score = 39.1 bits (87), Expect = 0.075
 Identities = 16/22 (72%), Positives = 17/22 (77%)
 Frame = +1

Query: 523 KRCDWENPGVPQLNCLAGHSPF 588
           +R DWENPGV QLN LA H PF
Sbjct: 73  QRRDWENPGVTQLNRLAAHPPF 94


>UniRef50_Q47336 Cluster: LacZ-alpha peptide; n=2; cellular
           organisms|Rep: LacZ-alpha peptide - Escherichia coli
          Length = 90

 Score = 39.1 bits (87), Expect = 0.075
 Identities = 16/22 (72%), Positives = 17/22 (77%)
 Frame = +1

Query: 523 KRCDWENPGVPQLNCLAGHSPF 588
           +R DWENPGV QLN LA H PF
Sbjct: 27  QRRDWENPGVTQLNRLAAHPPF 48


>UniRef50_Q1QTW7 Cluster: ABC transporter related; n=2;
           Oceanospirillales|Rep: ABC transporter related -
           Chromohalobacter salexigens (strain DSM 3043 / ATCC
           BAA-138 / NCIMB13768)
          Length = 233

 Score = 39.1 bits (87), Expect = 0.075
 Identities = 19/35 (54%), Positives = 25/35 (71%)
 Frame = +2

Query: 308 LLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRR 412
           +L +  L L+ G R  L+G +G GKS+LLAALRRR
Sbjct: 21  VLAELTLTLHAGERVALLGPSGVGKSTLLAALRRR 55


>UniRef50_Q18YK1 Cluster: ABC transporter related; n=2;
           Desulfitobacterium hafniense|Rep: ABC transporter
           related - Desulfitobacterium hafniense (strain DCB-2)
          Length = 620

 Score = 39.1 bits (87), Expect = 0.075
 Identities = 21/56 (37%), Positives = 30/56 (53%)
 Frame = +2

Query: 239 TGCAPCSRDIKIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALR 406
           TG     R + + + S+ F G  L     +EL  G R  L+G NG GK+SLL A++
Sbjct: 310 TGRRSGDRTLMLEDVSVEFPGRRLFHGVDVELRRGDRVALLGENGIGKTSLLKAIK 365


>UniRef50_Q0STW8 Cluster: Iron compound ABC transporter, ATP-binding
           protein, putative; n=4; Clostridium|Rep: Iron compound
           ABC transporter, ATP-binding protein, putative -
           Clostridium perfringens (strain SM101 / Type A)
          Length = 251

 Score = 39.1 bits (87), Expect = 0.075
 Identities = 15/46 (32%), Positives = 28/46 (60%)
 Frame = +2

Query: 266 IKIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAAL 403
           +++ N    + G+E++ +    +N G    ++G NGCGKS++L AL
Sbjct: 2   LEVKNLCCGYDGNEVIHNLSFNINRGENISIIGPNGCGKSTVLKAL 47


>UniRef50_Q0AZU0 Cluster: ABC-type sugar (Aldose) transport system,
           ATPase component; n=1; Syntrophomonas wolfei subsp.
           wolfei str. Goettingen|Rep: ABC-type sugar (Aldose)
           transport system, ATPase component - Syntrophomonas
           wolfei subsp. wolfei (strain Goettingen)
          Length = 498

 Score = 39.1 bits (87), Expect = 0.075
 Identities = 19/54 (35%), Positives = 31/54 (57%)
 Frame = +2

Query: 266 IKIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVPIP 427
           ++IA  + T+ G+ +L +   +L  G  + LVG NG GKS+L+  +   E P P
Sbjct: 9   LEIAQLNKTYSGNRVLNNINFDLKLGEVHALVGENGAGKSTLIKIIAGVEKPDP 62


>UniRef50_A7IE56 Cluster: ABC transporter related precursor; n=7;
           Bacteria|Rep: ABC transporter related precursor -
           Xanthobacter sp. (strain Py2)
          Length = 549

 Score = 39.1 bits (87), Expect = 0.075
 Identities = 19/53 (35%), Positives = 30/53 (56%)
 Frame = +2

Query: 251 PCSRDIKIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRR 409
           P +R + + + ++T+ G   +    L ++ G    LVG NG GKSSLL A+ R
Sbjct: 282 PAARLLTVRDLNVTYGGLTAVDGVSLHIDEGEVLALVGANGAGKSSLLKAIGR 334


>UniRef50_A5Y460 Cluster: Mel; n=19; Bacteria|Rep: Mel -
           Acinetobacter baumannii
          Length = 491

 Score = 39.1 bits (87), Expect = 0.075
 Identities = 21/46 (45%), Positives = 27/46 (58%)
 Frame = +2

Query: 266 IKIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAAL 403
           IK  N  + + G ++L    LE++   R GLVG NG GKSSLL  L
Sbjct: 5   IKARNIRLDYAGRDVLDIDELEIHSYDRIGLVGDNGAGKSSLLKVL 50


>UniRef50_A3VGA6 Cluster: Ribose ABC transporter, ATP-binding
           protein; n=2; Rhodobacterales|Rep: Ribose ABC
           transporter, ATP-binding protein - Rhodobacterales
           bacterium HTCC2654
          Length = 544

 Score = 39.1 bits (87), Expect = 0.075
 Identities = 19/54 (35%), Positives = 28/54 (51%)
 Frame = +2

Query: 266 IKIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVPIP 427
           +++ N S TF  +  L    L +  G  +GL+G NG GKS+L+  L     P P
Sbjct: 22  LRLENISKTFRATRALDSVSLTIEPGEVHGLLGTNGSGKSTLIKVLAGFHAPDP 75


>UniRef50_A1SIE5 Cluster: ABC transporter related precursor; n=1;
           Nocardioides sp. JS614|Rep: ABC transporter related
           precursor - Nocardioides sp. (strain BAA-499 / JS614)
          Length = 362

 Score = 39.1 bits (87), Expect = 0.075
 Identities = 36/115 (31%), Positives = 55/115 (47%)
 Frame = +2

Query: 236 VTGCAPCSRDIKIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRRE 415
           +TG    +R +++A  S T+ G   ++   LEL  G    L+G +GCGKS+LLA +   E
Sbjct: 1   MTGAVIGAR-VRLAGLSKTYDGVCAVEQADLELAPGSFTALLGPSGCGKSTLLAMVAGLE 59

Query: 416 VPIPEHIDIFHLTRGGARYPIRPIVSRITIHGRRFTNVVTGKTLAFPNLIALQDI 580
            P     D   +   GA+    P  SR          +V  K L FP+L A+ ++
Sbjct: 60  RP-----DAGEVILDGAQVTAAPAESRP-------IGLVFQKPLLFPHLTAVDNV 102


>UniRef50_A0RRP7 Cluster: Ferrichrome transport ATP-binding protein
           FhuC; n=1; Campylobacter fetus subsp. fetus 82-40|Rep:
           Ferrichrome transport ATP-binding protein FhuC -
           Campylobacter fetus subsp. fetus (strain 82-40)
          Length = 258

 Score = 39.1 bits (87), Expect = 0.075
 Identities = 17/43 (39%), Positives = 27/43 (62%)
 Frame = +2

Query: 266 IKIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLL 394
           I+I N S  F  +++L    +++N     G++G NGCGKS+LL
Sbjct: 3   IEILNLSFKFNKNQILNKLNIQINSAEFIGILGPNGCGKSTLL 45


>UniRef50_Q37953 Cluster: LacZ protein; n=1; Phage M13mp18|Rep: LacZ
           protein - Phage M13mp18
          Length = 102

 Score = 39.1 bits (87), Expect = 0.075
 Identities = 16/22 (72%), Positives = 17/22 (77%)
 Frame = +1

Query: 523 KRCDWENPGVPQLNCLAGHSPF 588
           +R DWENPGV QLN LA H PF
Sbjct: 31  QRRDWENPGVTQLNRLAAHPPF 52


>UniRef50_P57445 Cluster: ABC transporter ATP-binding protein uup;
           n=2; Buchnera aphidicola|Rep: ABC transporter
           ATP-binding protein uup - Buchnera aphidicola subsp.
           Acyrthosiphon pisum (Acyrthosiphon pisumsymbiotic
           bacterium)
          Length = 596

 Score = 39.1 bits (87), Expect = 0.075
 Identities = 17/50 (34%), Positives = 30/50 (60%)
 Frame = +2

Query: 266 IKIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRRE 415
           I I N S++F   ++L+ +   +N   R  L+G NG GKS+LL  + +++
Sbjct: 4   INIHNASLSFSNLQILEKSTFHINKNERVCLIGKNGAGKSTLLKIINKKQ 53


>UniRef50_P00722 Cluster: Beta-galactosidase; n=35; root|Rep:
           Beta-galactosidase - Escherichia coli (strain K12)
          Length = 1024

 Score = 39.1 bits (87), Expect = 0.075
 Identities = 16/22 (72%), Positives = 17/22 (77%)
 Frame = +1

Query: 523 KRCDWENPGVPQLNCLAGHSPF 588
           +R DWENPGV QLN LA H PF
Sbjct: 13  QRRDWENPGVTQLNRLAAHPPF 34


>UniRef50_Q8RF38 Cluster: Hemin transport system ATP-binding protein
           hmuV; n=1; Fusobacterium nucleatum subsp. nucleatum|Rep:
           Hemin transport system ATP-binding protein hmuV -
           Fusobacterium nucleatum subsp. nucleatum
          Length = 256

 Score = 38.7 bits (86), Expect = 0.100
 Identities = 19/49 (38%), Positives = 32/49 (65%)
 Frame = +2

Query: 263 DIKIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRR 409
           ++K  NFSI     +++QD  +++N G+  G++G NG GKS+LL  + R
Sbjct: 8   EVKKLNFSIE--NKKIIQDISIKVNQGQFIGVIGANGSGKSTLLKNVYR 54


