SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0006
         (600 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_Q4JSC0 Cluster: Actin; n=13; Coelomata|Rep: Actin - Ano...   148   1e-34
UniRef50_O65314 Cluster: Actin; n=20; Eukaryota|Rep: Actin - Sch...   139   5e-32
UniRef50_P02581 Cluster: Actin-1; n=1852; Eukaryota|Rep: Actin-1...   118   1e-25
UniRef50_P14883 Cluster: Actin-2; n=75; Eukaryota|Rep: Actin-2 -...   114   1e-24
UniRef50_Q96483 Cluster: Actin-51; n=584; Eukaryota|Rep: Actin-5...   109   6e-23
UniRef50_A7RPC3 Cluster: Predicted protein; n=3; Eumetazoa|Rep: ...    91   2e-17
UniRef50_Q0VHZ5 Cluster: Actin deviating protein; n=7; Eukaryota...    87   3e-16
UniRef50_UPI0000449751 Cluster: PREDICTED: similar to gamma-acti...    86   7e-16
UniRef50_UPI0000605B09 Cluster: PREDICTED: similar to actin alph...    83   5e-15
UniRef50_UPI00001E426E Cluster: PREDICTED: similar to actin-12; ...    83   5e-15
UniRef50_UPI000065FC19 Cluster: Homolog of Homo sapiens "Actin, ...    83   6e-15
UniRef50_Q7XB26 Cluster: Ubiquitin/actin fusion protein 4; n=1; ...    83   6e-15
UniRef50_P61163 Cluster: Alpha-centractin; n=356; root|Rep: Alph...    81   2e-14
UniRef50_UPI0000E466A7 Cluster: PREDICTED: similar to actin, alp...    81   3e-14
UniRef50_A4QNT8 Cluster: Si:ch211-241j12.3 protein; n=3; Danio r...    79   6e-14
UniRef50_A2DKQ5 Cluster: Actin 58, putative; n=2; Trichomonas va...    76   6e-13
UniRef50_UPI00006C1719 Cluster: PREDICTED: similar to actin, alp...    76   7e-13
UniRef50_Q0VHZ6 Cluster: Actin deviating protein; n=2; Bolivina ...    73   4e-12
UniRef50_Q7M3B0 Cluster: Actin beta; n=1; Sus scrofa domestica|R...    73   5e-12
UniRef50_Q2GY63 Cluster: Putative uncharacterized protein; n=1; ...    72   9e-12
UniRef50_UPI0000F2D825 Cluster: PREDICTED: similar to actin; n=1...    70   4e-11
UniRef50_A5E2K2 Cluster: Actin; n=5; Saccharomycetales|Rep: Acti...    70   5e-11
UniRef50_Q9XZB9 Cluster: Actin; n=1; Sterkiella nova|Rep: Actin ...    69   8e-11
UniRef50_UPI00005A2ACF Cluster: PREDICTED: similar to cytoplasmi...    67   3e-10
UniRef50_UPI0000E23780 Cluster: PREDICTED: hypothetical protein ...    66   5e-10
UniRef50_A7QKV4 Cluster: Chromosome chr8 scaffold_115, whole gen...    66   6e-10
UniRef50_UPI0000588EB0 Cluster: PREDICTED: similar to actin; n=1...    66   8e-10
UniRef50_Q4CV94 Cluster: Actin 2, putative; n=2; Trypanosoma cru...    64   2e-09
UniRef50_A2FRF9 Cluster: Actin family protein; n=1; Trichomonas ...    64   2e-09
UniRef50_Q9DFB8 Cluster: Actin; n=1; Scomberomorus maculatus|Rep...    64   3e-09
UniRef50_UPI0000F2D326 Cluster: PREDICTED: similar to actin; n=1...    63   6e-09
UniRef50_UPI0001554F81 Cluster: PREDICTED: similar to actin; n=1...    62   1e-08
UniRef50_Q5KB93 Cluster: Actin binding protein, putative; n=3; F...    62   1e-08
UniRef50_UPI00005864C8 Cluster: PREDICTED: similar to Actin; n=4...    61   2e-08
UniRef50_A0E1S8 Cluster: Chromosome undetermined scaffold_73, wh...    61   2e-08
UniRef50_Q8MVN5 Cluster: Cardiac actin-like protein; n=1; Bolten...    60   3e-08
UniRef50_UPI00015B6274 Cluster: PREDICTED: similar to putative m...    59   9e-08
UniRef50_Q8TDY3 Cluster: Actin-related protein T2; n=26; Amniota...    59   9e-08
UniRef50_A2DBN6 Cluster: Actin family protein; n=1; Trichomonas ...    57   3e-07
UniRef50_Q8LKR2 Cluster: Actin-related protein 4; n=7; core eudi...    57   4e-07
UniRef50_O96019 Cluster: Actin-like protein 6A; n=63; Eumetazoa|...    56   8e-07
UniRef50_Q0J646 Cluster: Os08g0369300 protein; n=2; Oryza sativa...    55   1e-06
UniRef50_A2YUL5 Cluster: Putative uncharacterized protein; n=1; ...    55   1e-06
UniRef50_Q9Y615 Cluster: Actin-like protein 7A; n=11; Mammalia|R...    55   1e-06
UniRef50_Q6FRF2 Cluster: Similar to sp|P38696 Saccharomyces cere...    54   2e-06
UniRef50_Q4QG59 Cluster: Actin-like protein, putative; n=3; Leis...    54   3e-06
UniRef50_O96819 Cluster: Actin-related protein; n=5; Trypanosoma...    54   3e-06
UniRef50_Q4N681 Cluster: Actin, putative; n=3; Piroplasmida|Rep:...    53   4e-06
UniRef50_Q9BYD9 Cluster: Actin-related protein M1; n=12; Theria|...    52   8e-06
UniRef50_UPI0000D9A391 Cluster: PREDICTED: actin related protein...    52   1e-05
UniRef50_A4RW28 Cluster: Predicted protein; n=2; Ostreococcus|Re...    52   1e-05
UniRef50_A3BPG0 Cluster: Putative uncharacterized protein; n=3; ...    52   1e-05
UniRef50_Q24C02 Cluster: Actin family protein; n=3; Oligohymenop...    52   1e-05
UniRef50_Q00UL2 Cluster: Alpha amylase 1; n=3; Ostreococcus|Rep:...    52   1e-05
UniRef50_Q5C3R3 Cluster: SJCHGC08022 protein; n=1; Schistosoma j...    51   2e-05
UniRef50_P61160 Cluster: Actin-related protein 2; n=96; Eukaryot...    50   4e-05
UniRef50_UPI0000F2DE11 Cluster: PREDICTED: similar to testis-spe...    50   6e-05
UniRef50_Q55DY5 Cluster: Putative uncharacterized protein; n=1; ...    50   6e-05
UniRef50_A7S2B1 Cluster: Predicted protein; n=1; Nematostella ve...    50   6e-05
UniRef50_Q54UQ7 Cluster: Actin-like protein 6A; n=1; Dictyosteli...    49   7e-05
UniRef50_A2EUM6 Cluster: Actin family protein; n=1; Trichomonas ...    49   7e-05
UniRef50_Q55DS6 Cluster: Putative uncharacterized protein; n=1; ...    48   1e-04
UniRef50_Q5C683 Cluster: SJCHGC08418 protein; n=1; Schistosoma j...    48   2e-04
UniRef50_A2ECQ8 Cluster: Actin family protein; n=1; Trichomonas ...    48   2e-04
UniRef50_Q6BG22 Cluster: Actin, putative; n=2; Paramecium tetrau...    48   2e-04
UniRef50_Q54E71 Cluster: Putative uncharacterized protein; n=1; ...    48   2e-04
UniRef50_UPI0000EBF019 Cluster: PREDICTED: similar to ribosomal ...    47   3e-04
UniRef50_Q9LHH0 Cluster: Actin-like protein; n=11; Magnoliophyta...    47   3e-04
UniRef50_UPI0000E80C06 Cluster: PREDICTED: hypothetical protein;...    47   4e-04
UniRef50_UPI0000449ED3 Cluster: PREDICTED: similar to RIKEN cDNA...    47   4e-04
UniRef50_Q75JT2 Cluster: Similar to Drosophila melanogaster (Fru...    47   4e-04
UniRef50_Q5CKL2 Cluster: BRG1/brm-associated factor 53A; n=2; Cr...    47   4e-04
UniRef50_Q38F20 Cluster: Actin-like protein 3, putative; n=1; Tr...    47   4e-04
UniRef50_Q9P7X7 Cluster: Actin-related protein 4; n=1; Schizosac...    46   5e-04
UniRef50_Q17GZ9 Cluster: Actin-related protein 5; n=4; Endoptery...    46   7e-04
UniRef50_A2FH22 Cluster: Actin family protein; n=1; Trichomonas ...    45   0.002
UniRef50_Q383R8 Cluster: Actin-like protein, putative; n=4; Tryp...    44   0.002
UniRef50_Q4SGD5 Cluster: Chromosome 17 SCAF14597, whole genome s...    44   0.004
UniRef50_A4S826 Cluster: Predicted protein; n=1; Ostreococcus lu...    44   0.004
UniRef50_Q4QF44 Cluster: Actin-related protein 3, putative; n=3;...    44   0.004
UniRef50_Q9Y614 Cluster: Actin-like protein 7B; n=12; Theria|Rep...    44   0.004
UniRef50_Q54JL1 Cluster: Putative uncharacterized protein; n=1; ...    43   0.005
UniRef50_Q22WQ4 Cluster: Actin family protein; n=1; Tetrahymena ...    43   0.005
UniRef50_Q5KLG9 Cluster: 53 kDa brg1-associated factor b (Actin-...    43   0.006
UniRef50_UPI000049A548 Cluster: actin; n=1; Entamoeba histolytic...    42   0.008
UniRef50_UPI00005A3B5D Cluster: PREDICTED: similar to Actin-5C; ...    42   0.011
UniRef50_Q14BL3 Cluster: RIKEN cDNA 4921517D21 gene; n=7; Euther...    42   0.011
UniRef50_UPI0000499930 Cluster: actin; n=1; Entamoeba histolytic...    42   0.015
UniRef50_Q7M3Y5 Cluster: Actin; n=1; Aplysia californica|Rep: Ac...    42   0.015
UniRef50_Q4DMP2 Cluster: Actin-related protein 2, putative; n=4;...    42   0.015
UniRef50_A0CQQ2 Cluster: Chromosome undetermined scaffold_24, wh...    42   0.015
UniRef50_A2YQV6 Cluster: Putative uncharacterized protein; n=1; ...    41   0.019
UniRef50_Q8IS27 Cluster: Actin-related protein 2; n=5; Oligohyme...    41   0.019
UniRef50_A6R1X8 Cluster: Putative uncharacterized protein; n=1; ...    41   0.019
UniRef50_Q4P2E8 Cluster: Actin-related protein 4; n=1; Ustilago ...    41   0.019
UniRef50_A0D9D5 Cluster: Chromosome undetermined scaffold_42, wh...    41   0.026
UniRef50_A5B4L4 Cluster: Putative uncharacterized protein; n=1; ...    40   0.034
UniRef50_Q19R57 Cluster: Actin-like protein 1; n=2; Trypanosoma ...    40   0.034
UniRef50_Q6X960 Cluster: HSD21; n=13; Theria|Rep: HSD21 - Homo s...    40   0.034
UniRef50_UPI0000E47BC7 Cluster: PREDICTED: similar to ubiquitin/...    40   0.045
UniRef50_Q19R56 Cluster: Actin-like protein 3; n=4; Trypanosoma ...    40   0.045
UniRef50_Q4WA13 Cluster: Chromatin remodeling complex subunit (A...    40   0.045
UniRef50_Q5CSX9 Cluster: Actin; n=2; Cryptosporidium|Rep: Actin ...    40   0.059
UniRef50_Q2H0E9 Cluster: Putative uncharacterized protein; n=1; ...    40   0.059
UniRef50_Q0H7S7 Cluster: Actin; n=29; Sordariomycetes|Rep: Actin...    40   0.059
UniRef50_UPI0000F2D272 Cluster: PREDICTED: similar to actin; n=1...    39   0.078
UniRef50_Q8IIQ4 Cluster: Actin, putative; n=7; Apicomplexa|Rep: ...    39   0.078
UniRef50_A2DNQ0 Cluster: Actin family protein; n=1; Trichomonas ...    39   0.078
UniRef50_P61158 Cluster: Actin-related protein 3; n=107; Eukaryo...    39   0.078
UniRef50_Q9NZ32 Cluster: Actin-related protein 10; n=40; Eumetaz...    39   0.10 
UniRef50_Q18PR4 Cluster: Actin-related protein; n=1; Porphyra ye...    38   0.14 
UniRef50_Q6C0A9 Cluster: Yarrowia lipolytica chromosome F of str...    38   0.14 
UniRef50_P80428 Cluster: Actin-related protein 4; n=4; Saccharom...    38   0.14 
UniRef50_Q9N4N4 Cluster: Putative uncharacterized protein; n=2; ...    38   0.18 
UniRef50_Q6BIA3 Cluster: CA5059|IPF3691 Candida albicans IPF3691...    38   0.18 
UniRef50_A6RD01 Cluster: Putative uncharacterized protein; n=1; ...    38   0.18 
UniRef50_A3FQE6 Cluster: Putative uncharacterized protein; n=2; ...    38   0.24 
UniRef50_Q7SHR0 Cluster: Actin-related protein 4; n=16; Pezizomy...    38   0.24 
UniRef50_Q9Y7X8 Cluster: Actin-like protein Arp5; n=1; Schizosac...    37   0.32 
UniRef50_A7TST0 Cluster: Putative uncharacterized protein; n=1; ...    37   0.32 
UniRef50_Q6C061 Cluster: Actin-related protein 4; n=1; Yarrowia ...    37   0.32 
UniRef50_Q9H568 Cluster: Actin-like protein 8; n=10; Eutheria|Re...    37   0.32 
UniRef50_A2VD47 Cluster: Zgc:158823 protein; n=3; Eukaryota|Rep:...    37   0.42 
UniRef50_Q4UGT7 Cluster: Actin-related protein, putative; n=2; T...    37   0.42 
UniRef50_Q09849 Cluster: Uncharacterized protein C23D3.09; n=1; ...    37   0.42 
UniRef50_UPI0000D56C2F Cluster: PREDICTED: similar to Actin-57B;...    36   0.55 
UniRef50_Q7S6X6 Cluster: Actin-like protein arp-6; n=5; Pezizomy...    36   0.55 
UniRef50_Q6CSB9 Cluster: Actin-related protein 4; n=1; Kluyverom...    36   0.55 
UniRef50_Q6BXN0 Cluster: Actin-related protein 4; n=7; Saccharom...    36   0.73 
UniRef50_UPI0000E4A0BF Cluster: PREDICTED: similar to Actin-rela...    36   0.97 
UniRef50_Q4N7N1 Cluster: Actin, putative; n=2; Theileria|Rep: Ac...    36   0.97 
UniRef50_P32392 Cluster: Actin-related protein 3; n=27; Eukaryot...    35   1.3  
UniRef50_Q8I450 Cluster: Actin-related protein, putative; n=5; P...    35   1.7  
UniRef50_Q7QA11 Cluster: ENSANGP00000003921; n=1; Anopheles gamb...    35   1.7  
UniRef50_A2DEE0 Cluster: Actin family protein; n=1; Trichomonas ...    35   1.7  
UniRef50_Q7RR61 Cluster: Actin-like 6; n=3; Plasmodium (Vinckeia...    34   2.2  
UniRef50_Q4Q187 Cluster: Actin-like protein, putative; n=3; Leis...    34   2.2  
UniRef50_Q09443 Cluster: Actin-like protein C08B11.6; n=2; Caeno...    34   2.2  
UniRef50_A7AQU0 Cluster: Actin-related, putative; n=1; Babesia b...    34   2.9  
UniRef50_UPI0000E477BD Cluster: PREDICTED: similar to uncharacte...    33   3.9  
UniRef50_UPI0000E254E7 Cluster: PREDICTED: similar to putative c...    33   3.9  
UniRef50_Q81ND7 Cluster: Putative uncharacterized protein; n=3; ...    33   3.9  
UniRef50_Q6BG23 Cluster: Actin, putative; n=1; Paramecium tetrau...    33   3.9  
UniRef50_A5KAY0 Cluster: Actin-related protein, putative; n=1; P...    33   3.9  
UniRef50_Q0V0G6 Cluster: Putative uncharacterized protein; n=1; ...    33   3.9  
UniRef50_UPI0000498FDF Cluster: actin; n=1; Entamoeba histolytic...    33   5.1  
UniRef50_UPI000061673C Cluster: Thrombospondin repeat containing...    33   5.1  
UniRef50_Q7M3Y6 Cluster: Actin homolog fat, testicular; n=3; Deu...    33   5.1  
UniRef50_Q8SRZ3 Cluster: ACTIN-RELATED PROTEIN; n=1; Encephalito...    33   5.1  
UniRef50_Q4P820 Cluster: Putative uncharacterized protein; n=1; ...    33   5.1  
UniRef50_A1C924 Cluster: Actin family protein; n=4; Eurotiomycet...    33   5.1  
UniRef50_A1ZKI0 Cluster: Formiminoglutamate deiminase; n=2; Sphi...    33   6.8  
UniRef50_Q9SRK2 Cluster: Putative actin; n=1; Arabidopsis thalia...    33   6.8  
UniRef50_A2SY08 Cluster: Trhombospondin Bi; n=1; Ciona intestina...    33   6.8  
UniRef50_A5E5Q2 Cluster: Putative uncharacterized protein; n=1; ...    33   6.8  
UniRef50_Q6C982 Cluster: Actin-like protein ARP6; n=1; Yarrowia ...    33   6.8  
UniRef50_Q5AXH1 Cluster: Actin-like protein arp6; n=5; Trichocom...    33   6.8  
UniRef50_UPI000023F3F1 Cluster: hypothetical protein FG08918.1; ...    32   9.0  
UniRef50_UPI0000EC9F4D Cluster: HSD21.; n=2; Gallus gallus|Rep: ...    32   9.0  
UniRef50_Q8AXX1 Cluster: Putative gag protein; n=1; Danio rerio|...    32   9.0  
UniRef50_Q6SF88 Cluster: Esterase, putative; n=3; Bacteria|Rep: ...    32   9.0  
UniRef50_Q1NK22 Cluster: Electron-transferring-flavoprotein dehy...    32   9.0  
UniRef50_Q1FM23 Cluster: Putative uncharacterized protein; n=1; ...    32   9.0  
UniRef50_A1WYM4 Cluster: Prepilin peptidase precursor; n=1; Halo...    32   9.0  
UniRef50_Q8ILM5 Cluster: Actin, putative; n=1; Plasmodium falcip...    32   9.0  
UniRef50_Q5BXM4 Cluster: SJCHGC05761 protein; n=1; Schistosoma j...    32   9.0  
UniRef50_Q2PE20 Cluster: CG10067-PB, isoform B; n=1; Drosophila ...    32   9.0  
UniRef50_A2QYF6 Cluster: Similarity to proteins with this domain...    32   9.0  
UniRef50_Q0W6D4 Cluster: Putative uncharacterized protein; n=1; ...    32   9.0  
UniRef50_P23246 Cluster: Splicing factor, proline- and glutamine...    32   9.0  

