SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0007
         (555 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_UPI00006CFCE4 Cluster: cation channel family protein; n...    34   1.9  
UniRef50_UPI00006CD309 Cluster: hypothetical protein TTHERM_0027...    33   3.4  
UniRef50_A5BL87 Cluster: Putative uncharacterized protein; n=1; ...    33   5.9  

>UniRef50_UPI00006CFCE4 Cluster: cation channel family protein; n=1;
           Tetrahymena thermophila SB210|Rep: cation channel family
           protein - Tetrahymena thermophila SB210
          Length = 1558

 Score = 34.3 bits (75), Expect = 1.9
 Identities = 17/35 (48%), Positives = 22/35 (62%)
 Frame = -1

Query: 186 YCLRNSTKHIYFECLYM*YNPNLV*KLEITKIYWS 82
           YC  NSTKH Y EC Y+ Y P+   K +I K+ +S
Sbjct: 635 YCCDNSTKHSYVECPYIHYIPD---KYKIIKMEYS 666


>UniRef50_UPI00006CD309 Cluster: hypothetical protein TTHERM_00274430;
            n=3; Tetrahymena thermophila SB210|Rep: hypothetical
            protein TTHERM_00274430 - Tetrahymena thermophila SB210
          Length = 1100

 Score = 33.5 bits (73), Expect = 3.4
 Identities = 16/35 (45%), Positives = 20/35 (57%)
 Frame = +3

Query: 42   RAVIPTRTYGCTRCSSKF**FQVFKLNSGCITCKD 146
            +  IP + YGCT CSSK    Q+ K+   C  CKD
Sbjct: 985  QCTIPNKNYGCTECSSKT--RQLEKITGSCF-CKD 1016


>UniRef50_A5BL87 Cluster: Putative uncharacterized protein; n=1;
           Vitis vinifera|Rep: Putative uncharacterized protein -
           Vitis vinifera (Grape)
          Length = 460

 Score = 32.7 bits (71), Expect = 5.9
 Identities = 25/89 (28%), Positives = 40/89 (44%), Gaps = 2/89 (2%)
 Frame = -2

Query: 524 KSWPKFSIAE*DSGPFVFLNSLPFY-QNPLEILKTCRVTHMTFLSQKLFLRVALKVHKQY 348
           K+W KF +   + G   + NS P Y +  +   + C +T  T +S   F+ +   V  Q 
Sbjct: 351 KNWSKFVLQYVEDGIMDYCNSYPTYIRGCVLFFRYCVITLCTLMSYASFILICYVVDLQ- 409

Query: 347 LKTSVLH-KTLPYQPSFYPELYRNTYLTV 264
            K S+ H   LP    FY   +  T++ V
Sbjct: 410 -KASLNHLYLLPTTQLFYMTKFYMTFVQV 437


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 494,468,321
Number of Sequences: 1657284
Number of extensions: 8957475
Number of successful extensions: 17580
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 17185
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 17578
length of database: 575,637,011
effective HSP length: 96
effective length of database: 416,537,747
effective search space used: 36655321736
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).