>UniRef50_Q8A8C5 Cluster: ABC transporter ATP-binding protein; n=36;
           Bacteria|Rep: ABC transporter ATP-binding protein -
           Bacteroides thetaiotaomicron
          Length = 539

 Score = 38.7 bits (86), Expect = 0.100
 Identities = 17/46 (36%), Positives = 25/46 (54%)
 Frame = +2

Query: 266 IKIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAAL 403
           I ++N S+ F    L  D  L+   G  YG++G NG GKS+ L  +
Sbjct: 2   ITVSNVSVQFGKRVLFNDVNLKFTSGNCYGIIGANGAGKSTFLRTI 47


>UniRef50_Q45593 Cluster: YydI protein; n=13; Bacillales|Rep: YydI
           protein - Bacillus subtilis
          Length = 209

 Score = 38.7 bits (86), Expect = 0.100
 Identities = 19/42 (45%), Positives = 26/42 (61%)
 Frame = +2

Query: 266 IKIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSL 391
           + IAN+++   G  LLQDT L  + G+   +VG NG GKS L
Sbjct: 1   MNIANYTLKVKGKTLLQDTDLHFSSGKINHVVGKNGVGKSQL 42


>UniRef50_Q39ML3 Cluster: ABC transporter, duplicated ATPase
           domains; n=7; Proteobacteria|Rep: ABC transporter,
           duplicated ATPase domains - Burkholderia sp. (strain
           383) (Burkholderia cepacia (strain ATCC 17760/ NCIB 9086
           / R18194))
          Length = 574

 Score = 38.7 bits (86), Expect = 0.100
 Identities = 19/38 (50%), Positives = 21/38 (55%)
 Frame = +2

Query: 308 LLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVP 421
           L QD    +  G R GL+G NGCGKSSLL  L     P
Sbjct: 19  LFQDLSFTVKLGDRIGLIGHNGCGKSSLLDVLAGSREP 56


>UniRef50_Q2RW13 Cluster: ABC transporter component; n=1;
           Rhodospirillum rubrum ATCC 11170|Rep: ABC transporter
           component - Rhodospirillum rubrum (strain ATCC 11170 /
           NCIB 8255)
          Length = 589

 Score = 38.7 bits (86), Expect = 0.100
 Identities = 22/69 (31%), Positives = 33/69 (47%)
 Frame = +2

Query: 236 VTGCAPCSRDIKIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRRE 415
           + G AP     +    S++   SE+L+D    +  GR   +VG +G GKSS+L  L R  
Sbjct: 329 LAGSAPIGEAARFFGVSLSLGESEVLEDVSFSVPQGRLTAIVGPSGAGKSSILRLLNRSW 388

Query: 416 VPIPEHIDI 442
            P    I +
Sbjct: 389 DPTAGRIHL 397


>UniRef50_Q26HC0 Cluster: ABC transporter, ATP binding component;
           n=14; Bacteroidetes|Rep: ABC transporter, ATP binding
           component - Flavobacteria bacterium BBFL7
          Length = 247

 Score = 38.7 bits (86), Expect = 0.100
 Identities = 22/57 (38%), Positives = 31/57 (54%)
 Frame = +2

Query: 266 IKIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVPIPEHI 436
           I I N S  + G+++L    LE+  G+  GLVG NG GK++L + L     P   HI
Sbjct: 2   ITINNLSKQYNGTKVLDIESLEIPAGQAIGLVGNNGAGKTTLFSLLLDLIQPSTGHI 58


>UniRef50_A6ULC5 Cluster: ABC transporter related; n=1;
           Sinorhizobium medicae WSM419|Rep: ABC transporter
           related - Sinorhizobium medicae WSM419
          Length = 516

 Score = 38.7 bits (86), Expect = 0.100
 Identities = 19/56 (33%), Positives = 31/56 (55%)
 Frame = +2

Query: 236 VTGCAPCSRDIKIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAAL 403
           V G + C   ++    + +F G+ +L    L+L+ G   GL+G NG GKS+L+  L
Sbjct: 15  VAGISSCGPLLRARGIAKSFAGNTVLHSVDLDLHAGEVVGLLGENGAGKSTLMHIL 70


>UniRef50_A6EDK3 Cluster: ABC transporter ATP-binding protein; n=1;
           Pedobacter sp. BAL39|Rep: ABC transporter ATP-binding
           protein - Pedobacter sp. BAL39
          Length = 620

 Score = 38.7 bits (86), Expect = 0.100
 Identities = 19/53 (35%), Positives = 28/53 (52%)
 Frame = +2

Query: 266 IKIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVPI 424
           I   N    ++   L ++  L +  G+R  LVG+NG GKS+LL  L  R  P+
Sbjct: 5   IAAENLGHAYHNEWLFKNLTLGIQTGQRVALVGINGAGKSTLLKLLAERFSPL 57


>UniRef50_A6EA96 Cluster: Putative ABC transporter ATP-binding
           protein; n=1; Pedobacter sp. BAL39|Rep: Putative ABC
           transporter ATP-binding protein - Pedobacter sp. BAL39
          Length = 275

 Score = 38.7 bits (86), Expect = 0.100
 Identities = 20/44 (45%), Positives = 30/44 (68%), Gaps = 1/44 (2%)
 Frame = +2

Query: 266 IKIANFSITFYGSELL-QDTLLELNCGRRYGLVGLNGCGKSSLL 394
           IKI++ +  +   +LL +D  ++L+ G  YGL+G NG GKSSLL
Sbjct: 2   IKISDLNFGYPRQQLLFRDMNVQLSAGHIYGLLGKNGAGKSSLL 45


>UniRef50_A3TJ17 Cluster: Putative ABC transporter ATP-binding
           protein; n=1; Janibacter sp. HTCC2649|Rep: Putative ABC
           transporter ATP-binding protein - Janibacter sp.
           HTCC2649
          Length = 538

 Score = 38.7 bits (86), Expect = 0.100
 Identities = 19/28 (67%), Positives = 21/28 (75%)
 Frame = +2

Query: 326 LELNCGRRYGLVGLNGCGKSSLLAALRR 409
           L+L  GRR GLVG NG GKS+LLA L R
Sbjct: 346 LDLPPGRRIGLVGANGTGKSTLLAVLAR 373


>UniRef50_A1G3R5 Cluster: ABC transporter related; n=2;
           Salinispora|Rep: ABC transporter related - Salinispora
           arenicola CNS205
          Length = 505

 Score = 38.7 bits (86), Expect = 0.100
 Identities = 17/46 (36%), Positives = 28/46 (60%)
 Frame = +2

Query: 266 IKIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAAL 403
           +++ N    + G+ +L D  L++  GR   +VG NG GKS+LL A+
Sbjct: 267 LRVRNLRAGYTGAPMLTDITLDVRAGRVTAVVGRNGAGKSTLLNAI 312


>UniRef50_Q8GU66 Cluster: MRP-like ABC transporter; n=2; Oryza
            sativa|Rep: MRP-like ABC transporter - Oryza sativa
            subsp. japonica (Rice)
          Length = 1483

 Score = 38.7 bits (86), Expect = 0.100
 Identities = 20/64 (31%), Positives = 34/64 (53%), Gaps = 2/64 (3%)
 Frame = +2

Query: 251  PCSRDIKIANFSITFYGSE--LLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVPI 424
            P   DI + +  + +  +   +L+   + +N G + G+VG  G GKS+L+ AL R   P+
Sbjct: 1232 PRRGDIDVKDLKVRYRSNTPLILKGITISINSGEKIGVVGRTGSGKSTLVQALFRLVEPV 1291

Query: 425  PEHI 436
              HI
Sbjct: 1292 EGHI 1295


>UniRef50_Q6GYA9 Cluster: ABCF-type protein; n=4; cellular
           organisms|Rep: ABCF-type protein - Zea mays (Maize)
          Length = 705

 Score = 38.7 bits (86), Expect = 0.100
 Identities = 18/61 (29%), Positives = 33/61 (54%)
 Frame = +2

Query: 239 TGCAPCSRDIKIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREV 418
           +G +     +++   S ++ G  +L+D   E+  G + GLVG+NG GK++ L  +   E 
Sbjct: 102 SGASSIPSGVRLEGISKSYKGVTVLKDVSWEVQRGEKVGLVGVNGAGKTTQLRIIAGLEK 161

Query: 419 P 421
           P
Sbjct: 162 P 162



 Score = 34.7 bits (76), Expect = 1.6
 Identities = 17/52 (32%), Positives = 25/52 (48%)
 Frame = +2

Query: 266 IKIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVP 421
           + I N    F    L  +  L +  G +  ++G NGCGKS+LL  +   E P
Sbjct: 438 LTINNLQFGFENKTLFNNANLIVERGEKIAIIGPNGCGKSTLLKLMLGMEKP 489


>UniRef50_Q24809 Cluster: P-glycoprotein 6; n=3; Entamoeba
           histolytica|Rep: P-glycoprotein 6 - Entamoeba
           histolytica
          Length = 1282

 Score = 38.7 bits (86), Expect = 0.100
 Identities = 18/45 (40%), Positives = 27/45 (60%)
 Frame = +2

Query: 308 LLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVPIPEHIDI 442
           +L +  LE+  G   GLVG +GCGKS+++  L+R   P+   I I
Sbjct: 398 ILNNFNLEIKAGHSVGLVGASGCGKSTIIGLLQRLYEPVDGKIMI 442


>UniRef50_A4QWE4 Cluster: Putative uncharacterized protein; n=1;
            Magnaporthe grisea|Rep: Putative uncharacterized protein
            - Magnaporthe grisea (Rice blast fungus) (Pyricularia
            grisea)
          Length = 1458