>UniRef50_Q4JSC0 Cluster: Actin; n=13; Coelomata|Rep: Actin -
           Anopheles gambiae (African malaria mosquito)
          Length = 376

 Score =  148 bits (358), Expect = 1e-34
 Identities = 76/134 (56%), Positives = 85/134 (63%)
 Frame = +2

Query: 86  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGVRHR 265
           MCD++  ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMG KD+YVG   +
Sbjct: 1   MCDDDAGALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGNKDAYVGDEAQ 60

Query: 266 AKXXXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSWVSPPEEHPVLLTEAPLNPKATERKM 445
           +K                      +             PEEHPVLLTEAPLNPK+   KM
Sbjct: 61  SKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKSNREKM 120

Query: 446 THIMFPKHFTRPAI 487
           T IMF + F  PA+
Sbjct: 121 TQIMF-ETFAAPAV 133



 Score =  102 bits (245), Expect = 6e-21
 Identities = 58/115 (50%), Positives = 66/115 (57%)
 Frame = +1

Query: 229 GTEGLLCRSEAQSKRGFLTLKYPIEHGIVTNWDDMEKIWHHTFYNELGVAPRGTPSPAH* 408
           G +      EAQSKRG LTLKYPIEHGI+TNWDDMEKIWHHTFYNEL VAP   P     
Sbjct: 49  GNKDAYVGDEAQSKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPVLLTE 108

Query: 409 GSPQPQGHREKDDPYHVSKTFYTPRHCSVGIQTVLLAFTPFRGRYPTRDSRLGLS 573
               P+ +REK     + +TF  P    V IQ VL  +   R      DS  G+S
Sbjct: 109 APLNPKSNREKMTQI-MFETFAAPA-VYVAIQAVLSLYASGRTTGVVLDSGDGVS 161


>UniRef50_O65314 Cluster: Actin; n=20; Eukaryota|Rep: Actin -
           Scherffelia dubia
          Length = 378

 Score =  139 bits (336), Expect = 5e-32
 Identities = 76/132 (57%), Positives = 83/132 (62%)
 Frame = +2

Query: 92  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGVRHRAK 271
           D EV+ALV DNGSGM KAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKD+YVG   ++K
Sbjct: 5   DGEVSALVCDNGSGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDEAQSK 64

Query: 272 XXXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSWVSPPEEHPVLLTEAPLNPKATERKMTH 451
                                 +             PEEHPVLLTEAPLNPKA   KMT 
Sbjct: 65  RGILTLKYPIEHGVVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQ 124

Query: 452 IMFPKHFTRPAI 487
           IMF + F  PA+
Sbjct: 125 IMF-ETFNVPAM 135



 Score =  100 bits (239), Expect = 3e-20
 Identities = 56/106 (52%), Positives = 64/106 (60%)
 Frame = +1

Query: 256 EAQSKRGFLTLKYPIEHGIVTNWDDMEKIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHR 435
           EAQSKRG LTLKYPIEHG+V+NWDDMEKIWHHTFYNEL VAP   P         P+ +R
Sbjct: 60  EAQSKRGILTLKYPIEHGVVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANR 119

