SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0010
         (539 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_Q9AFH5 Cluster: CpsVN; n=3; Streptococcus agalactiae|Re...    37   0.26 
UniRef50_UPI0000DB7272 Cluster: PREDICTED: similar to CG10260-PB...    32   7.3  

>UniRef50_Q9AFH5 Cluster: CpsVN; n=3; Streptococcus agalactiae|Rep:
           CpsVN - Streptococcus agalactiae
          Length = 295

 Score = 37.1 bits (82), Expect = 0.26
 Identities = 16/45 (35%), Positives = 26/45 (57%)
 Frame = +1

Query: 82  KYMSIYQISEC*ILTTQNIVDFKLLCSQGENILSQLLNYIFQSNQ 216
           KY    +I  C ++    +VDF+  C +GEN LS+ + YI+ S +
Sbjct: 145 KYKYHLKIETCIVINNAYLVDFEFPCFEGENFLSEEIMYIYLSKK 189


>UniRef50_UPI0000DB7272 Cluster: PREDICTED: similar to CG10260-PB
            isoform 2; n=2; Endopterygota|Rep: PREDICTED: similar to
            CG10260-PB isoform 2 - Apis mellifera
          Length = 2093

 Score = 32.3 bits (70), Expect = 7.3
 Identities = 16/76 (21%), Positives = 38/76 (50%), Gaps = 3/76 (3%)
 Frame = +1

Query: 49   IKINSKTNVSRKYMSIYQISEC*ILTTQNIVDFKLLCSQGENILSQLLNYIFQSN---QI 219
            +K++++TN   +Y++  Q ++C  L +   ++   + +  E  L  ++ Y+  ++     
Sbjct: 840  LKLSTRTNDISQYVTKLQFAQCTYLLSVYWLETLRVANSSEPSLQPIMEYLCDTDLQKDK 899

Query: 220  LSLMSCACCVKSYVFI 267
              +  C CCV   VF+
Sbjct: 900  SGMWQCICCVADSVFV 915


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 445,691,658
Number of Sequences: 1657284
Number of extensions: 7770683
Number of successful extensions: 11010
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 10639
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 11009
length of database: 575,637,011
effective HSP length: 96
effective length of database: 416,537,747
effective search space used: 34572633001
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).