 Score = 38.7 bits (86), Expect = 0.100
 Identities = 22/69 (31%), Positives = 35/69 (50%), Gaps = 2/69 (2%)
 Frame = +2

Query: 242  GCAPCSRDIKIANFSITFYGSE--LLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRRE 415
            G  P    I+  N +  +  S+  +L+D  LE+  G R  +VG  G GKSS++  L RR 
Sbjct: 1010 GVWPRCGSIRFTNVTAKYDQSDKLVLKDVTLEIKPGERVAIVGRTGAGKSSIIQTLLRRT 1069

Query: 416  VPIPEHIDI 442
              +   ++I
Sbjct: 1070 QVVSGSVEI 1078


>UniRef50_Q0PAB6 Cluster: Methionine import ATP-binding protein
           metN; n=31; Bacteria|Rep: Methionine import ATP-binding
           protein metN - Campylobacter jejuni
          Length = 336

 Score = 38.7 bits (86), Expect = 0.100
 Identities = 22/51 (43%), Positives = 29/51 (56%), Gaps = 1/51 (1%)
 Frame = +2

Query: 266 IKIANFSITFYGSEL-LQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRRE 415
           IKI N    +YG EL + D  LE+  G  Y +VG +G GKS+LL  +   E
Sbjct: 2   IKIKNLK-KYYGKELVINDVSLEIKKGEIYAIVGHSGAGKSTLLRCINGLE 51


>UniRef50_Q9HT70 Cluster: Methionine import ATP-binding protein metN
           2; n=40; Proteobacteria|Rep: Methionine import
           ATP-binding protein metN 2 - Pseudomonas aeruginosa
          Length = 335

 Score = 38.7 bits (86), Expect = 0.100
 Identities = 29/91 (31%), Positives = 42/91 (46%), Gaps = 5/91 (5%)
 Frame = +2

Query: 311 LQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVP-----IPEHIDIFHLTRGGARYP 475
           LQ T L +  G+ +GL+G +G GKS+LL  + R E P     + E  D+  L   G R  
Sbjct: 21  LQPTRLNIQAGQIFGLIGHSGAGKSTLLRLINRLEEPSGGRILVEGEDVTALDAEGLR-R 79

Query: 476 IRPIVSRITIHGRRFTNVVTGKTLAFPNLIA 568
            R  V  I  H    ++      +A P  +A
Sbjct: 80  FRQRVGMIFQHFNLLSSKTVADNIAMPLRLA 110


>UniRef50_UPI00015BE7EC Cluster: UPI00015BE7EC related cluster; n=1;
           unknown|Rep: UPI00015BE7EC UniRef100 entry - unknown
          Length = 565

 Score = 38.3 bits (85), Expect = 0.13
 Identities = 19/46 (41%), Positives = 27/46 (58%)
 Frame = +2

Query: 266 IKIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAAL 403
           I + N  +T    E+L+D  L +N G + G+VG  G GKS+LL  L
Sbjct: 332 IVMKNVYVTIDSKEILKDINLTINPGEKIGIVGPTGAGKSTLLDIL 377


>UniRef50_Q8GH71 Cluster: MtsC; n=2; Lactobacillus|Rep: MtsC -
           Lactobacillus plantarum
          Length = 251

 Score = 38.3 bits (85), Expect = 0.13
 Identities = 13/46 (28%), Positives = 28/46 (60%)
 Frame = +2

Query: 266 IKIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAAL 403
           +K+ N ++ +  + +  D  +  N G+  G++G NG GKS+++ A+
Sbjct: 8   LKVQNLTVAYSDTPVFTDVAVNFNAGKITGIIGPNGAGKSTMIKAM 53


>UniRef50_Q7UMP5 Cluster: ABC transporter ATP binding protein; n=1;
           Pirellula sp.|Rep: ABC transporter ATP binding protein -
           Rhodopirellula baltica
          Length = 331

 Score = 38.3 bits (85), Expect = 0.13
 Identities = 19/46 (41%), Positives = 28/46 (60%)
 Frame = +2

Query: 266 IKIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAAL 403
           + + N S  F  +E L D  L++  G  +GL+GLNG GK++LL  L
Sbjct: 13  VVVENLSQRFGRTEALNDVSLKIPQGTVFGLLGLNGAGKTTLLRHL 58


>UniRef50_Q5L3A4 Cluster: ABC transporter; n=1; Geobacillus
           kaustophilus|Rep: ABC transporter - Geobacillus
           kaustophilus
          Length = 217

 Score = 38.3 bits (85), Expect = 0.13
 Identities = 22/63 (34%), Positives = 32/63 (50%)
 Frame = +2

Query: 266 IKIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVPIPEHIDIF 445
           I ++N S T    E+L++  LEL  G+ YG VG NG GK+ L   +     P    + +F
Sbjct: 4   IVLSNVSKTIKAREVLRNINLELERGKIYGFVGPNGSGKTMLFRVISGLVKPSSGTVAVF 63

Query: 446 HLT 454
             T
Sbjct: 64  GQT 66


>UniRef50_Q2RMD1 Cluster: ABC transporter related; n=1; Moorella
           thermoacetica ATCC 39073|Rep: ABC transporter related -
           Moorella thermoacetica (strain ATCC 39073)
          Length = 356

 Score = 38.3 bits (85), Expect = 0.13
 Identities = 22/60 (36%), Positives = 33/60 (55%)
 Frame = +2

Query: 242 GCAPCSRDIKIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVP 421
           G + C+RD+++        G ++L    LE+  G  +GL+G NG GKS+LL  L   E P
Sbjct: 2   GISICARDVRVIKG-----GRQVLAVDDLEIGPGEVWGLIGPNGAGKSTLLQVLALLEKP 56


>UniRef50_Q4HDR6 Cluster: Iron (III) ABC transporter, ATP-binding
           protein; n=11; Campylobacter|Rep: Iron (III) ABC
           transporter, ATP-binding protein - Campylobacter coli
           RM2228
          Length = 259

 Score = 38.3 bits (85), Expect = 0.13
 Identities = 19/43 (44%), Positives = 28/43 (65%)
 Frame = +2

Query: 266 IKIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLL 394
           +KI N S +++  ELL++  LEL      G++G NG GKS+LL
Sbjct: 3   LKIQNLSFSYHKKELLKNINLELQNKAFIGILGPNGSGKSTLL 45


>UniRef50_Q2IRS5 Cluster: ABC transporter related; n=3;
           Proteobacteria|Rep: ABC transporter related -
           Rhodopseudomonas palustris (strain HaA2)
          Length = 252

 Score = 38.3 bits (85), Expect = 0.13
 Identities = 19/48 (39%), Positives = 29/48 (60%)
 Frame = +2

Query: 266 IKIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRR 409
           I + N S+ + G+ +L+D  LE+       L+G NG GKSSLL+ + R
Sbjct: 2   IVVKNISLAYQGARILRDINLEIPETGVTALIGPNGAGKSSLLSLIAR 49


>UniRef50_Q1VK95 Cluster: Branched-chain amino acid ABC transporter,
           ATP-binding protein; n=1; Psychroflexus torquis ATCC
           700755|Rep: Branched-chain amino acid ABC transporter,
           ATP-binding protein - Psychroflexus torquis ATCC 700755
          Length = 157

 Score = 38.3 bits (85), Expect = 0.13
 Identities = 24/95 (25%), Positives = 44/95 (46%)
 Frame = +2

Query: 266 IKIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVPIPEHIDIF 445
           +++ N ++ F G   +QD   ++  G    ++G NG GKSS+L  +     P   H+   
Sbjct: 27  MEMQNITLRFGGVVAIQDISFDIREGEIRAIIGPNGAGKSSMLNVINGFYHPQEGHV--- 83

Query: 446 HLTRGGARYPIRPIVSRITIHGRRFTNVVTGKTLA 550
            + +G  R P++P         R F N+   K ++
Sbjct: 84  -IYKGEVRKPLKPYEIAHQGIARTFQNIALFKGMS 117


>UniRef50_A6GU25 Cluster: ABC transporter related protein; n=1;
           Limnobacter sp. MED105|Rep: ABC transporter related
           protein - Limnobacter sp. MED105
          Length = 637

 Score = 38.3 bits (85), Expect = 0.13
 Identities = 21/46 (45%), Positives = 27/46 (58%)
 Frame = +2

Query: 266 IKIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAAL 403
           I+I N SI      +L +  L L  G + GL+G NG GKSS L+AL
Sbjct: 2   IQINNLSIARGSKPILTNAELTLFPGEKVGLIGHNGAGKSSFLSAL 47


>UniRef50_A5TVU5 Cluster: Cation ABC superfamily ATP binding
           cassette transporter ABC protein; n=3; Fusobacterium
           nucleatum|Rep: Cation ABC superfamily ATP binding
           cassette transporter ABC protein - Fusobacterium
           nucleatum subsp. polymorphum ATCC 10953
          Length = 239

 Score = 38.3 bits (85), Expect = 0.13
 Identities = 18/47 (38%), Positives = 30/47 (63%)
 Frame = +2

Query: 263 DIKIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAAL 403
           +I+I + ++   G+E+L+D  L +  G  + LVG NG GK+SLL  +
Sbjct: 15  EIQIKDLNLVLSGNEILEDINLTVKAGEIHCLVGPNGGGKTSLLRCI 61


>UniRef50_A1T072 Cluster: ABC transporter for cysteine ATP-binding
           protein precursor; n=6; Alteromonadales|Rep: ABC
           transporter for cysteine ATP-binding protein precursor -
           Psychromonas ingrahamii (strain 37)
          Length = 592

 Score = 38.3 bits (85), Expect = 0.13
 Identities = 19/47 (40%), Positives = 26/47 (55%)
 Frame = +2