Query: 436 EKDDPYHVSKTFYTPRHCSVGIQTVLLAFTPFRGRYPTRDSRLGLS 573
           EK     + +TF  P    V IQ VL  +   R      DS  G+S
Sbjct: 120 EKMTQI-MFETFNVPA-MYVAIQAVLSLYASGRTTGIVLDSGDGVS 163


>UniRef50_P02581 Cluster: Actin-1; n=1852; Eukaryota|Rep: Actin-1 -
           Glycine max (Soybean)
          Length = 377

 Score =  118 bits (284), Expect = 1e-25
 Identities = 64/131 (48%), Positives = 75/131 (57%)
 Frame = +2

Query: 95  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGVRHRAKX 274
           E++  LV DNG+GM KAG AGDDAPRAVFPSIVGRPRH  V+VGMGQKD+YVG   + + 
Sbjct: 5   EDIQPLVCDNGTGMVKAGLAGDDAPRAVFPSIVGRPRHTXVVVGMGQKDAYVGDEAQVQR 64

Query: 275 XXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSWVSPPEEHPVLLTEAPLNPKATERKMTHI 454
                                +             PEEHPVLLTEAPLNPK    KM  +
Sbjct: 65  GILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKYNREKMXRV 124

Query: 455 MFPKHFTRPAI 487
           MF + F  PA+
Sbjct: 125 MF-ETFGAPAV 134



 Score = 95.1 bits (226), Expect = 1e-18
 Identities = 54/106 (50%), Positives = 63/106 (59%)
 Frame = +1

Query: 256 EAQSKRGFLTLKYPIEHGIVTNWDDMEKIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHR 435
           EAQ +RG LTLKYPIEHGIV+NWDDMEKIWHHTFYNEL VAP   P         P+ +R
Sbjct: 59  EAQVQRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKYNR 118

Query: 436 EKDDPYHVSKTFYTPRHCSVGIQTVLLAFTPFRGRYPTRDSRLGLS 573
           EK     + +TF  P  C V +  VL  +   R      DS  G+S
Sbjct: 119 EKMXRV-MFETFGAPAVC-VAVLAVLSLYASGRTTGIVLDSGDGVS 162


>UniRef50_P14883 Cluster: Actin-2; n=75; Eukaryota|Rep: Actin-2 -
           Plasmodium falciparum
          Length = 376

 Score =  114 bits (275), Expect = 1e-24
 Identities = 74/168 (44%), Positives = 86/168 (51%)
 Frame = +2

Query: 95  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGVRHRAKX 274
           EE  ALVVDNGSGM K+G AGDDAP+ VFPSIVGRP+   +M+GM QK+ YVG   + K 
Sbjct: 3   EEAVALVVDNGSGMVKSGLAGDDAPKCVFPSIVGRPKMPNIMIGMEQKECYVGDEAQNKR 62

Query: 275 XXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSWVSPPEEHPVLLTEAPLNPKATERKMTHI 454
                                +             PEEHPVLLTEAPLNPK    KMT I
Sbjct: 63  GILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVSPEEHPVLLTEAPLNPKTNREKMTQI 122

Query: 455 MFPKHFTRPAIVPSAFKPCFLLLHRFGAVTQPGIRGLDFPGGTGVFSH 598
           MF + F  PA+  S      L L+  G  T     G+    G GV SH
Sbjct: 123 MF-ETFDVPAMYVSI--QAILSLYASGRTT-----GIVLDSGDGV-SH 161



 Score = 98.3 bits (234), Expect = 1e-19
 Identities = 55/106 (51%), Positives = 64/106 (60%)
 Frame = +1

Query: 256 EAQSKRGFLTLKYPIEHGIVTNWDDMEKIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHR 435
           EAQ+KRG LTLKYPIEHGIVTNWDDMEKIWHHTFYNEL V+P   P         P+ +R
Sbjct: 57  EAQNKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVSPEEHPVLLTEAPLNPKTNR 116

Query: 436 EKDDPYHVSKTFYTPRHCSVGIQTVLLAFTPFRGRYPTRDSRLGLS 573
           EK     + +TF  P    V IQ +L  +   R      DS  G+S
Sbjct: 117 EKMTQI-MFETFDVPA-MYVSIQAILSLYASGRTTGIVLDSGDGVS 160


>UniRef50_Q96483 Cluster: Actin-51; n=584; Eukaryota|Rep: Actin-51 -
           Solanum lycopersicum (Tomato) (Lycopersicon esculentum)
          Length = 336

 Score =  109 bits (261), Expect = 6e-23
 Identities = 61/115 (53%), Positives = 67/115 (58%)
 Frame = +2

Query: 143 AGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGVRHRAKXXXXXXXXXXXXXXXLT 322
           AGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKD+Y G   ++K                 
Sbjct: 1   AGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYDGDEAQSKRGILTLKYPIEHGIVSN 60

Query: 323 GMTWRRFGIIPSTMSWVSPPEEHPVLLTEAPLNPKATERKMTHIMFPKHFTRPAI 487
                +             PEEHPVLLTEAPLNPKA   KMT IMF + F  PA+
Sbjct: 61  WDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMF-ETFNVPAM 114



 Score =  100 bits (240), Expect = 2e-20
 Identities = 57/106 (53%), Positives = 64/106 (60%)
 Frame = +1

Query: 256 EAQSKRGFLTLKYPIEHGIVTNWDDMEKIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHR 435
           EAQSKRG LTLKYPIEHGIV+NWDDMEKIWHHTFYNEL VAP   P         P+ +R
Sbjct: 39  EAQSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANR 98

Query: 436 EKDDPYHVSKTFYTPRHCSVGIQTVLLAFTPFRGRYPTRDSRLGLS 573
           EK     + +TF  P    V IQ VL  +   R      DS  G+S
Sbjct: 99  EKMTQI-MFETFNVPA-MYVAIQAVLSLYASGRTTGIVLDSGDGVS 142


>UniRef50_A7RPC3 Cluster: Predicted protein; n=3; Eumetazoa|Rep:
           Predicted protein - Nematostella vectensis
          Length = 64

 Score = 90.6 bits (215), Expect = 2e-17
 Identities = 42/55 (76%), Positives = 45/55 (81%)
 Frame = +2

Query: 107 ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGVRHRAK 271
           ALV+D GS M K GFAGDDAP+ VFP IVGRPRHQGVMVGMGQKDSYVG    +K
Sbjct: 1   ALVIDVGSHMWKVGFAGDDAPKGVFPPIVGRPRHQGVMVGMGQKDSYVGWEAHSK 55


>UniRef50_Q0VHZ5 Cluster: Actin deviating protein; n=7;
           Eukaryota|Rep: Actin deviating protein - Bolivina sp.
           isolate 615
          Length = 360

 Score = 87.0 bits (206), Expect = 3e-16
 Identities = 49/110 (44%), Positives = 58/110 (52%)
 Frame = +2

Query: 155 GDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGVRHRAKXXXXXXXXXXXXXXXLTGMTW 334
           GDDAPRAVFP+I GR R  GVMVGM QK+ YVG   ++K                +    
Sbjct: 1   GDDAPRAVFPAITGRRRRNGVMVGMAQKNCYVGDEAQSKRGILSLRWPIVHGISTSWDDV 60

Query: 335 RRFGIIPSTMSWVSPPEEHPVLLTEAPLNPKATERKMTHIMFPKHFTRPA 484
                          PEEHP+L+TE PLNPKA  +KMT IMF + F  PA
Sbjct: 61  EEIWRHTFYQELRIQPEEHPILMTEPPLNPKANRQKMTQIMF-ETFNTPA 109



 Score = 76.6 bits (180), Expect = 4e-13
 Identities = 41/93 (44%), Positives = 56/93 (60%)
 Frame = +1

Query: 256 EAQSKRGFLTLKYPIEHGIVTNWDDMEKIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHR 435
           EAQSKRG L+L++PI HGI T+WDD+E+IW HTFY EL + P   P         P+ +R
Sbjct: 35  EAQSKRGILSLRWPIVHGISTSWDDVEEIWRHTFYQELRIQPEEHPILMTEPPLNPKANR 94

Query: 436 EKDDPYHVSKTFYTPRHCSVGIQTVLLAFTPFR 534
           +K     + +TF TP   +  IQ+VL  +   R
Sbjct: 95  QKMTQI-MFETFNTPAFYT-AIQSVLSLYASGR 125


>UniRef50_UPI0000449751 Cluster: PREDICTED: similar to gamma-actin;
           n=3; Amniota|Rep: PREDICTED: similar to gamma-actin -
           Gallus gallus
          Length = 377

 Score = 85.8 bits (203), Expect = 7e-16
 Identities = 48/126 (38%), Positives = 64/126 (50%)
 Frame = +2

Query: 110 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGVRHRAKXXXXXX 289
           +V DNGSG CKAG +G+ APR+V P+IVG P+   VM+GM  +D YVG   ++K      
Sbjct: 12  VVFDNGSGQCKAGLSGEQAPRSVIPTIVGYPKFTFVMIGMEHRDWYVGEEAQSKRGILSL 71

Query: 290 XXXXXXXXXLTGMTWRRFGIIPSTMSWVSPPEEHPVLLTEAPLNPKATERKMTHIMFPKH 469
                     +     +             P E PVLLTE PLNP +   KM  +MF + 
Sbjct: 72  TYPMENGVVTSWDNMEKIWRYLYEHELGVKPSEGPVLLTETPLNPPSHREKMAELMF-ES 130

Query: 470 FTRPAI 487
           F  PA+
Sbjct: 131 FQVPAL 136



 Score = 72.9 bits (171), Expect = 5e-12
 Identities = 33/62 (53%), Positives = 42/62 (67%)
 Frame = +1

Query: 256 EAQSKRGFLTLKYPIEHGIVTNWDDMEKIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHR 435
           EAQSKRG L+L YP+E+G+VT+WD+MEKIW + + +ELGV P   P         P  HR
Sbjct: 61  EAQSKRGILSLTYPMENGVVTSWDNMEKIWRYLYEHELGVKPSEGPVLLTETPLNPPSHR 120

Query: 436 EK 441
           EK
Sbjct: 121 EK 122


>UniRef50_UPI0000605B09 Cluster: PREDICTED: similar to actin alpha 1
           skeletal muscle protein; n=1; Mus musculus|Rep:
           PREDICTED: similar to actin alpha 1 skeletal muscle
           protein - Mus musculus
          Length = 255

 Score = 83.0 bits (196), Expect = 5e-15
 Identities = 44/130 (33%), Positives = 66/130 (50%)
 Frame = +2

Query: 98  EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGVRHRAKXX 277
           E   LV D GSG  K GF+G  AP+AVFP+I+G+ +H  V+ G+G++D ++G   +    
Sbjct: 2   EKTPLVCDYGSGFSKVGFSGTQAPQAVFPTILGKMKHTNVLEGLGEQDWFIGAETQTNRT 61

Query: 278 XXXXXXXXXXXXXLTGMTWRRFGIIPSTMSWVSPPEEHPVLLTEAPLNPKATERKMTHIM 457
                               +        S    PE+HP+L+TEAPL  K  + +MT I+
Sbjct: 62  ELNMYYPISRGAITNWDNVEKIWHYSFYHSLQIAPEQHPILITEAPLTSKEAKSRMTQIL 121

