SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0009
         (606 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_Q2FPL5 Cluster: PKD precursor; n=1; Methanospirillum hu...    33   4.0  
UniRef50_A5FHW0 Cluster: NADPH-dependent FMN reductase; n=2; Bac...    32   9.2  
UniRef50_Q7YYI2 Cluster: Putative uncharacterized protein; n=1; ...    32   9.2  
UniRef50_Q5CX83 Cluster: Putative uncharacterized protein; n=2; ...    32   9.2  

>UniRef50_Q2FPL5 Cluster: PKD precursor; n=1; Methanospirillum
           hungatei JF-1|Rep: PKD precursor - Methanospirillum
           hungatei (strain JF-1 / DSM 864)
          Length = 1292

 Score = 33.5 bits (73), Expect = 4.0
 Identities = 14/29 (48%), Positives = 19/29 (65%), Gaps = 1/29 (3%)
 Frame = +2

Query: 485 WNWTKNRKAFSTQPGPLKVYSGFG-YTVK 568
           W WT N +AFST+  P KV+   G YT++
Sbjct: 820 WAWTANGEAFSTEQNPKKVFDKTGKYTIE 848


>UniRef50_A5FHW0 Cluster: NADPH-dependent FMN reductase; n=2;
           Bacteroidetes|Rep: NADPH-dependent FMN reductase -
           Flavobacterium johnsoniae UW101
          Length = 179

 Score = 32.3 bits (70), Expect = 9.2
 Identities = 14/29 (48%), Positives = 18/29 (62%)
 Frame = -1

Query: 549 PEYTLSGPGCVENAFLFFVQFHLFENHKT 463
           PEY  S PG ++NA  +FV   +F N KT
Sbjct: 81  PEYVFSLPGSLKNALEWFVSTTIFSNKKT 109


>UniRef50_Q7YYI2 Cluster: Putative uncharacterized protein; n=1;
           Cryptosporidium parvum|Rep: Putative uncharacterized
           protein - Cryptosporidium parvum
          Length = 974

 Score = 32.3 bits (70), Expect = 9.2
 Identities = 16/59 (27%), Positives = 33/59 (55%), Gaps = 2/59 (3%)
 Frame = +1

Query: 139 LFRNIFIF--FITDMLGRSQSPPAVKWLLEPIDIYSVNPPLP*DISSKVRV*TFALLLI 309
           LFRN+F+   + +D +G+S+   ++K L    +I+  NP L   +   V +  + +L++
Sbjct: 384 LFRNLFVLLTWASDYIGKSEFSKSIKSLTHLFEIWQRNPALSFSLKDFVYISDYVILVL 442


>UniRef50_Q5CX83 Cluster: Putative uncharacterized protein; n=2;
           Cryptosporidium|Rep: Putative uncharacterized protein -
           Cryptosporidium parvum Iowa II
          Length = 964

 Score = 32.3 bits (70), Expect = 9.2
 Identities = 16/59 (27%), Positives = 33/59 (55%), Gaps = 2/59 (3%)
 Frame = +1

Query: 139 LFRNIFIF--FITDMLGRSQSPPAVKWLLEPIDIYSVNPPLP*DISSKVRV*TFALLLI 309
           LFRN+F+   + +D +G+S+   ++K L    +I+  NP L   +   V +  + +L++
Sbjct: 231 LFRNLFVLLTWASDYIGKSEFSKSIKSLTHLFEIWQRNPALSFSLKDFVYISDYVILVL 289


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 644,026,627
Number of Sequences: 1657284
Number of extensions: 12788310
Number of successful extensions: 25743
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 25160
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 25737
length of database: 575,637,011
effective HSP length: 97
effective length of database: 414,880,463
effective search space used: 43147568152
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).