Query: 281 FSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVP 421
           FS    G E+L+   L +  G +  L+G  GCGKSSLL+ + R   P
Sbjct: 348 FSYEKGGVEILKGINLSIKVGEKVALLGPTGCGKSSLLSLITREWAP 394


>UniRef50_A7SSK8 Cluster: Predicted protein; n=6; Nematostella
            vectensis|Rep: Predicted protein - Nematostella vectensis
          Length = 1191

 Score = 38.3 bits (85), Expect = 0.13
 Identities = 22/64 (34%), Positives = 36/64 (56%), Gaps = 2/64 (3%)
 Frame = +2

Query: 251  PCSRDIKIANFSITFY--GSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVPI 424
            P   ++++ + S+ +Y  GS  L++  + +    + G+VG  G GKSSL+AAL R   P 
Sbjct: 980  PDRGELRLQDVSLAYYEGGSCALEEVNVRIQAKGKVGIVGRTGAGKSSLVAALFRMPEPK 1039

Query: 425  PEHI 436
             E I
Sbjct: 1040 GEVI 1043


>UniRef50_Q8SR22 Cluster: ABC TRANSPORTER; n=1; Encephalitozoon
           cuniculi|Rep: ABC TRANSPORTER - Encephalitozoon cuniculi
          Length = 572

 Score = 38.3 bits (85), Expect = 0.13
 Identities = 18/48 (37%), Positives = 28/48 (58%)
 Frame = +2

Query: 266 IKIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRR 409
           I+  + SI      +++    E+  G + G++G NGCGKSSL+ AL R
Sbjct: 346 IRFVDMSIYIGNKPVVKGFTGEIRKGEKVGIIGKNGCGKSSLINALLR 393


>UniRef50_Q7Z991 Cluster: CCR4-Not complex subunit Caf16; n=3;
           Dikarya|Rep: CCR4-Not complex subunit Caf16 -
           Schizosaccharomyces pombe (Fission yeast)
          Length = 280

 Score = 38.3 bits (85), Expect = 0.13
 Identities = 32/105 (30%), Positives = 47/105 (44%), Gaps = 3/105 (2%)
 Frame = +2

Query: 263 DIKIANFSITFYGSE--LLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVPIPEHI 436
           ++ ++N S TF   +   L    L+L  G R  LVG NG GKS+LL  L  + +    HI
Sbjct: 2   EVTVSNLSYTFSPKQPLSLDHVTLDLPKGSRTLLVGANGAGKSTLLKLLSGKSLAKAGHI 61

Query: 437 DIFHLTRGGARYPIRPIVSRITIHGRRF-TNVVTGKTLAFPNLIA 568
            +      G + P R   S     G  +  N V  + ++   LIA
Sbjct: 62  SV------GGKDPFRESSSAFVYLGTEWVNNPVIHRDMSVARLIA 100


>UniRef50_Q6BJS4 Cluster: Similar to tr|Q8H0V6 Arabidopsis thaliana
           putative ABC transporter protein; n=1; Debaryomyces
           hansenii|Rep: Similar to tr|Q8H0V6 Arabidopsis thaliana
           putative ABC transporter protein - Debaryomyces hansenii
           (Yeast) (Torulaspora hansenii)
          Length = 187

 Score = 38.3 bits (85), Expect = 0.13
 Identities = 21/47 (44%), Positives = 29/47 (61%)
 Frame = +2

Query: 263 DIKIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAAL 403
           D+K  N S+     +L+ DT L+L  G  YGLVG NG GK++LL  +
Sbjct: 40  DLKQVNISVG--DRDLIVDTDLQLFAGIHYGLVGGNGTGKTTLLKCI 84


>UniRef50_Q06034 Cluster: Multidrug resistance protein 1; n=8;
           Leishmania|Rep: Multidrug resistance protein 1 -
           Leishmania enriettii
          Length = 1280

 Score = 38.3 bits (85), Expect = 0.13
 Identities = 16/42 (38%), Positives = 26/42 (61%)
 Frame = +2

Query: 299 GSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVPI 424
           G  L +D  L++ CG++    G +GCGKSS++  ++R   PI
Sbjct: 405 GMILFRDLSLKIKCGQKVAFSGASGCGKSSVIGLIQRFYDPI 446


>UniRef50_Q9KNX2 Cluster: ABC transporter, ATP-binding protein;
           n=82; Proteobacteria|Rep: ABC transporter, ATP-binding
           protein - Vibrio cholerae
          Length = 664

 Score = 37.9 bits (84), Expect = 0.17
 Identities = 17/36 (47%), Positives = 23/36 (63%)
 Frame = +2

Query: 299 GSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALR 406
           G  LL+     ++ G + GLVG NGCGKS+L A L+
Sbjct: 39  GKPLLEQASATIHPGDKVGLVGKNGCGKSTLFALLK 74



 Score = 32.7 bits (71), Expect = 6.5
 Identities = 17/37 (45%), Positives = 23/37 (62%), Gaps = 1/37 (2%)
 Frame = +2

Query: 296 YGSELLQDTL-LELNCGRRYGLVGLNGCGKSSLLAAL 403
           YG  L+ + + L L  G R GL+G NG GKS+L+  L
Sbjct: 348 YGDHLILEKIRLNLVPGSRIGLLGRNGAGKSTLIKLL 384


>UniRef50_Q929U5 Cluster: Lin2179 protein; n=44; Bacilli|Rep:
           Lin2179 protein - Listeria innocua
          Length = 650

 Score = 37.9 bits (84), Expect = 0.17
 Identities = 18/35 (51%), Positives = 25/35 (71%), Gaps = 1/35 (2%)
 Frame = +2

Query: 293 FYGSELLQDTL-LELNCGRRYGLVGLNGCGKSSLL 394
           F+G+E++ D + LE+  G R  LVG NG GKS+LL
Sbjct: 12  FFGAEVILDNIKLEVKTGDRIALVGRNGAGKSTLL 46


>UniRef50_Q8A7I1 Cluster: Putative ABC transporter ATP-binding
           protein; n=4; Bacteroidales|Rep: Putative ABC
           transporter ATP-binding protein - Bacteroides
           thetaiotaomicron
          Length = 532

 Score = 37.9 bits (84), Expect = 0.17
 Identities = 25/95 (26%), Positives = 44/95 (46%), Gaps = 5/95 (5%)
 Frame = +2

Query: 308 LLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVP----IPEHIDIFHLTRGGARYP 475
           L  D    ++ G++ GLVG NGCGKS+LL  +  +  P    I    D++++ +   +Y 
Sbjct: 18  LFSDLNFAISKGQKLGLVGNNGCGKSTLLQIIAGQLAPSSGVIVRPDDLYYIPQHFGQYD 77

Query: 476 IRPIVSRITI-HGRRFTNVVTGKTLAFPNLIALQD 577
              I   + I H ++  + +     +  N   L D
Sbjct: 78  SLTIAQALQIDHKQKALHAILAGDASIENFSILND 112


>UniRef50_Q6MAV3 Cluster: Putative tylosin resistance protein; n=1;
           Candidatus Protochlamydia amoebophila UWE25|Rep:
           Putative tylosin resistance protein - Protochlamydia
           amoebophila (strain UWE25)
          Length = 621

 Score = 37.9 bits (84), Expect = 0.17
 Identities = 20/48 (41%), Positives = 26/48 (54%)
 Frame = +2

Query: 278 NFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVP 421
           N + +  G  L     L L+ G R G+VGLNG GK++LL  L   E P
Sbjct: 319 NLTKSLGGRLLFSGINLTLSPGTRLGIVGLNGSGKTTLLKLLMNEETP 366



 Score = 32.3 bits (70), Expect = 8.6
 Identities = 18/44 (40%), Positives = 24/44 (54%)
 Frame = +2

Query: 290 TFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVP 421
           +F    L +D  L +  G + GL+G NG GKS+LL  L   E P
Sbjct: 35  SFSSRLLFKDMSLGIFRGDKIGLIGPNGSGKSTLLKILAGLESP 78


>UniRef50_Q6MA69 Cluster: Probable zinc ABC transporter ATP-binding
           protein; n=1; Candidatus Protochlamydia amoebophila
           UWE25|Rep: Probable zinc ABC transporter ATP-binding
           protein - Protochlamydia amoebophila (strain UWE25)
          Length = 245

 Score = 37.9 bits (84), Expect = 0.17
 Identities = 20/60 (33%), Positives = 32/60 (53%)
 Frame = +2

Query: 266 IKIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVPIPEHIDIF 445
           IK+ + S  +  S +L D   E+N G   G++G NG GK++LL  +     P    I++F
Sbjct: 5   IKVDHLSFCYDNSTILSDISFEVNPGEFIGIIGPNGGGKTTLLKLIMGFLKPENGKIEVF 64


>UniRef50_Q6G1Y4 Cluster: ABC transporter, ATP-binding protein;
           n=39; Bacteria|Rep: ABC transporter, ATP-binding protein
           - Bartonella henselae (Rochalimaea henselae)
          Length = 620

 Score = 37.9 bits (84), Expect = 0.17
 Identities = 23/69 (33%), Positives = 32/69 (46%)
 Frame = +2

Query: 266 IKIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVPIPEHIDIF 445
           +++    +TF  + L     L +  G R  LVG NGCGKS+LL       +  P   +IF
Sbjct: 6   LRLDRICLTFGKTPLFNQACLAVEQGARIALVGRNGCGKSTLLKI--AAGIIEPNEGEIF 63

Query: 446 HLTRGGARY 472
              R   RY
Sbjct: 64  RHPRATLRY 72



 Score = 33.5 bits (73), Expect = 3.7
 Identities = 18/41 (43%), Positives = 26/41 (63%), Gaps = 1/41 (2%)
 Frame = +2