Query: 458 FPKHFTRPAI 487
           F + F  PA+
Sbjct: 122 F-ETFNFPAL 130



 Score = 61.3 bits (142), Expect = 2e-08
 Identities = 24/55 (43%), Positives = 35/55 (63%)
 Frame = +1

Query: 229 GTEGLLCRSEAQSKRGFLTLKYPIEHGIVTNWDDMEKIWHHTFYNELGVAPRGTP 393
           G +     +E Q+ R  L + YPI  G +TNWD++EKIWH++FY+ L +AP   P
Sbjct: 46  GEQDWFIGAETQTNRTELNMYYPISRGAITNWDNVEKIWHYSFYHSLQIAPEQHP 100


>UniRef50_UPI00001E426E Cluster: PREDICTED: similar to actin-12;
           n=11; Eutheria|Rep: PREDICTED: similar to actin-12 - Mus
           musculus
          Length = 372

 Score = 83.0 bits (196), Expect = 5e-15
 Identities = 44/130 (33%), Positives = 66/130 (50%)
 Frame = +2

Query: 98  EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGVRHRAKXX 277
           E   LV D GSG  K GF+G  AP+AVFP+I+G+ +H  V+ G+G++D ++G   +    
Sbjct: 2   EKTPLVCDYGSGFSKVGFSGTQAPQAVFPTILGKMKHTNVLEGLGEQDWFIGAETQTNRT 61

Query: 278 XXXXXXXXXXXXXLTGMTWRRFGIIPSTMSWVSPPEEHPVLLTEAPLNPKATERKMTHIM 457
                               +        S    PE+HP+L+TEAPL  K  + +MT I+
Sbjct: 62  ELNMYYPISRGAITNWDNVEKIWHYSFYHSLQIAPEQHPILITEAPLTSKEAKSRMTQIL 121

Query: 458 FPKHFTRPAI 487
           F + F  PA+
Sbjct: 122 F-ETFNFPAL 130



 Score = 61.3 bits (142), Expect = 2e-08
 Identities = 24/55 (43%), Positives = 35/55 (63%)
 Frame = +1

Query: 229 GTEGLLCRSEAQSKRGFLTLKYPIEHGIVTNWDDMEKIWHHTFYNELGVAPRGTP 393
           G +     +E Q+ R  L + YPI  G +TNWD++EKIWH++FY+ L +AP   P
Sbjct: 46  GEQDWFIGAETQTNRTELNMYYPISRGAITNWDNVEKIWHYSFYHSLQIAPEQHP 100


>UniRef50_UPI000065FC19 Cluster: Homolog of Homo sapiens "Actin,
           cytoplasmic 2; n=1; Takifugu rubripes|Rep: Homolog of
           Homo sapiens "Actin, cytoplasmic 2 - Takifugu rubripes
          Length = 396

 Score = 82.6 bits (195), Expect = 6e-15
 Identities = 43/119 (36%), Positives = 64/119 (53%), Gaps = 2/119 (1%)
 Frame = +2

Query: 110 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGVRHRAKXXXXXX 289
           +V+D GSG  KAGFA +D P  VFP+I+G P+++ +M G  ++++Y+G  H A+      
Sbjct: 2   IVLDTGSGFMKAGFADEDLPNVVFPTIIGMPKYEEIMNGRAERETYIG--HEAQHMRGVL 59

Query: 290 XXXXXXXXXLTGMTWRRFGII--PSTMSWVSPPEEHPVLLTEAPLNPKATERKMTHIMF 460
                    +    W     I   + +     PE+HPVLLTEA +NP    R+M  IMF
Sbjct: 60  ALKHPIKNGII-QNWDEMEKIWHHTFLQMRVDPEDHPVLLTEAAMNPLENRRRMVEIMF 117



 Score = 63.3 bits (147), Expect = 4e-09
 Identities = 27/46 (58%), Positives = 34/46 (73%)
 Frame = +1

Query: 256 EAQSKRGFLTLKYPIEHGIVTNWDDMEKIWHHTFYNELGVAPRGTP 393
           EAQ  RG L LK+PI++GI+ NWD+MEKIWHHTF  ++ V P   P
Sbjct: 51  EAQHMRGVLALKHPIKNGIIQNWDEMEKIWHHTFL-QMRVDPEDHP 95


>UniRef50_Q7XB26 Cluster: Ubiquitin/actin fusion protein 4; n=1;
           Bigelowiella natans|Rep: Ubiquitin/actin fusion protein
           4 - Bigelowiella natans (Pedinomonas minutissima)
           (Chlorarachnion sp.(strain CCMP 621))
          Length = 234

 Score = 82.6 bits (195), Expect = 6e-15
 Identities = 54/130 (41%), Positives = 62/130 (47%)
 Frame = +2

Query: 95  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGVRHRAKX 274
           EE   LVVDNGS M KAGFAGD APR  FPS+   PR +  M   G++D Y+G    AK 
Sbjct: 78  EECQPLVVDNGSDMIKAGFAGDGAPRTAFPSVFKVPRVRNTMT--GKQDVYIG-SVNAKR 134

Query: 275 XXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSWVSPPEEHPVLLTEAPLNPKATERKMTHI 454
                                +             PEEHPVLLTE PLNPKA   K   +
Sbjct: 135 GVLINKYAIEHGIVTDWDAMLKIWDHTFLNELKVAPEEHPVLLTEPPLNPKANREKTIKV 194

Query: 455 MFPKHFTRPA 484
           MF + F  PA
Sbjct: 195 MF-ETFKTPA 203



 Score = 71.3 bits (167), Expect = 2e-11
 Identities = 45/103 (43%), Positives = 54/103 (52%)
 Frame = +1

Query: 265 SKRGFLTLKYPIEHGIVTNWDDMEKIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHREKD 444
           +KRG L  KY IEHGIVT+WD M KIW HTF NEL VAP   P         P+ +REK 
Sbjct: 132 AKRGVLINKYAIEHGIVTDWDAMLKIWDHTFLNELKVAPEEHPVLLTEPPLNPKANREKT 191

Query: 445 DPYHVSKTFYTPRHCSVGIQTVLLAFTPFRGRYPTRDSRLGLS 573
               + +TF TP    + IQ  L  +   R      DS  G+S
Sbjct: 192 IKV-MFETFKTPA-TYIAIQAALSLYASGRTTGIVLDSGKGVS 232


>UniRef50_P61163 Cluster: Alpha-centractin; n=356; root|Rep:
           Alpha-centractin - Homo sapiens (Human)
          Length = 376

 Score = 81.0 bits (191), Expect = 2e-14
 Identities = 46/127 (36%), Positives = 64/127 (50%), Gaps = 1/127 (0%)
 Frame = +2

Query: 110 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGVRHRAKXXXXXX 289
           +V+DNGSG+ KAGFAGD  P+  FP+ VGRP+H  VM G  + D ++G +          
Sbjct: 12  VVIDNGSGVIKAGFAGDQIPKYCFPNYVGRPKHVRVMAGALEGDIFIGPKAEEHRGLLSI 71

Query: 290 XXXXXXXXXLTGMTWRR-FGIIPSTMSWVSPPEEHPVLLTEAPLNPKATERKMTHIMFPK 466
                           R +  + S     +  EEHPVLLTEAPLNP+    +   + F +
Sbjct: 72  RYPMEHGIVKDWNDMERIWQYVYSKDQLQTFSEEHPVLLTEAPLNPRKNRERAAEVFF-E 130

Query: 467 HFTRPAI 487
            F  PA+
Sbjct: 131 TFNVPAL 137



 Score = 51.6 bits (118), Expect = 1e-05
 Identities = 17/34 (50%), Positives = 28/34 (82%)
 Frame = +1

Query: 256 EAQSKRGFLTLKYPIEHGIVTNWDDMEKIWHHTF 357
           +A+  RG L+++YP+EHGIV +W+DME+IW + +
Sbjct: 61  KAEEHRGLLSIRYPMEHGIVKDWNDMERIWQYVY 94


>UniRef50_UPI0000E466A7 Cluster: PREDICTED: similar to actin, alpha
           1, skeletal muscle; n=1; Strongylocentrotus
           purpuratus|Rep: PREDICTED: similar to actin, alpha 1,
           skeletal muscle - Strongylocentrotus purpuratus
          Length = 258

 Score = 80.6 bits (190), Expect = 3e-14
 Identities = 33/43 (76%), Positives = 37/43 (86%)
 Frame = +1

Query: 256 EAQSKRGFLTLKYPIEHGIVTNWDDMEKIWHHTFYNELGVAPR 384
           EAQ KRG L++KYPIE GIVTNW+DME IWHHTFYNEL V P+
Sbjct: 16  EAQRKRGLLSIKYPIERGIVTNWEDMETIWHHTFYNELRVDPK 58


>UniRef50_A4QNT8 Cluster: Si:ch211-241j12.3 protein; n=3; Danio
           rerio|Rep: Si:ch211-241j12.3 protein - Danio rerio
           (Zebrafish) (Brachydanio rerio)
          Length = 389

 Score = 79.4 bits (187), Expect = 6e-14
 Identities = 43/119 (36%), Positives = 65/119 (54%), Gaps = 2/119 (1%)
 Frame = +2

Query: 110 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGVRHRAKXXXXXX 289
           +V+D+GSG+ KAGFA  D P AVFP+++GRP+++ VM     ++ YVG  H A+      
Sbjct: 25  IVLDSGSGLMKAGFADQDLPAAVFPTVIGRPKYEEVMNSCVDRELYVG--HDAQHMRGVL 82

Query: 290 XXXXXXXXXLTGMTWRRFGII--PSTMSWVSPPEEHPVLLTEAPLNPKATERKMTHIMF 460
                    +    W    ++   +     + PE+HPVLLTEA LNP    ++M  +MF
Sbjct: 83  TLRYPIRHGVVS-NWDEMEMLWTHAFQLLSAAPEDHPVLLTEAALNPLQNRQRMVELMF 140


>UniRef50_A2DKQ5 Cluster: Actin 58, putative; n=2; Trichomonas
           vaginalis G3|Rep: Actin 58, putative - Trichomonas
           vaginalis G3
          Length = 373

 Score = 76.2 bits (179), Expect = 6e-13
 Identities = 40/117 (34%), Positives = 58/117 (49%)
 Frame = +2

Query: 110 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGVRHRAKXXXXXX 289
           +V+DNG+G+ KAGFAG +AP++VFP+I+G P+    MVG   KD +VG     K      
Sbjct: 6   IVIDNGTGLTKAGFAGAEAPKSVFPTIIGSPKSNMQMVGGQNKDFFVGFEAVQKSDLLVL 65

Query: 290 XXXXXXXXXLTGMTWRRFGIIPSTMSWVSPPEEHPVLLTEAPLNPKATERKMTHIMF 460
                           +          +  PEEHPV+L E P++P+    K   +MF
Sbjct: 66  RQPIENGTISNWDDIEKIWHHTFYNELLVAPEEHPVILAEKPMSPRMNREKKIQMMF 122



 Score = 71.7 bits (168), Expect = 1e-11
 Identities = 40/90 (44%), Positives = 52/90 (57%)
 Frame = +1

Query: 256 EAQSKRGFLTLKYPIEHGIVTNWDDMEKIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHR 435
           EA  K   L L+ PIE+G ++NWDD+EKIWHHTFYNEL VAP   P         P+ +R
Sbjct: 55  EAVQKSDLLVLRQPIENGTISNWDDIEKIWHHTFYNELLVAPEEHPVILAEKPMSPRMNR 114