Query: 296 YGSELL-QDTLLELNCGRRYGLVGLNGCGKSSLLAALRRRE 415
           YG  ++ +D  L +  G R GLVG NG GK++LL+ L  +E
Sbjct: 292 YGERVIVKDFSLRVQRGDRIGLVGPNGIGKTTLLSVLIGQE 332


>UniRef50_Q6ANU8 Cluster: Related to ABC transporter, ATP-binding
           protein; n=1; Desulfotalea psychrophila|Rep: Related to
           ABC transporter, ATP-binding protein - Desulfotalea
           psychrophila
          Length = 669

 Score = 37.9 bits (84), Expect = 0.17
 Identities = 19/52 (36%), Positives = 29/52 (55%), Gaps = 1/52 (1%)
 Frame = +2

Query: 251 PCSRD-IKIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAAL 403
           P  RD + +   S ++ G  + +D   EL  G +  +VG+NG GKS+LL  L
Sbjct: 327 PSGRDMLSVKGLSKSYRGKTVFKDAEFELQRGDKVAVVGVNGAGKSTLLKIL 378



 Score = 33.5 bits (73), Expect = 3.7
 Identities = 14/43 (32%), Positives = 25/43 (58%)
 Frame = +2

Query: 266 IKIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLL 394
           + +    I +    L ++  +++N G R  LVG+NG GK++LL
Sbjct: 8   LSVNRLDIRYGEKHLFKNVSVQVNRGNRIALVGVNGAGKTTLL 50


>UniRef50_Q31NM2 Cluster: ATPase; n=2; Synechococcus elongatus|Rep:
           ATPase - Synechococcus sp. (strain PCC 7942) (Anacystis
           nidulans R2)
          Length = 245

 Score = 37.9 bits (84), Expect = 0.17
 Identities = 15/46 (32%), Positives = 29/46 (63%)
 Frame = +2

Query: 266 IKIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAAL 403
           ++I + S+ +    +L+D  L++  G +  L+G NG GKS+L+ A+
Sbjct: 2   LEIQHLSVCYRQQRVLEDICLQVQAGEQLALIGPNGAGKSTLVRAI 47


>UniRef50_Q3Y302 Cluster: ABC transporter; n=1; Enterococcus faecium
           DO|Rep: ABC transporter - Enterococcus faecium DO
          Length = 527

 Score = 37.9 bits (84), Expect = 0.17
 Identities = 18/50 (36%), Positives = 27/50 (54%)
 Frame = +2

Query: 266 IKIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRRE 415
           I+  +   T  G+ L +D   ++  G +  LVG+NG GKS+ L  L  RE
Sbjct: 3   IQAISIKKTIGGNPLFEDLSCQIEAGEKIALVGINGTGKSTFLQILTGRE 52


>UniRef50_Q1EMI3 Cluster: Putative ABC-type transport system,
           ATPase; n=1; Leptospira biflexa serovar Patoc|Rep:
           Putative ABC-type transport system, ATPase - Leptospira
           biflexa serovar Patoc
          Length = 1021

 Score = 37.9 bits (84), Expect = 0.17
 Identities = 19/45 (42%), Positives = 30/45 (66%), Gaps = 2/45 (4%)
 Frame = +2

Query: 266 IKIANFSITFY-GS-ELLQDTLLELNCGRRYGLVGLNGCGKSSLL 394
           IK+ N S  +  GS E+L+D  L++  G +  +VG +GCGKS+L+
Sbjct: 778 IKLDNISFRYSDGSPEILKDINLDIEAGEKIAIVGRSGCGKSTLM 822


>UniRef50_Q11CV0 Cluster: ABC transporter related; n=13;
           Alphaproteobacteria|Rep: ABC transporter related -
           Mesorhizobium sp. (strain BNC1)
          Length = 604

 Score = 37.9 bits (84), Expect = 0.17
 Identities = 19/43 (44%), Positives = 25/43 (58%)
 Frame = +2

Query: 266 IKIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLL 394
           +K+    +TF G+ LL    L +  G R  LVG NG GKS+LL
Sbjct: 6   LKLDGIRLTFGGAPLLDGASLMVGPGERIALVGRNGSGKSTLL 48


>UniRef50_Q0HTC9 Cluster: ABC transporter related; n=50;
           Proteobacteria|Rep: ABC transporter related - Shewanella
           sp. (strain MR-7)
          Length = 346

 Score = 37.9 bits (84), Expect = 0.17
 Identities = 28/105 (26%), Positives = 43/105 (40%)
 Frame = +2

Query: 239 TGCAPCSRDIKIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREV 418
           T  A     I+    +  F G   ++D  L +  G  YG +G NGCGKS+ +  L     
Sbjct: 20  TSSAASEFAIETRGMTRAFGGINAVEDLDLAIPKGTIYGFLGPNGCGKSTSIRMLTGLLS 79

Query: 419 PIPEHIDIFHLTRGGARYPIRPIVSRITIHGRRFTNVVTGKTLAF 553
           P    I +   T  GA   +R  +  +T     + N+   + L F
Sbjct: 80  PTSGDIRVLGETLPGAEEKLRRRIGYMTQKFSLYDNLSVRENLEF 124


>UniRef50_Q0AUT2 Cluster: Putative uncharacterized protein; n=1;
           Syntrophomonas wolfei subsp. wolfei str. Goettingen|Rep:
           Putative uncharacterized protein - Syntrophomonas wolfei
           subsp. wolfei (strain Goettingen)
          Length = 739

 Score = 37.9 bits (84), Expect = 0.17
 Identities = 28/94 (29%), Positives = 48/94 (51%), Gaps = 5/94 (5%)
 Frame = +2

Query: 257 SRDIKIANFSITFYGSE--LLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVPIPE 430
           S +I++ N S  ++     +L D  L++  G+   +VG  GCGKS+L+  L   E   P+
Sbjct: 488 SGNIELNNVSFRYHEEMPLVLDDISLKIKAGQYVAIVGKTGCGKSTLMRLLLGFET--PQ 545

Query: 431 HIDIFHLTRGGARYPIRPI---VSRITIHGRRFT 523
              I++  R  AR  +R +   +  +T  GR F+
Sbjct: 546 RGAIYYDGRDIARLDMRSLRQNIGAVTQDGRLFS 579


>UniRef50_A7HFR8 Cluster: ABC transporter related; n=4;
           Cystobacterineae|Rep: ABC transporter related -
           Anaeromyxobacter sp. Fw109-5
          Length = 651

 Score = 37.9 bits (84), Expect = 0.17
 Identities = 21/43 (48%), Positives = 26/43 (60%), Gaps = 1/43 (2%)
 Frame = +2

Query: 296 YGSELLQDTL-LELNCGRRYGLVGLNGCGKSSLLAALRRREVP 421
           +GS  + D L L +  G R GLVG+NG GKSSL+  L R   P
Sbjct: 13  FGSRTVFDGLTLTIEEGERVGLVGVNGSGKSSLMRMLARAAEP 55


>UniRef50_A6GTJ2 Cluster: Phosphonate ABC transporter PhnC,
           ATP-binding protein; n=1; Limnobacter sp. MED105|Rep:
           Phosphonate ABC transporter PhnC, ATP-binding protein -
           Limnobacter sp. MED105
          Length = 245

 Score = 37.9 bits (84), Expect = 0.17
 Identities = 26/86 (30%), Positives = 39/86 (45%), Gaps = 5/86 (5%)
 Frame = +2

Query: 257 SRDIKIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVPIPEHI 436
           S  I I N  +   G  +L+   L++  G +  ++G NG GKS+LL  L     P   HI
Sbjct: 3   SNIIDIQNLEMVIAGRRILKVESLQIARGEKVAILGRNGAGKSTLLRCLNGFVKPTAGHI 62

Query: 437 -----DIFHLTRGGARYPIRPIVSRI 499
                 +F L R     P+R  V ++
Sbjct: 63  VVNQHTVFPLRRERDLRPVRAQVGQV 88


>UniRef50_A5IRS0 Cluster: ABC transporter related; n=12;
           Staphylococcus aureus|Rep: ABC transporter related -
           Staphylococcus aureus subsp. aureus JH9
          Length = 213

 Score = 37.9 bits (84), Expect = 0.17
 Identities = 16/43 (37%), Positives = 27/43 (62%)
 Frame = +2

Query: 266 IKIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLL 394
           I++ + +I      +L+   L+  CG+ Y L+G +GCGKS+LL
Sbjct: 2   IELKDLTIQKGNIHILKKLNLKFQCGKSYALIGKSGCGKSTLL 44


>UniRef50_A5G419 Cluster: ABC transporter related; n=1; Geobacter
           uraniumreducens Rf4|Rep: ABC transporter related -
           Geobacter uraniumreducens Rf4
          Length = 421

 Score = 37.9 bits (84), Expect = 0.17
 Identities = 18/45 (40%), Positives = 25/45 (55%)
 Frame = +2

Query: 311 LQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVPIPEHIDIF 445
           L+D   E+  G   G++G NG GKS+LL  + R  VP     +IF
Sbjct: 55  LKDVSFEVRQGEIVGIIGQNGAGKSTLLKVISRITVPTDGRAEIF 99


>UniRef50_A4NWK5 Cluster: Probable amino-acid ABC transporter
           ATP-binding protein; n=1; Haemophilus influenzae
           22.4-21|Rep: Probable amino-acid ABC transporter
           ATP-binding protein - Haemophilus influenzae 22.4-21
          Length = 227

 Score = 37.9 bits (84), Expect = 0.17
 Identities = 27/106 (25%), Positives = 51/106 (48%), Gaps = 1/106 (0%)
 Frame = +2

Query: 266 IKIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVPIPEHIDIF 445
           +K++N    F G+ +L+    E+N G    ++G +G GK++ L  L   E P      I 
Sbjct: 2   LKVSNIQKNFNGNHVLKGIDFEINKGEVVAILGPSGSGKTTFLRCLNLLERP---EQGIL 58

Query: 446 HLTRGGARYPIRPIVSRI-TIHGRRFTNVVTGKTLAFPNLIALQDI 580
             T G  +      +S+   +  RR +++V  +   FP+  AL+++
Sbjct: 59  EFTDGSLKIDFSQKISKADELKLRRRSSMVFQQYNLFPHRSALENV 104


>UniRef50_A3X9H3 Cluster: ABC ferric siderophore transporter, ATPase
           subunit; n=2; Roseobacter|Rep: ABC ferric siderophore
           transporter, ATPase subunit - Roseobacter sp. MED193
          Length = 250

 Score = 37.9 bits (84), Expect = 0.17
 Identities = 20/48 (41%), Positives = 30/48 (62%)
 Frame = +2

Query: 266 IKIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRR 409
           I+I N S    G ++L++  L+L+ G    LVG NG GKS+LL+ + R
Sbjct: 2   IRIRNLSHQIAGHDILRNVDLDLSKGGLTALVGPNGAGKSTLLSLVAR 49


>UniRef50_A3K6R5 Cluster: Spermidine/putrescine ABC transporter,
           ATP-binding protein; n=1; Sagittula stellata E-37|Rep:
           Spermidine/putrescine ABC transporter, ATP-binding
           protein - Sagittula stellata E-37
          Length = 359

 Score = 37.9 bits (84), Expect = 0.17
 Identities = 17/48 (35%), Positives = 27/48 (56%)
 Frame = +2

Query: 251 PCSRDIKIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLL 394
           P SR + +     +F G+ ++ D    +N G    L+G +GCGKS+LL
Sbjct: 8   PVSRYLDVVGVEKSFKGTRVMSDMNFRVNRGELVSLLGPSGCGKSTLL 55


>UniRef50_A3DG94 Cluster: ABC transporter related protein; n=1;
           Clostridium thermocellum ATCC 27405|Rep: ABC transporter
           related protein - Clostridium thermocellum (strain ATCC
           27405 / DSM 1237)
          Length = 266

 Score = 37.9 bits (84), Expect = 0.17
 Identities = 16/48 (33%), Positives = 31/48 (64%)
 Frame = +2

Query: 266 IKIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRR 409
           I++ +  ++F    +L+   L++  GR YG++G NG GK++LL ++ R
Sbjct: 9   IEVRDIEVSFGDLNVLKGISLQMEKGRFYGILGPNGSGKTTLLKSMAR 56


>UniRef50_A1WJA0 Cluster: ABC transporter related; n=4;
           Proteobacteria|Rep: ABC transporter related -
           Verminephrobacter eiseniae (strain EF01-2)
          Length = 268

 Score = 37.9 bits (84), Expect = 0.17
 Identities = 20/51 (39%), Positives = 27/51 (52%)
 Frame = +2

Query: 251 PCSRDIKIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAAL 403
           P S  + +   S  +    +L D  L +  G R GLVGLNG GKS+L  A+
Sbjct: 30  PRSEVLDVKGLSAGYGPMRVLHDLDLSVQAGERVGLVGLNGHGKSTLFYAI 80


>UniRef50_A0RLZ5 Cluster: Ferric cations import ATP-binding protein
           FbpC 1; n=2; Campylobacter|Rep: Ferric cations import
           ATP-binding protein FbpC 1 - Campylobacter fetus subsp.
           fetus (strain 82-40)
          Length = 319

 Score = 37.9 bits (84), Expect = 0.17
 Identities = 19/50 (38%), Positives = 30/50 (60%)
 Frame = +2

Query: 266 IKIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRRE 415
           +KI++ S  F  + +L+D  L LN G    ++G +GCGKS+LL  +   E
Sbjct: 5   LKISHLSKKFGNNTVLKDINLSLNSGEILTILGGSGCGKSTLLRIIANLE 54


>UniRef50_A2WUM4 Cluster: Putative uncharacterized protein; n=2; Oryza
            sativa|Rep: Putative uncharacterized protein - Oryza
            sativa subsp. indica (Rice)
          Length = 1203

 Score = 37.9 bits (84), Expect = 0.17
 Identities = 15/34 (44%), Positives = 24/34 (70%)
 Frame = +2

Query: 308  LLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRR 409
            +LQD  L++  G   GLVG +GCGKS+++  ++R
Sbjct: 982  ILQDFSLDVKAGTSIGLVGRSGCGKSTIIGLIQR 1015


>UniRef50_Q5CXX8 Cluster: ABC ATpase (2 ABC domains) with 10
            transmembrane domains, adjacent duplicated gene; n=2;
            Cryptosporidium|Rep: ABC ATpase (2 ABC domains) with 10
            transmembrane domains, adjacent duplicated gene -
            Cryptosporidium parvum Iowa II
          Length = 1393

 Score = 37.9 bits (84), Expect = 0.17
 Identities = 21/55 (38%), Positives = 31/55 (56%), Gaps = 2/55 (3%)
 Frame = +2

Query: 251  PCSRDIKIANFSITFYGSE--LLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRR 409
            P    I+  N  +TFY +    L +  L+++ G R G+VG  G GKSSL +A+ R
Sbjct: 1150 PSQGKIEFRNVDMTFYPNPNPSLCNICLKISPGERIGIVGRTGAGKSSLFSAILR 1204


>UniRef50_A7SC94 Cluster: Predicted protein; n=2; Nematostella
            vectensis|Rep: Predicted protein - Nematostella vectensis
          Length = 1236

 Score = 37.9 bits (84), Expect = 0.17
 Identities = 20/55 (36%), Positives = 31/55 (56%), Gaps = 2/55 (3%)
 Frame = +2

Query: 251  PCSRDIKIANFSITFY--GSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRR 409
            P +  +   N S+T+   G   L+D    ++ G + G+VG NG GKSS++ AL R
Sbjct: 993  PSAGHVVCDNVSLTYEKDGLRALKDLTFSVSAGEKIGIVGRNGSGKSSVIHALFR 1047


>UniRef50_A7RVD2 Cluster: Predicted protein; n=3; Nematostella
            vectensis|Rep: Predicted protein - Nematostella vectensis
          Length = 1254

 Score = 37.9 bits (84), Expect = 0.17
 Identities = 19/41 (46%), Positives = 25/41 (60%)
 Frame = +2

Query: 308  LLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVPIPE 430
            +L+D  L++  G R G+VG  G GKSS+ AAL R   P  E
Sbjct: 1025 VLRDITLDVRPGERVGIVGKTGAGKSSVFAALFRMPDPTGE 1065


>UniRef50_Q2GMU1 Cluster: Putative uncharacterized protein; n=1;
           Chaetomium globosum|Rep: Putative uncharacterized
           protein - Chaetomium globosum (Soil fungus)
          Length = 1037

 Score = 37.9 bits (84), Expect = 0.17
 Identities = 23/57 (40%), Positives = 34/57 (59%), Gaps = 5/57 (8%)
 Frame = +2

Query: 254 CSRDIKIANFSITF-YGS----ELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRR 409
           CS  I++    + F Y S    ++LQ+  L +N G+   LVG +GCGKS++LA L R
Sbjct: 783 CSNGIQVELNDVDFRYPSRPDHQVLQNFNLNINKGQYLALVGPSGCGKSTILALLER 839


>UniRef50_Q3AXX4 Cluster: Phosphate import ATP-binding protein pstB;
           n=41; Bacteria|Rep: Phosphate import ATP-binding protein
           pstB - Synechococcus sp. (strain CC9902)
          Length = 272

 Score = 37.9 bits (84), Expect = 0.17
 Identities = 15/48 (31%), Positives = 30/48 (62%)
 Frame = +2

Query: 266 IKIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRR 409
           + + N +I++  S  ++D   E++ G+    +G +GCGKS+LL ++ R
Sbjct: 18  VSMQNVTISYGKSAAVKDVFCEISTGKVTAFIGPSGCGKSTLLRSINR 65


>UniRef50_Q98EP4 Cluster: Sugar ABC transportor, ATP-binding
           protein; n=9; Proteobacteria|Rep: Sugar ABC transportor,
           ATP-binding protein - Rhizobium loti (Mesorhizobium
           loti)
          Length = 355

 Score = 37.5 bits (83), Expect = 0.23
 Identities = 19/47 (40%), Positives = 27/47 (57%)
 Frame = +2

Query: 263 DIKIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAAL 403
           D+   N S +F    +L+D  L++  G    LVG +GCGKS+LL  L
Sbjct: 3   DVLFRNLSKSFGQHRILEDINLDIKTGEFVVLVGPSGCGKSTLLRML 49


>UniRef50_Q8EYQ7 Cluster: ABC transporter ATP-binding protein; n=4;
           Leptospira|Rep: ABC transporter ATP-binding protein -
           Leptospira interrogans
          Length = 309

 Score = 37.5 bits (83), Expect = 0.23
 Identities = 22/47 (46%), Positives = 28/47 (59%), Gaps = 1/47 (2%)
 Frame = +2

Query: 266 IKIANFSITFYGSELLQDTL-LELNCGRRYGLVGLNGCGKSSLLAAL 403
           IK+ N S  FYG +L  D L  EL  G   GL+GLNG GK++ +  L
Sbjct: 2   IKVKNLS-KFYGKKLAIDRLNFELGEGEIVGLLGLNGAGKTTTIRIL 47


>UniRef50_Q8ET71 Cluster: ABC transporter ATP-binding protein; n=31;
           Firmicutes|Rep: ABC transporter ATP-binding protein -
           Oceanobacillus iheyensis
          Length = 628