Query: 436 EKDDPYHVSKTFYTPRHCSVGIQTVLLAFT 525
           EK     + +TF       +G+Q VL  F+
Sbjct: 115 EKKIQM-MFETFNVSGF-YLGMQAVLALFS 142


>UniRef50_UPI00006C1719 Cluster: PREDICTED: similar to actin, alpha
           2, smooth muscle, aorta; n=3; Homo/Pan/Gorilla
           group|Rep: PREDICTED: similar to actin, alpha 2, smooth
           muscle, aorta - Homo sapiens
          Length = 183

 Score = 75.8 bits (178), Expect = 7e-13
 Identities = 33/42 (78%), Positives = 36/42 (85%)
 Frame = +1

Query: 256 EAQSKRGFLTLKYPIEHGIVTNWDDMEKIWHHTFYNELGVAP 381
           EAQSK G LTLKYPIE G+VTN DDMEKIWHHTFYN+L + P
Sbjct: 11  EAQSKYGILTLKYPIEQGMVTNRDDMEKIWHHTFYNKLRLHP 52


>UniRef50_Q0VHZ6 Cluster: Actin deviating protein; n=2; Bolivina sp.
           isolate 615|Rep: Actin deviating protein - Bolivina sp.
           isolate 615
          Length = 387

 Score = 73.3 bits (172), Expect = 4e-12
 Identities = 30/46 (65%), Positives = 35/46 (76%)
 Frame = +1

Query: 256 EAQSKRGFLTLKYPIEHGIVTNWDDMEKIWHHTFYNELGVAPRGTP 393
           EAQSKRG L L +P++ G+V NWDDMEKIWHHT Y+EL V P   P
Sbjct: 35  EAQSKRGILKLMHPMQRGVVKNWDDMEKIWHHTLYHELRVQPEEHP 80



 Score = 66.1 bits (154), Expect = 6e-10
 Identities = 37/102 (36%), Positives = 47/102 (46%)
 Frame = +2

Query: 155 GDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGVRHRAKXXXXXXXXXXXXXXXLTGMTW 334
           G DAPRAVFP+IVG  +H+G+ VGM QK  YVG   ++K                     
Sbjct: 1   GVDAPRAVFPTIVGTLKHRGIFVGMAQKSYYVGDEAQSKRGILKLMHPMQRGVVKNWDDM 60

Query: 335 RRFGIIPSTMSWVSPPEEHPVLLTEAPLNPKATERKMTHIMF 460
            +             PEEHP+L+T+ P   K    KM  IMF
Sbjct: 61  EKIWHHTLYHELRVQPEEHPILMTDTPFASKMDREKMAQIMF 102


>UniRef50_Q7M3B0 Cluster: Actin beta; n=1; Sus scrofa domestica|Rep:
           Actin beta - Sus scrofa domestica (domestic pig)
          Length = 195

 Score = 72.9 bits (171), Expect = 5e-12
 Identities = 29/30 (96%), Positives = 29/30 (96%)
 Frame = +1

Query: 292 YPIEHGIVTNWDDMEKIWHHTFYNELGVAP 381
           YPIEHGIVTNWDDMEKIWHHTFYNEL VAP
Sbjct: 21  YPIEHGIVTNWDDMEKIWHHTFYNELRVAP 50



 Score = 46.4 bits (105), Expect = 5e-04
 Identities = 20/20 (100%), Positives = 20/20 (100%)
 Frame = +2

Query: 143 AGFAGDDAPRAVFPSIVGRP 202
           AGFAGDDAPRAVFPSIVGRP
Sbjct: 1   AGFAGDDAPRAVFPSIVGRP 20


>UniRef50_Q2GY63 Cluster: Putative uncharacterized protein; n=1;
           Chaetomium globosum|Rep: Putative uncharacterized
           protein - Chaetomium globosum (Soil fungus)
          Length = 350

 Score = 72.1 bits (169), Expect = 9e-12
 Identities = 44/129 (34%), Positives = 67/129 (51%), Gaps = 2/129 (1%)
 Frame = +2

Query: 107 ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGVRHRAKXXXXX 286
           A+V+DNGSG  +AG++G+  P+  FPS VGRP+H  V+ G  + + +VG +  A+     
Sbjct: 9   AVVLDNGSGNIRAGYSGESEPKVNFPSWVGRPKHLRVLAGALEGEVFVGKKAAAELRGLL 68

Query: 287 XXXXXXXXXXLTGMTWRRFGIIPSTM--SWVSPPEEHPVLLTEAPLNPKATERKMTHIMF 460
                     +T   W     I S +        E+HP+LLTE PLNP++       I+F
Sbjct: 69  KIRYPLEHGIVT--DWDDMEKIWSHVYSELKCDAEQHPLLLTEPPLNPRSNRDTAAQILF 126

Query: 461 PKHFTRPAI 487
            + F  PA+
Sbjct: 127 -ETFNVPAL 134



 Score = 58.4 bits (135), Expect = 1e-07
 Identities = 24/40 (60%), Positives = 30/40 (75%)
 Frame = +1

Query: 250 RSEAQSKRGFLTLKYPIEHGIVTNWDDMEKIWHHTFYNEL 369
           +  A   RG L ++YP+EHGIVT+WDDMEKIW H  Y+EL
Sbjct: 58  KKAAAELRGLLKIRYPLEHGIVTDWDDMEKIWSHV-YSEL 96


>UniRef50_UPI0000F2D825 Cluster: PREDICTED: similar to actin; n=1;
           Monodelphis domestica|Rep: PREDICTED: similar to actin -
           Monodelphis domestica
          Length = 416

 Score = 70.1 bits (164), Expect = 4e-11
 Identities = 40/94 (42%), Positives = 52/94 (55%)
 Frame = +1

Query: 253 SEAQSKRGFLTLKYPIEHGIVTNWDDMEKIWHHTFYNELGVAPRGTPSPAH*GSPQPQGH 432
           +E   K   L +KYPIEHGI+ NWDDMEKIWHH+FYN L V P   P         P+ +
Sbjct: 100 NEVIEKWANLLVKYPIEHGIIVNWDDMEKIWHHSFYNVLHVDPEKHPLLVTEHLFTPKAN 159

Query: 433 REKDDPYHVSKTFYTPRHCSVGIQTVLLAFTPFR 534
           +EK     + ++F  P    V IQ +L  F+  R
Sbjct: 160 KEKLIEV-MFESFRVPA-LYVAIQDILSLFSSGR 191



 Score = 60.1 bits (139), Expect = 4e-08
 Identities = 37/130 (28%), Positives = 58/130 (44%)
 Frame = +2

Query: 98  EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGVRHRAKXX 277
           E   ++ D GS   K G+ G+ +PR VFPS +G  R Q +  GM  +D+++G     K  
Sbjct: 48  ESLPVIFDGGSRYFKVGYGGEYSPRFVFPSAIGHYRWQNIKSGMDLRDTFIGNEVIEKWA 107

Query: 278 XXXXXXXXXXXXXLTGMTWRRFGIIPSTMSWVSPPEEHPVLLTEAPLNPKATERKMTHIM 457
                        +      +             PE+HP+L+TE    PKA + K+  +M
Sbjct: 108 NLLVKYPIEHGIIVNWDDMEKIWHHSFYNVLHVDPEKHPLLVTEHLFTPKANKEKLIEVM 167

Query: 458 FPKHFTRPAI 487
           F + F  PA+
Sbjct: 168 F-ESFRVPAL 176


>UniRef50_A5E2K2 Cluster: Actin; n=5; Saccharomycetales|Rep: Actin -
           Lodderomyces elongisporus (Yeast) (Saccharomyces
           elongisporus)
          Length = 417

 Score = 69.7 bits (163), Expect = 5e-11
 Identities = 48/138 (34%), Positives = 67/138 (48%), Gaps = 12/138 (8%)
 Frame = +2

Query: 110 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVG------MGQ---KDSYVGVRH 262
           +VVDNG G  KAGFAG++ PR    SI+GRP++Q +M G       G     D+ + V  
Sbjct: 10  VVVDNGLGTLKAGFAGEEKPRTYASSIIGRPKYQKLMAGSLTSSTSGSTIASDTDLFVGD 69

Query: 263 RAKXXXXXXXXXXXXXXXLTGMTWRRFGII---PSTMSWVSPPEEHPVLLTEAPLNPKAT 433
            A+               +    W    II     T      PE+HP+L+TEAPLNP++ 
Sbjct: 70  AAQKNRGLLRLNYPVEHGIV-TKWSDMEIIWDHMFTQDLKIKPEDHPLLITEAPLNPRSN 128

Query: 434 ERKMTHIMFPKHFTRPAI 487
             KM  +MF + F  P +
Sbjct: 129 REKMCQVMF-EQFNVPCM 145



 Score = 64.9 bits (151), Expect = 1e-09
 Identities = 41/106 (38%), Positives = 51/106 (48%), Gaps = 1/106 (0%)
 Frame = +1

Query: 259 AQSKRGFLTLKYPIEHGIVTNWDDMEKIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHRE 438
           AQ  RG L L YP+EHGIVT W DME IW H F  +L + P   P         P+ +RE
Sbjct: 71  AQKNRGLLRLNYPVEHGIVTKWSDMEIIWDHMFTQDLKIKPEDHPLLITEAPLNPRSNRE 130

Query: 439 KDDPYHVSKTFYTPRHCS-VGIQTVLLAFTPFRGRYPTRDSRLGLS 573
           K     + + F  P  C  + IQ VL  +   R      DS  G+S
Sbjct: 131 KMCQV-MFEQFNVP--CMYISIQAVLALYASGRTTGVVVDSGDGVS 173


>UniRef50_Q9XZB9 Cluster: Actin; n=1; Sterkiella nova|Rep: Actin -
           Oxytricha nova
          Length = 374

 Score = 68.9 bits (161), Expect = 8e-11
 Identities = 42/150 (28%), Positives = 66/150 (44%)
 Frame = +2

Query: 95  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGVRHRAKX 274
           E    +V+DNGSG  KAGF G+D P  V  ++VGRP++Q  ++G+  KD ++G     K 
Sbjct: 2   ESSKTIVIDNGSGFVKAGFVGEDGPSVVLRNLVGRPKNQNAIIGVEAKDEFIGEDAYLKR 61

Query: 275 XXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSWVSPPEEHPVLLTEAPLNPKATERKMTHI 454
                                +      +        EHP L++E+PL P+    +   +
Sbjct: 62  GVLKFSYPVQHGIIKDWDDMEKVWNHLFSYELKVDSSEHPFLISESPLTPEFIREQTVQM 121

Query: 455 MFPKHFTRPAIVPSAFKPCFLLLHRFGAVT 544
           MF + F  P++  +      L LH  G  T
Sbjct: 122 MF-ETFNVPSLYMAI--SAALQLHSIGKTT 148



 Score = 58.0 bits (134), Expect = 2e-07
 Identities = 22/40 (55%), Positives = 29/40 (72%)
 Frame = +1

Query: 256 EAQSKRGFLTLKYPIEHGIVTNWDDMEKIWHHTFYNELGV 375
           +A  KRG L   YP++HGI+ +WDDMEK+W+H F  EL V
Sbjct: 56  DAYLKRGVLKFSYPVQHGIIKDWDDMEKVWNHLFSYELKV 95