 Score = 37.5 bits (83), Expect = 0.23
 Identities = 19/43 (44%), Positives = 27/43 (62%), Gaps = 1/43 (2%)
 Frame = +2

Query: 296 YGSELLQDTL-LELNCGRRYGLVGLNGCGKSSLLAALRRREVP 421
           YG  L+ + + LE+N   R G+VG NG GKS+LL  + + E P
Sbjct: 13  YGGNLIFERISLEINENERIGIVGRNGSGKSTLLRLMAKIEDP 55


>UniRef50_Q83LS4 Cluster: ATP-binding component of putrescine
           transport system; n=75; Proteobacteria|Rep: ATP-binding
           component of putrescine transport system - Shigella
           flexneri
          Length = 404

 Score = 37.5 bits (83), Expect = 0.23
 Identities = 18/52 (34%), Positives = 29/52 (55%)
 Frame = +2

Query: 266 IKIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVP 421
           ++I N + ++ G   + D  L +  G  + L+G +GCGKS+LL  L   E P
Sbjct: 47  LEIRNLTKSYDGQHAVDDVSLTIYKGEIFALLGASGCGKSTLLRMLAGFEQP 98


>UniRef50_Q7VBA1 Cluster: ATPase components of ABC transporters,
           duplicated ATPase domain; n=17; cellular organisms|Rep:
           ATPase components of ABC transporters, duplicated ATPase
           domain - Prochlorococcus marinus
          Length = 643

 Score = 37.5 bits (83), Expect = 0.23
 Identities = 20/61 (32%), Positives = 30/61 (49%)
 Frame = +2

Query: 260 RDIKIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVPIPEHID 439
           + I     SIT  G+ LL+D     +   R G++G NG GKS+ L  L  +  P    I+
Sbjct: 317 KTINAEKLSITINGAILLEDFSYSFSSEDRVGIIGANGSGKSTFLDLLAGKREPCNGTIE 376

Query: 440 I 442
           +
Sbjct: 377 V 377



 Score = 33.5 bits (73), Expect = 3.7
 Identities = 18/43 (41%), Positives = 24/43 (55%)
 Frame = +2

Query: 266 IKIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLL 394
           I + N S  F    L ++  L +N   R GL+G NG GKS+LL
Sbjct: 4   ISLINASKDFGVRTLFENLNLHINNKERLGLIGPNGAGKSTLL 46


>UniRef50_Q74KW2 Cluster: ABC transporter ATPase and permease
           components; n=3; Lactobacillus|Rep: ABC transporter
           ATPase and permease components - Lactobacillus johnsonii
          Length = 587

 Score = 37.5 bits (83), Expect = 0.23
 Identities = 20/60 (33%), Positives = 30/60 (50%)
 Frame = +2

Query: 263 DIKIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVPIPEHIDI 442
           ++K  +F+  F   E+L      +N G +  +VG NG GKS+L+  L R   P    I I
Sbjct: 345 EVKDLSFTYPFSDDEVLHKVSFSVNSGEKIAIVGENGSGKSTLVKLLMRFYDPTTGAISI 404


>UniRef50_Q73MU0 Cluster: ABC transporter, ATP-binding protein; n=1;
           Treponema denticola|Rep: ABC transporter, ATP-binding
           protein - Treponema denticola
          Length = 411

 Score = 37.5 bits (83), Expect = 0.23
 Identities = 17/37 (45%), Positives = 23/37 (62%)
 Frame = +2

Query: 311 LQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVP 421
           L+D   ++  G R G++G NG GKS+LL AL R   P
Sbjct: 61  LKDLTFDIKQGDRVGIIGKNGAGKSTLLKALSRITTP 97


>UniRef50_Q6NJW1 Cluster: Putative ABC transport system ATP-binding
           protein; n=1; Corynebacterium diphtheriae|Rep: Putative
           ABC transport system ATP-binding protein -
           Corynebacterium diphtheriae
          Length = 352

 Score = 37.5 bits (83), Expect = 0.23
 Identities = 20/46 (43%), Positives = 27/46 (58%)
 Frame = +2

Query: 266 IKIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAAL 403
           I I   S+T  G+ LL D  LE + G    ++G +G GKS+LL AL
Sbjct: 4   IHIQGLSVTSRGARLLDDVSLEADPGELIVVLGRSGAGKSTLLRAL 49


>UniRef50_Q6LHH9 Cluster: Hypothetical ATP-binding protein
           ofiron/siderophore ABC transporter; n=5;
           Gammaproteobacteria|Rep: Hypothetical ATP-binding
           protein ofiron/siderophore ABC transporter -
           Photobacterium profundum (Photobacterium sp. (strain
           SS9))
          Length = 262

 Score = 37.5 bits (83), Expect = 0.23
 Identities = 17/47 (36%), Positives = 30/47 (63%), Gaps = 1/47 (2%)
 Frame = +2

Query: 272 IANFSITFYGSELLQD-TLLELNCGRRYGLVGLNGCGKSSLLAALRR 409
           I + S++F G+ +L D T+ E++ G    L+G NG GKS++L  + +
Sbjct: 19  ITSLSVSFGGNRVLNDLTISEIHFGEMVSLIGKNGAGKSTVLKQMTK 65


>UniRef50_Q64NR2 Cluster: Putative ABC transporter ATP-binding
           protein; n=6; Bacteroides|Rep: Putative ABC transporter
           ATP-binding protein - Bacteroides fragilis
          Length = 286

 Score = 37.5 bits (83), Expect = 0.23
 Identities = 21/45 (46%), Positives = 27/45 (60%), Gaps = 2/45 (4%)
 Frame = +2

Query: 266 IKIANFSITFYGSE--LLQDTLLELNCGRRYGLVGLNGCGKSSLL 394
           I + N S  +  S+  +L D  L L  GR YGL+G NG GKS+LL
Sbjct: 4   ITVENLSFLYRKSKRAVLHDFSLSLEKGRVYGLLGKNGAGKSTLL 48


>UniRef50_Q47S93 Cluster: ABC transporter, ATP-binding protein
           precursor; n=1; Thermobifida fusca YX|Rep: ABC
           transporter, ATP-binding protein precursor -
           Thermobifida fusca (strain YX)
          Length = 604

 Score = 37.5 bits (83), Expect = 0.23
 Identities = 25/58 (43%), Positives = 32/58 (55%), Gaps = 2/58 (3%)
 Frame = +2

Query: 242 GCAPCSRDIKIANFSITFYGSEL--LQDTLLELNCGRRYGLVGLNGCGKSSLLAALRR 409
           GC   +  I+ AN S+T+ G  L  L    L +  G+R  L G +G GKSSLLA L R
Sbjct: 375 GCT--APQIRFANVSLTYPGRNLPALSQVSLVIRPGQRLLLTGPSGSGKSSLLALLLR 430


>UniRef50_P72884 Cluster: ABC transporter; n=3; Bacteria|Rep: ABC
           transporter - Synechocystis sp. (strain PCC 6803)
          Length = 430

 Score = 37.5 bits (83), Expect = 0.23
 Identities = 19/44 (43%), Positives = 24/44 (54%)
 Frame = +2

Query: 311 LQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVPIPEHIDI 442
           L+D   E+  G R G++G NG GKS+LL  L R   P    I I
Sbjct: 60  LKDVSFEIKQGDRVGIIGRNGAGKSTLLKILSRITEPTEGRISI 103


>UniRef50_O54119 Cluster: ABC-transporter ATP-binding protein; n=1;
           Streptomyces coelicolor|Rep: ABC-transporter ATP-binding
           protein - Streptomyces coelicolor
          Length = 361

 Score = 37.5 bits (83), Expect = 0.23
 Identities = 16/53 (30%), Positives = 31/53 (58%)
 Frame = +2

Query: 263 DIKIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVP 421
           ++ + N   +F+G+ +L+D    +  G  + L+G +GCGKS+ L+ +   E P
Sbjct: 3   ELVVENIKKSFHGTAVLEDVNFTVADGEFFTLLGPSGCGKSTTLSCVAGLETP 55


>UniRef50_Q8GDS4 Cluster: ABC transporter ATP-binding protein Uup;
           n=8; Clostridiales|Rep: ABC transporter ATP-binding
           protein Uup - Heliobacillus mobilis
          Length = 676

 Score = 37.5 bits (83), Expect = 0.23
 Identities = 19/42 (45%), Positives = 25/42 (59%)
 Frame = +2

Query: 278 NFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAAL 403
           N + T+    LLQD  + +  G R GLVG+NG GKS+ L  L
Sbjct: 18  NLTKTYGEKVLLQDVSVGIEEGERIGLVGVNGTGKSTFLKIL 59


>UniRef50_Q8GAL3 Cluster: Putative ATP binding component of ABC
           transporter; n=2; Micrococcineae|Rep: Putative ATP
           binding component of ABC transporter - Arthrobacter
           nicotinovorans
          Length = 496

 Score = 37.5 bits (83), Expect = 0.23
 Identities = 18/46 (39%), Positives = 28/46 (60%)
 Frame = +2

Query: 266 IKIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAAL 403
           +++   S +F+G  +L    LE+  G  +GLVG NG GKS+L+  L
Sbjct: 4   LEVRGVSKSFFGFPVLTGVDLEIRPGEVHGLVGENGAGKSTLMKIL 49


>UniRef50_Q4HQ94 Cluster: Hemin ABC transporter, ATP-binding
           protein; n=2; Campylobacter|Rep: Hemin ABC transporter,
           ATP-binding protein - Campylobacter upsaliensis RM3195
          Length = 259

 Score = 37.5 bits (83), Expect = 0.23
 Identities = 18/46 (39%), Positives = 28/46 (60%)
 Frame = +2