>UniRef50_UPI00005A2ACF Cluster: PREDICTED: similar to cytoplasmic
           beta-actin; n=1; Canis lupus familiaris|Rep: PREDICTED:
           similar to cytoplasmic beta-actin - Canis familiaris
          Length = 268

 Score = 66.9 bits (156), Expect = 3e-10
 Identities = 46/119 (38%), Positives = 59/119 (49%), Gaps = 1/119 (0%)
 Frame = +1

Query: 229 GTEGLLCRSEAQSKRGFLTLKYPIEHGIVTNWDDMEKIWHHTFYNELGVAPRGTPSPAH* 408
           G +    R+EAQ K G LT KY IEHGIV NWDDME I HH FYN+L +AP         
Sbjct: 102 GQKDSYIRNEAQRKWGILTFKYCIEHGIVINWDDME-IQHHNFYNKLCMAPEELYILL-- 158

Query: 409 GSPQPQGHREKDDPYHVS-KTFYTPRHCSVGIQTVLLAFTPFRGRYPTRDSRLGLSGGN 582
            +  P   + K +   +  +TF TP    + IQTVL  +        T D  + +   N
Sbjct: 159 -TEIPLNLKAKGEMTQIMFETFNTPA-MYLAIQTVLFLYAVVTPLGVTMDMHIAVEEAN 215


>UniRef50_UPI0000E23780 Cluster: PREDICTED: hypothetical protein
           isoform 2; n=2; Amniota|Rep: PREDICTED: hypothetical
           protein isoform 2 - Pan troglodytes
          Length = 179

 Score = 66.5 bits (155), Expect = 5e-10
 Identities = 31/61 (50%), Positives = 42/61 (68%)
 Frame = -1

Query: 438 LSVALGLRGASVSRTGCSSGGDTQLIVEGMMPNLLHVIPVSDDSVFDGVFEGQETSFALC 259
           L V LG++G    + G   G  TQL+VEG++P+LLHV+PV DD+V  GV +GQ+ S AL 
Sbjct: 57  LVVGLGVQGCLGQQDGVLLGSHTQLVVEGVVPDLLHVVPVGDDAVLHGVLQGQDASLALG 116

Query: 258 L 256
           L
Sbjct: 117 L 117



 Score = 64.5 bits (150), Expect = 2e-09
 Identities = 43/129 (33%), Positives = 58/129 (44%)
 Frame = -3

Query: 460 KHDMGHLSLCGLGVEGSLSEQDWVFLGGRHPAHCRRYDAKSSPCHPS**RFRVRWGI*GS 281
           KHD+GHL + GLGV+G L +QD V LG                  P      +   + G 
Sbjct: 50  KHDLGHLLVVGLGVQGCLGQQDGVLLGSHTQLVVEGVVPDLLHVVPVGDDAVLHGVLQGQ 109

Query: 280 GNLFCSVPHSYIRVLLSHTDHHALMAGPSHDRGEHGARSIISCETGLAHTGAIVYYQRGN 101
                    ++I + L H  HHAL+ G  HD  E     II+C+ GLAH  A+V    G 
Sbjct: 110 DASLALGLIAHIGLHLMHAPHHALVPGAPHDGREDSPGGIITCKAGLAHARAVVNDGHGG 169

Query: 100 FFVAHLELV 74
             + H EL+
Sbjct: 170 III-HGELI 177


>UniRef50_A7QKV4 Cluster: Chromosome chr8 scaffold_115, whole genome
           shotgun sequence; n=1; Vitis vinifera|Rep: Chromosome
           chr8 scaffold_115, whole genome shotgun sequence - Vitis
           vinifera (Grape)
          Length = 431

 Score = 66.1 bits (154), Expect = 6e-10
 Identities = 31/43 (72%), Positives = 33/43 (76%), Gaps = 1/43 (2%)
 Frame = +1

Query: 256 EAQSKRGFLTLKYPIEHGIVTNWDDMEK-IWHHTFYNELGVAP 381
           EAQSK+  LTLKYP + GIV NWDD  K IWHHTFY EL VAP
Sbjct: 29  EAQSKKDMLTLKYPTKSGIVGNWDDKGKTIWHHTFYIELCVAP 71



 Score = 38.3 bits (85), Expect = 0.14
 Identities = 22/39 (56%), Positives = 24/39 (61%)
 Frame = +2

Query: 380 PEEHPVLLTEAPLNPKATERKMTHIMFPKHFTRPAIVPS 496
           PE H VLLTE  LN K    KMT  MF + F+ PAIV S
Sbjct: 71  PEAHLVLLTEVLLNLKVNHDKMTQSMF-ETFSTPAIVSS 108


>UniRef50_UPI0000588EB0 Cluster: PREDICTED: similar to actin; n=1;
           Strongylocentrotus purpuratus|Rep: PREDICTED: similar to
           actin - Strongylocentrotus purpuratus
          Length = 386

 Score = 65.7 bits (153), Expect = 8e-10
 Identities = 46/131 (35%), Positives = 63/131 (48%), Gaps = 5/131 (3%)
 Frame = +2

Query: 110 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQK----DSYVGVRHRAKXX 277
           +V+D+GS   +AGFA +D PR VF SIVGRPRHQ V+  +  K    DSYVG    A+  
Sbjct: 14  MVIDHGSFEIQAGFAEEDCPRTVFQSIVGRPRHQEVLDDLTTKLNFRDSYVG--EEAQNR 71

Query: 278 XXXXXXXXXXXXXLTGMTWRRFGIIPSTMSWVS-PPEEHPVLLTEAPLNPKATERKMTHI 454
                        +         +   T S +   P++   +L++ P NPK  + KM  I
Sbjct: 72  RGVLTLTYPIERGIITKWDDMEAVWSHTFSEIKFNPQDEGAVLSQIPNNPKPNKEKMAEI 131

Query: 455 MFPKHFTRPAI 487
            F K F  P I
Sbjct: 132 FFEK-FQSPGI 141



 Score = 63.7 bits (148), Expect = 3e-09
 Identities = 36/90 (40%), Positives = 50/90 (55%)
 Frame = +1

Query: 256 EAQSKRGFLTLKYPIEHGIVTNWDDMEKIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHR 435
           EAQ++RG LTL YPIE GI+T WDDME +W HTF +E+   P+   +        P+ ++
Sbjct: 67  EAQNRRGVLTLTYPIERGIITKWDDMEAVWSHTF-SEIKFNPQDEGAVLSQIPNNPKPNK 125

Query: 436 EKDDPYHVSKTFYTPRHCSVGIQTVLLAFT 525
           EK       K F +P  C +  Q  L  F+
Sbjct: 126 EKMAEIFFEK-FQSPGIC-LANQAALALFS 153


>UniRef50_Q4CV94 Cluster: Actin 2, putative; n=2; Trypanosoma
           cruzi|Rep: Actin 2, putative - Trypanosoma cruzi
          Length = 392

 Score = 64.5 bits (150), Expect = 2e-09
 Identities = 44/134 (32%), Positives = 60/134 (44%), Gaps = 3/134 (2%)
 Frame = +2

Query: 95  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVG---VRHR 265
           +E  A+V+DNGSG  K GFAG++ PR VFPS+ G   +         +  YVG   ++ +
Sbjct: 7   DEEPAVVLDNGSGNIKCGFAGEEIPRCVFPSVTGVSMNTRSSGSSSSQRVYVGDEALQEK 66

Query: 266 AKXXXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSWVSPPEEHPVLLTEAPLNPKATERKM 445
                                 WR      +      PPE   VLLTEAPLNP +   KM
Sbjct: 67  GLRYFYPMEHGIVSDWDQMERVWRH-----AYEQLRVPPERQAVLLTEAPLNPISNREKM 121

Query: 446 THIMFPKHFTRPAI 487
              +F + F  PA+
Sbjct: 122 AETLF-ESFGVPAL 134



 Score = 48.4 bits (110), Expect = 1e-04
 Identities = 22/54 (40%), Positives = 33/54 (61%)
 Frame = +1

Query: 220 GRYGTEGLLCRSEAQSKRGFLTLKYPIEHGIVTNWDDMEKIWHHTFYNELGVAP 381
           G   ++ +    EA  ++G L   YP+EHGIV++WD ME++W H  Y +L V P
Sbjct: 49  GSSSSQRVYVGDEALQEKG-LRYFYPMEHGIVSDWDQMERVWRHA-YEQLRVPP 100


>UniRef50_A2FRF9 Cluster: Actin family protein; n=1; Trichomonas
           vaginalis G3|Rep: Actin family protein - Trichomonas
           vaginalis G3
          Length = 543

 Score = 64.1 bits (149), Expect = 2e-09
 Identities = 34/86 (39%), Positives = 48/86 (55%)
 Frame = +1

Query: 253 SEAQSKRGFLTLKYPIEHGIVTNWDDMEKIWHHTFYNELGVAPRGTPSPAH*GSPQPQGH 432
           +E  +K   + +  PIE+G++ NWDD+EK+WHHT+YNEL V P   P          Q  
Sbjct: 54  NEVFTKSDLVDISKPIENGVIVNWDDIEKVWHHTYYNELLVVPDQHPVIITEKQCATQHA 113

Query: 433 REKDDPYHVSKTFYTPRHCSVGIQTV 510
           REK       +TF  P + S G+Q+V
Sbjct: 114 REKTIQMFF-ETFNVPGYYS-GVQSV 137



 Score = 48.0 bits (109), Expect = 2e-04
 Identities = 37/138 (26%), Positives = 57/138 (41%)
 Frame = +2

Query: 110 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGVRHRAKXXXXXX 289
           +V+D GSG  K GFAG   P+  FP++VG P+    ++G    D +VG     K      
Sbjct: 6   VVIDTGSGFTKVGFAGYYEPKVEFPTVVGVPKDSTALIGGKNVDFFVGNEVFTKSDLVDI 65

Query: 290 XXXXXXXXXLTGMTWRRFGIIPSTMSWVSPPEEHPVLLTEAPLNPKATERKMTHIMFPKH 469
                    +      +          +  P++HPV++TE     +   R+ T  MF + 
Sbjct: 66  SKPIENGVIVNWDDIEKVWHHTYYNELLVVPDQHPVIITEKQCATQHA-REKTIQMFFET 124

Query: 470 FTRPAIVPSAFKPCFLLL 523
           F  P    S  +  F LL
Sbjct: 125 FNVPGYY-SGVQSVFALL 141


>UniRef50_Q9DFB8 Cluster: Actin; n=1; Scomberomorus maculatus|Rep:
           Actin - Scomberomorus maculatus (Spanish mackerel)
          Length = 101

 Score = 63.7 bits (148), Expect = 3e-09
 Identities = 38/83 (45%), Positives = 47/83 (56%), Gaps = 6/83 (7%)
 Frame = +3

Query: 252 E*GTEQKRFPDPQIPHRTRNRH*LG*HGEDLASYLLQ*AGCRPPRNTQSCSLRLPSTPR- 428
           E G E+KR PDP++ HR R+ H LG HGEDLA +LLQ A C  PR       R PS P+ 
Sbjct: 20  ERGPEKKRHPDPEVSHRARHHHQLGRHGEDLAPHLLQRAAC-GPRRAPHPGDRGPSQPKS 78