Query: 266 IKIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAAL 403
           +K+ NFS+      ++    L+L  G+ Y ++G NG GKSSLL A+
Sbjct: 2   LKLENFSVHRKNLCVVDQINLKLEKGKIYAILGANGAGKSSLLGAI 47


>UniRef50_Q44477 Cluster: Orf1; n=1; Azotobacter vinelandii|Rep:
           Orf1 - Azotobacter vinelandii
          Length = 259

 Score = 37.5 bits (83), Expect = 0.23
 Identities = 20/51 (39%), Positives = 29/51 (56%)
 Frame = +2

Query: 269 KIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVP 421
           ++ + S    G  LLQ   L+L  G+  GL+G NG GKS+L+  L R+  P
Sbjct: 6   ELNDVSFHLAGRRLLQQISLQLPQGQTVGLIGHNGSGKSTLVKLLARQLEP 56


>UniRef50_Q41F48 Cluster: IMP dehydrogenase/GMP reductase:ABC
           transporter related; n=1; Exiguobacterium sibiricum
           255-15|Rep: IMP dehydrogenase/GMP reductase:ABC
           transporter related - Exiguobacterium sibiricum 255-15
          Length = 631

 Score = 37.5 bits (83), Expect = 0.23
 Identities = 17/52 (32%), Positives = 28/52 (53%)
 Frame = +2

Query: 266 IKIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVP 421
           +K+      F    + +D    ++ G R G++G+NG GKS+LL  L  +E P
Sbjct: 3   LKVDQLKKEFADKIVFEDVTFSVSPGDRIGIIGVNGTGKSTLLHILAGQETP 54



 Score = 34.3 bits (75), Expect = 2.1
 Identities = 15/25 (60%), Positives = 19/25 (76%)
 Frame = +2

Query: 347 RYGLVGLNGCGKSSLLAALRRREVP 421
           RYG+VG NG GKS+LL+ L +R  P
Sbjct: 345 RYGIVGRNGSGKSTLLSILAKRLEP 369


>UniRef50_Q11M34 Cluster: ABC transporter related; n=1;
           Mesorhizobium sp. BNC1|Rep: ABC transporter related -
           Mesorhizobium sp. (strain BNC1)
          Length = 272

 Score = 37.5 bits (83), Expect = 0.23
 Identities = 21/49 (42%), Positives = 30/49 (61%), Gaps = 1/49 (2%)
 Frame = +2

Query: 266 IKIANFSITFYGSELLQDTL-LELNCGRRYGLVGLNGCGKSSLLAALRR 409
           +K+   S+  YG+ L  D + L +  G+   L G NGCGKS+LL A+RR
Sbjct: 8   LKVDTLSVA-YGAHLAVDAISLTIPKGKITVLAGPNGCGKSTLLRAIRR 55


>UniRef50_Q08QR0 Cluster: Abc transporter ATP-binding protein; n=1;
           Stigmatella aurantiaca DW4/3-1|Rep: Abc transporter
           ATP-binding protein - Stigmatella aurantiaca DW4/3-1
          Length = 253

 Score = 37.5 bits (83), Expect = 0.23
 Identities = 16/59 (27%), Positives = 30/59 (50%)
 Frame = +2

Query: 266 IKIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVPIPEHIDI 442
           +++ N    F  + ++ D   ++  G R G+VG +G GKS+LL  L     P    +++
Sbjct: 15  LRVRNLECAFGKTRVVHDVSFDVRAGERLGIVGSSGAGKSTLLRCLNLLITPAAGTVEL 73


>UniRef50_Q04G57 Cluster: ABC-type cobalt transport system, ATPase
           component; n=2; Oenococcus oeni|Rep: ABC-type cobalt
           transport system, ATPase component - Oenococcus oeni
           (strain BAA-331 / PSU-1)
          Length = 267

 Score = 37.5 bits (83), Expect = 0.23
 Identities = 22/53 (41%), Positives = 29/53 (54%), Gaps = 1/53 (1%)
 Frame = +2

Query: 266 IKIANFSITFY-GSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVP 421
           I I N S +F  G EL +   L++N G    LVG NG GKS+L+  +   E P
Sbjct: 6   IVINNLSFSFDDGQELFRQLSLQVNRGEWLSLVGRNGSGKSTLMRLILGLETP 58


>UniRef50_A7I2P4 Cluster: Methionine import ATP-binding protein
           MetN; n=1; Campylobacter hominis ATCC BAA-381|Rep:
           Methionine import ATP-binding protein MetN -
           Campylobacter hominis (strain ATCC BAA-381 / LMG 19568 /
           NCTC 13146 /CH001A)
          Length = 340

 Score = 37.5 bits (83), Expect = 0.23
 Identities = 18/50 (36%), Positives = 30/50 (60%)
 Frame = +2

Query: 266 IKIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRRE 415
           +++ N S ++  +E+L+D    +N G  + LVG +G GKS+LL  L   E
Sbjct: 2   VEVKNLSKSYGKNEVLKDINFNINDGEIFALVGHSGAGKSTLLRCLNGLE 51


>UniRef50_A7HTD4 Cluster: Spermidine/putrescine ABC transporter
           ATPase subunit; n=1; Parvibaculum lavamentivorans
           DS-1|Rep: Spermidine/putrescine ABC transporter ATPase
           subunit - Parvibaculum lavamentivorans DS-1
          Length = 361

 Score = 37.5 bits (83), Expect = 0.23
 Identities = 21/53 (39%), Positives = 32/53 (60%), Gaps = 1/53 (1%)
 Frame = +2

Query: 266 IKIANFSITFYGS-ELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVP 421
           I+I N S  F G+ + + +  LE+  G  + L+G +GCGK++LL  L   EVP
Sbjct: 7   IQIKNVSKVFGGTVKAVDEVNLEVGRGEFFALLGPSGCGKTTLLRMLAGFEVP 59


>UniRef50_A7HCQ9 Cluster: ABC transporter related; n=2;
           Proteobacteria|Rep: ABC transporter related -
           Anaeromyxobacter sp. Fw109-5
          Length = 259

 Score = 37.5 bits (83), Expect = 0.23
 Identities = 17/45 (37%), Positives = 30/45 (66%)
 Frame = +2

Query: 269 KIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAAL 403
           ++++ ++   G  +L+D  L +  G R  L+G+NGCGK++LL AL
Sbjct: 4   ELSHVTLELGGRAVLRDVSLTVAPGERAVLLGVNGCGKTTLLRAL 48


>UniRef50_A7B848 Cluster: Putative uncharacterized protein; n=1;
           Ruminococcus gnavus ATCC 29149|Rep: Putative
           uncharacterized protein - Ruminococcus gnavus ATCC 29149
          Length = 213

 Score = 37.5 bits (83), Expect = 0.23
 Identities = 17/59 (28%), Positives = 30/59 (50%)
 Frame = +2

Query: 266 IKIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVPIPEHIDI 442
           +++ + S      E+L+D  + +  G+ YG  G NGCGKS L+  +    +P    + I
Sbjct: 3   LEVKHISKQIGADEVLKDITISMKKGKIYGFQGKNGCGKSMLMRVICGLVIPTDGSVTI 61


>UniRef50_A6TKG7 Cluster: ABC transporter related; n=1; Alkaliphilus
           metalliredigens QYMF|Rep: ABC transporter related -
           Alkaliphilus metalliredigens QYMF
          Length = 503

 Score = 37.5 bits (83), Expect = 0.23
 Identities = 19/46 (41%), Positives = 28/46 (60%)
 Frame = +2

Query: 266 IKIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAAL 403
           +++ N S  F   + LQD  LE+  G  +GL+G NG GKS+L+  L
Sbjct: 3   LQMKNISKNFGPVKALQDVSLEVGPGEIHGLMGENGAGKSTLMNIL 48


>UniRef50_A6G9D3 Cluster: ABC transporter-related protein; n=1;
           Plesiocystis pacifica SIR-1|Rep: ABC transporter-related
           protein - Plesiocystis pacifica SIR-1
          Length = 668

 Score = 37.5 bits (83), Expect = 0.23
 Identities = 18/38 (47%), Positives = 23/38 (60%)
 Frame = +2

Query: 308 LLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVP 421
           L+    L L  G R G+VG NGCGK+SLL A+    +P
Sbjct: 339 LVSGLTLRLRKGERLGVVGPNGCGKTSLLRAMTGDLIP 376



 Score = 36.7 bits (81), Expect = 0.40
 Identities = 21/43 (48%), Positives = 24/43 (55%), Gaps = 1/43 (2%)
 Frame = +2

Query: 296 YG-SELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVP 421
           YG  E+L+   L L  G R GLVG NG GKS+L   L   E P
Sbjct: 13  YGIHEVLRGANLSLEAGERVGLVGRNGSGKSTLARILAGAEDP 55


>UniRef50_A6CBU7 Cluster: ABC transporter, ATP-binding protein; n=3;
           Bacteria|Rep: ABC transporter, ATP-binding protein -
           Planctomyces maris DSM 8797
          Length = 596

 Score = 37.5 bits (83), Expect = 0.23
 Identities = 18/37 (48%), Positives = 24/37 (64%)
 Frame = +2

Query: 284 SITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLL 394
           S T+ G  LL +  LE+  G R GL+G NG GKS+L+
Sbjct: 10  SFTWSGHPLLDEISLEIYEGERIGLLGRNGAGKSTLM 46


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 572,756,335
Number of Sequences: 1657284
Number of extensions: 11181915
Number of successful extensions: 34442
Number of sequences better than 10.0: 500
Number of HSP's better than 10.0 without gapping: 32706
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 34434
length of database: 575,637,011
effective HSP length: 97
effective length of database: 414,880,463
effective search space used: 40658285374
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).