Query: 429 PQRER*P-----ISCFQNILHAP 482
            QRE  P     + C +N+   P
Sbjct: 79  QQREDDPDHVRDVQCTRNVRRHP 101


>UniRef50_UPI0000F2D326 Cluster: PREDICTED: similar to actin; n=1;
           Monodelphis domestica|Rep: PREDICTED: similar to actin -
           Monodelphis domestica
          Length = 378

 Score = 62.9 bits (146), Expect = 6e-09
 Identities = 38/130 (29%), Positives = 57/130 (43%)
 Frame = +2

Query: 98  EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGVRHRAKXX 277
           ++ + + DNGSG+CK G +G+  PR +  +++G P+    M    QK  YVG   +    
Sbjct: 8   KIPSAIFDNGSGLCKVGISGEQNPRFIQATVLGYPQSINSMANTWQKAYYVGQEAQDNRS 67

Query: 278 XXXXXXXXXXXXXLTGMTWRRFGIIPSTMSWVSPPEEHPVLLTEAPLNPKATERKMTHIM 457
                         +     +             P++ PVLLTEAPLNP     KM  I 
Sbjct: 68  ILTLNHPMQHGVVTSWDDMEKIWEHLYKDGLRETPKQRPVLLTEAPLNPPENRAKMVEIF 127

Query: 458 FPKHFTRPAI 487
           F + F  PA+
Sbjct: 128 F-ETFQVPAL 136



 Score = 62.1 bits (144), Expect = 1e-08
 Identities = 24/46 (52%), Positives = 32/46 (69%)
 Frame = +1

Query: 256 EAQSKRGFLTLKYPIEHGIVTNWDDMEKIWHHTFYNELGVAPRGTP 393
           EAQ  R  LTL +P++HG+VT+WDDMEKIW H + + L   P+  P
Sbjct: 61  EAQDNRSILTLNHPMQHGVVTSWDDMEKIWEHLYKDGLRETPKQRP 106


>UniRef50_UPI0001554F81 Cluster: PREDICTED: similar to actin; n=1;
           Ornithorhynchus anatinus|Rep: PREDICTED: similar to
           actin - Ornithorhynchus anatinus
          Length = 376

 Score = 62.1 bits (144), Expect = 1e-08
 Identities = 42/127 (33%), Positives = 61/127 (48%), Gaps = 7/127 (5%)
 Frame = +2

Query: 101 VAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGVRHRAKXXX 280
           +  LV+DNG+G+CKAGFAGD+AP+ V P+ VG       M   G ++  +          
Sbjct: 1   MTTLVIDNGTGLCKAGFAGDNAPKLVVPTAVGIQISPDNMTASGLQNRNILTGWETSRSL 60

Query: 281 XXXXXXXXXXXXLT-GMT--W----RRFGIIPSTMSWVSPPEEHPVLLTEAPLNPKATER 439
                       +T G+   W    R +G +   +   + P +HPVLLTE+P N  A   
Sbjct: 61  LEPGPTLALTFPVTRGVVTDWDEMERLWGYVFQKLH--ARPTKHPVLLTESPKNRAADRD 118

Query: 440 KMTHIMF 460
           K+  IMF
Sbjct: 119 KLLQIMF 125



 Score = 39.5 bits (88), Expect = 0.059
 Identities = 12/26 (46%), Positives = 20/26 (76%)
 Frame = +1

Query: 280 LTLKYPIEHGIVTNWDDMEKIWHHTF 357
           L L +P+  G+VT+WD+ME++W + F
Sbjct: 67  LALTFPVTRGVVTDWDEMERLWGYVF 92


>UniRef50_Q5KB93 Cluster: Actin binding protein, putative; n=3;
           Filobasidiella neoformans|Rep: Actin binding protein,
           putative - Cryptococcus neoformans (Filobasidiella
           neoformans)
          Length = 390

 Score = 61.7 bits (143), Expect = 1e-08
 Identities = 41/122 (33%), Positives = 52/122 (42%), Gaps = 2/122 (1%)
 Frame = +2

Query: 110 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRP-RHQGVMVGMGQ-KDSYVGVRHRAKXXXX 283
           LVVDNG+G  K G+AG + P  VFPSIVGRP       +G  Q KD  +G          
Sbjct: 7   LVVDNGTGFVKCGWAGSNFPDYVFPSIVGRPILRAEERLGTSQLKDIMIGDEAAENRSYL 66

Query: 284 XXXXXXXXXXXLTGMTWRRFGIIPSTMSWVSPPEEHPVLLTEAPLNPKATERKMTHIMFP 463
                            R              P    +LLTE P+NPKA  +KM  +MF 
Sbjct: 67  QVTHPMEHGVVKNWEDMRHLWDYTFNEKMHMDPRGKKILLTEPPMNPKANRQKMCEVMFE 126

Query: 464 KH 469
           ++
Sbjct: 127 EY 128



 Score = 55.6 bits (128), Expect = 8e-07
 Identities = 24/76 (31%), Positives = 41/76 (53%)
 Frame = +1

Query: 214 RDGRYGTEGLLCRSEAQSKRGFLTLKYPIEHGIVTNWDDMEKIWHHTFYNELGVAPRGTP 393
           R G    + ++   EA   R +L + +P+EHG+V NW+DM  +W +TF  ++ + PRG  
Sbjct: 44  RLGTSQLKDIMIGDEAAENRSYLQVTHPMEHGVVKNWEDMRHLWDYTFNEKMHMDPRGKK 103

Query: 394 SPAH*GSPQPQGHREK 441
                    P+ +R+K
Sbjct: 104 ILLTEPPMNPKANRQK 119


>UniRef50_UPI00005864C8 Cluster: PREDICTED: similar to Actin; n=4;
           Strongylocentrotus purpuratus|Rep: PREDICTED: similar to
           Actin - Strongylocentrotus purpuratus
          Length = 383

 Score = 61.3 bits (142), Expect = 2e-08
 Identities = 46/151 (30%), Positives = 66/151 (43%)
 Frame = +2

Query: 92  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGVRHRAK 271
           D+    +VVDNGSG  +AGFAG    RA FPS +GR +   V    G++++++G      
Sbjct: 6   DDGPDPVVVDNGSGTIQAGFAGGKTCRATFPSCIGRSKKSHV---DGKREAFIGEAIYKH 62

Query: 272 XXXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSWVSPPEEHPVLLTEAPLNPKATERKMTH 451
                                 +       +  +    EHPVL+TE P NP    +KM  
Sbjct: 63  REVLGINYPIEHGIVKDWEDMEKIWHYLFDVDLMVDTTEHPVLMTEPPGNPMYNRQKMAQ 122

Query: 452 IMFPKHFTRPAIVPSAFKPCFLLLHRFGAVT 544
           IMF + F  PA   +   P  L L+  G V+
Sbjct: 123 IMF-ETFQIPAFYVA--NPALLSLYSSGRVS 150



 Score = 50.8 bits (116), Expect = 2e-05
 Identities = 21/35 (60%), Positives = 26/35 (74%)
 Frame = +1

Query: 271 RGFLTLKYPIEHGIVTNWDDMEKIWHHTFYNELGV 375
           R  L + YPIEHGIV +W+DMEKIWH+ F  +L V
Sbjct: 63  REVLGINYPIEHGIVKDWEDMEKIWHYLFDVDLMV 97


>UniRef50_A0E1S8 Cluster: Chromosome undetermined scaffold_73, whole
           genome shotgun sequence; n=1; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_73,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 383

 Score = 61.3 bits (142), Expect = 2e-08
 Identities = 47/154 (30%), Positives = 64/154 (41%), Gaps = 6/154 (3%)
 Frame = +2

Query: 110 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGVRHRAKXXXXXX 289
           +V+DNGS   KAGF G  AP    P++VGRP+ +        +D Y G    AK      
Sbjct: 11  IVIDNGSYELKAGFQGHYAPSCRIPTVVGRPKLENSDEDF--EDQYFGEEAMAKANALSL 68

Query: 290 XXXXXXXXXLTGMTWRRFGIIPSTMSW----VSPPEEHPVLLTEAPLNPKATERKMTHIM 457
                         W     I   + W    +    EHP+LLTE P+NP A   K   I+
Sbjct: 69  KYPIQRGII---NDWDGIIYINMILIWNQFGIMQESEHPILLTEVPINPNANREKTMQIL 125

Query: 458 FPKHFTRP--AIVPSAFKPCFLLLHRFGAVTQPG 553
           F + F  P  ++V  A  P + +    G V   G
Sbjct: 126 F-ETFQAPLISLVNKAVLPLYAVGKLTGVVVDSG 158


>UniRef50_Q8MVN5 Cluster: Cardiac actin-like protein; n=1; Boltenia
           villosa|Rep: Cardiac actin-like protein - Boltenia
           villosa
          Length = 137

 Score = 60.5 bits (140), Expect = 3e-08
 Identities = 34/80 (42%), Positives = 46/80 (57%), Gaps = 1/80 (1%)
 Frame = +1

Query: 205 PSG-RDGRYGTEGLLCRSEAQSKRGFLTLKYPIEHGIVTNWDDMEKIWHHTFYNELGVAP 381
           PSG R GR     +  R+++  +   L+ K P+E  I+TNWD  EKIWHHT  NEL VAP
Sbjct: 10  PSGVRGGRDRKTVMGYRTQSIGREICLS-KIPLERXIITNWDXQEKIWHHTLNNELEVAP 68

Query: 382 RGTPSPAH*GSPQPQGHREK 441
              P+     +  P+ +REK
Sbjct: 69  EEHPTLFTKAAWNPKANREK 88



 Score = 39.9 bits (89), Expect = 0.045
 Identities = 19/36 (52%), Positives = 23/36 (63%)
 Frame = +2

Query: 380 PEEHPVLLTEAPLNPKATERKMTHIMFPKHFTRPAI 487
           PEEHP L T+A  NPKA   KM   MF + F+ PA+
Sbjct: 68  PEEHPTLFTKAAWNPKANREKMAQXMF-EPFSVPAM 102


>UniRef50_UPI00015B6274 Cluster: PREDICTED: similar to putative mRNA
           splicing factor; n=1; Nasonia vitripennis|Rep:
           PREDICTED: similar to putative mRNA splicing factor -
           Nasonia vitripennis
          Length = 515

 Score = 58.8 bits (136), Expect = 9e-08
 Identities = 36/93 (38%), Positives = 53/93 (56%)
 Frame = -1

Query: 534 PKRCKSKKHGLNADGTMAGRVKCFGNMIWVIFLSVALGLRGASVSRTGCSSGGDTQLIVE 355
           P RC  ++  LN+    + RV+   + +  + LSV L +  +     G    GD QL+VE
Sbjct: 353 PARCIERQDSLNSY-VHSRRVERLEHDLRHL-LSVGLRVERSLGEENGMFLWGDAQLVVE 410

Query: 354 GMMPNLLHVIPVSDDSVFDGVFEGQETSFALCL 256
           G+MP+LLHVIPV D SV D +F  ++T+  L L
Sbjct: 411 GVMPDLLHVIPVGDYSVLDRIFNREDTALGLGL 443



 Score = 48.4 bits (110), Expect = 1e-04
 Identities = 26/66 (39%), Positives = 40/66 (60%), Gaps = 10/66 (15%)
 Frame = -3

Query: 253 SYIRVLLSHTDHHAL----------MAGPSHDRGEHGARSIISCETGLAHTGAIVYYQRG 104
           +Y+ VLL+H DH AL          +AGP+ D  + G+R +++ ET LAH+ +IV ++ G
Sbjct: 445 AYVGVLLAHADHDALWIKSMVDTHLIAGPADDGWKDGSRRVVAGETSLAHSRSIVNHESG 504

Query: 103 NFFVAH 86
              VAH
Sbjct: 505 YVVVAH 510


>UniRef50_Q8TDY3 Cluster: Actin-related protein T2; n=26;
           Amniota|Rep: Actin-related protein T2 - Homo sapiens
           (Human)
          Length = 377

 Score = 58.8 bits (136), Expect = 9e-08
 Identities = 42/129 (32%), Positives = 57/129 (44%), Gaps = 3/129 (2%)
 Frame = +2

Query: 107 ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGVRHRAKXXXXX 286
           A++ DNGSG CKAG +G+  PR +  SIVG  + Q       QK  +VG     K     
Sbjct: 11  AVIFDNGSGFCKAGLSGEFGPRHMVSSIVGHLKFQAPSAEANQKKYFVGEEALYK-QEAL 69

Query: 287 XXXXXXXXXXLTGMTWRRF-GIIPSTMSWV--SPPEEHPVLLTEAPLNPKATERKMTHIM 457
                     +TG  W     +      W     P + P+L TE  LNP+    KM  +M
Sbjct: 70  QLHSPFERGLITG--WDDVERLWKHLFEWELGVKPSDQPLLATEPSLNPRENREKMAEVM 127

Query: 458 FPKHFTRPA 484
           F ++F  PA
Sbjct: 128 F-ENFGVPA 135



 Score = 57.2 bits (132), Expect = 3e-07
 Identities = 28/62 (45%), Positives = 36/62 (58%)
 Frame = +1

Query: 256 EAQSKRGFLTLKYPIEHGIVTNWDDMEKIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHR 435
           EA  K+  L L  P E G++T WDD+E++W H F  ELGV P   P  A   S  P+ +R
Sbjct: 61  EALYKQEALQLHSPFERGLITGWDDVERLWKHLFEWELGVKPSDQPLLATEPSLNPRENR 120

Query: 436 EK 441
           EK
Sbjct: 121 EK 122


>UniRef50_A2DBN6 Cluster: Actin family protein; n=1; Trichomonas
           vaginalis G3|Rep: Actin family protein - Trichomonas
           vaginalis G3
          Length = 373

 Score = 57.2 bits (132), Expect = 3e-07
 Identities = 40/132 (30%), Positives = 62/132 (46%), Gaps = 3/132 (2%)
 Frame = +2

Query: 98  EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRH-QGVMVGMGQKDSYVG--VRHRA 268
           EV+ +V+D G+   +AGF GD  P+ + P+++GR +  Q     +  KD YVG  V  ++
Sbjct: 2   EVSTIVIDTGAYSTRAGFGGDSDPQCILPTVIGRLKSPQDKAAAIATKDIYVGSEVFEQS 61

Query: 269 KXXXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSWVSPPEEHPVLLTEAPLNPKATERKMT 448
           K               +  +      I    ++      EHPVL+TE+P N K    K+T
Sbjct: 62  KNLNLKCPISDRVISNIDEIEVFWQHIFSKELN--INTSEHPVLMTESPQNTKIMREKVT 119

Query: 449 HIMFPKHFTRPA 484
            IM  + F  PA
Sbjct: 120 QIMM-ETFKVPA 130


>UniRef50_Q8LKR2 Cluster: Actin-related protein 4; n=7; core
           eudicotyledons|Rep: Actin-related protein 4 -
           Arabidopsis thaliana (Mouse-ear cress)
          Length = 442

 Score = 56.8 bits (131), Expect = 4e-07
 Identities = 23/34 (67%), Positives = 31/34 (91%)
 Frame = +2

Query: 95  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVG 196
           +EV+A+VVD GS  CKAG+AG+DAP+AVFPS++G
Sbjct: 6   DEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSVIG 39



 Score = 37.9 bits (84), Expect = 0.18
 Identities = 18/48 (37%), Positives = 29/48 (60%), Gaps = 1/48 (2%)
 Frame = +1

Query: 253 SEAQS-KRGFLTLKYPIEHGIVTNWDDMEKIWHHTFYNELGVAPRGTP 393
           S+A S +R  + +  PI+ GIV++WD ++ IW H F + L + P   P
Sbjct: 80  SQAMSYRRDHMEVLSPIKDGIVSDWDLVDNIWEHAFKSCLMIDPTEHP 127



 Score = 35.1 bits (77), Expect = 1.3
 Identities = 14/30 (46%), Positives = 18/30 (60%)
 Frame = +2

Query: 380 PEEHPVLLTEAPLNPKATERKMTHIMFPKH 469
           P EHP+LL E PLN +    K   +MF K+
Sbjct: 123 PTEHPMLLAEPPLNTQQQREKAAELMFEKY 152


>UniRef50_O96019 Cluster: Actin-like protein 6A; n=63;
           Eumetazoa|Rep: Actin-like protein 6A - Homo sapiens
           (Human)
          Length = 429

 Score = 55.6 bits (128), Expect = 8e-07
 Identities = 47/141 (33%), Positives = 64/141 (45%), Gaps = 11/141 (7%)
 Frame = +2

Query: 95  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGR--PRHQG--VMVGMGQKDSYVGVRH 262
           +EV ALV D GS   +AG+AG+D P+  FP+ +G    R  G  +M   G K    G  +
Sbjct: 9   DEVGALVFDIGSYTVRAGYAGEDCPKVDFPTAIGMVVERDDGSTLMEIDGDKGKQGGPTY 68

Query: 263 --RAKXXXXXXXXXXXXXXXLTGMT--WRRF-GIIPST--MSWVSPPEEHPVLLTEAPLN 421
                                 GM   W  F  I+  T  M   S    HPVL++EAP N
Sbjct: 69  YIDTNALRVPRENMEAISPLKNGMVEDWDSFQAILDHTYKMHVKSEASLHPVLMSEAPWN 128

Query: 422 PKATERKMTHIMFPKHFTRPA 484
            +A   K+T +MF +H+  PA
Sbjct: 129 TRAKREKLTELMF-EHYNIPA 148


>UniRef50_Q0J646 Cluster: Os08g0369300 protein; n=2; Oryza sativa
           (japonica cultivar-group)|Rep: Os08g0369300 protein -
           Oryza sativa subsp. japonica (Rice)
          Length = 495

 Score = 54.8 bits (126), Expect = 1e-06
 Identities = 41/127 (32%), Positives = 57/127 (44%), Gaps = 7/127 (5%)
 Frame = +2

Query: 110 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRP--RHQGVMVGMGQKDSYVG-----VRHRA 268
           +V DNG+G  K GFAG++ P +VFP +VGRP  R++  +      D  VG     +RH+ 
Sbjct: 7   VVCDNGTGYVKCGFAGENFPTSVFPCVVGRPLLRYEESLQEQELTDIVVGAACADLRHQL 66

Query: 269 KXXXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSWVSPPEEHPVLLTEAPLNPKATERKMT 448
                           + G  W       S +     P E  +LLT+ PLNP     KM 
Sbjct: 67  DVSYPVTNGIVQSWDDM-GHIWDH--AFYSELK--VDPSECKILLTDPPLNPVKNREKMI 121

Query: 449 HIMFPKH 469
             MF K+
Sbjct: 122 ETMFEKY 128



 Score = 49.2 bits (112), Expect = 7e-05
 Identities = 19/34 (55%), Positives = 24/34 (70%)
 Frame = +1

Query: 280 LTLKYPIEHGIVTNWDDMEKIWHHTFYNELGVAP 381
           L + YP+ +GIV +WDDM  IW H FY+EL V P
Sbjct: 66  LDVSYPVTNGIVQSWDDMGHIWDHAFYSELKVDP 99


>UniRef50_A2YUL5 Cluster: Putative uncharacterized protein; n=1;
           Oryza sativa (indica cultivar-group)|Rep: Putative
           uncharacterized protein - Oryza sativa subsp. indica
           (Rice)
          Length = 367

 Score = 54.8 bits (126), Expect = 1e-06
 Identities = 41/127 (32%), Positives = 57/127 (44%), Gaps = 7/127 (5%)
 Frame = +2

Query: 110 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRP--RHQGVMVGMGQKDSYVG-----VRHRA 268
           +V DNG+G  K GFAG++ P +VFP +VGRP  R++  +      D  VG     +RH+ 
Sbjct: 7   VVCDNGTGYVKCGFAGENFPTSVFPCVVGRPLLRYEESLQEQELTDIVVGAACADLRHQL 66

Query: 269 KXXXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSWVSPPEEHPVLLTEAPLNPKATERKMT 448
                           + G  W       S +     P E  +LLT+ PLNP     KM 
Sbjct: 67  DVSYPVTNGIVQSWDDM-GHIWDH--AFYSELK--VDPSECKILLTDPPLNPVKNREKMI 121

Query: 449 HIMFPKH 469
             MF K+
Sbjct: 122 ETMFEKY 128



 Score = 49.2 bits (112), Expect = 7e-05
 Identities = 19/34 (55%), Positives = 24/34 (70%)
 Frame = +1

Query: 280 LTLKYPIEHGIVTNWDDMEKIWHHTFYNELGVAP 381
           L + YP+ +GIV +WDDM  IW H FY+EL V P
Sbjct: 66  LDVSYPVTNGIVQSWDDMGHIWDHAFYSELKVDP 99


>UniRef50_Q9Y615 Cluster: Actin-like protein 7A; n=11; Mammalia|Rep:
           Actin-like protein 7A - Homo sapiens (Human)
          Length = 435

 Score = 54.8 bits (126), Expect = 1e-06
 Identities = 36/131 (27%), Positives = 55/131 (41%)
 Frame = +2

Query: 95  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGVRHRAKX 274
           E   A+VVD G+G CK GFAG   P     + VG+P  +    G  +K+++VG       
Sbjct: 67  EVTKAVVVDLGTGYCKCGFAGLPRPTHKISTTVGKPYMETAKTGDNRKETFVGQELNNTN 126

Query: 275 XXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSWVSPPEEHPVLLTEAPLNPKATERKMTHI 454
                         +   T +              PEEH VL+++ PL+P     K   +
Sbjct: 127 VHLKLVNPLRHGIIVDWDTVQDIWEYLFRQEMKIAPEEHAVLVSDPPLSPHTNREKYAEM 186

Query: 455 MFPKHFTRPAI 487
           +F + F  PA+
Sbjct: 187 LF-EAFNTPAM 196



 Score = 40.7 bits (91), Expect = 0.026
 Identities = 14/34 (41%), Positives = 22/34 (64%)
 Frame = +1

Query: 280 LTLKYPIEHGIVTNWDDMEKIWHHTFYNELGVAP 381
           L L  P+ HGI+ +WD ++ IW + F  E+ +AP
Sbjct: 129 LKLVNPLRHGIIVDWDTVQDIWEYLFRQEMKIAP 162


>UniRef50_Q6FRF2 Cluster: Similar to sp|P38696 Saccharomyces
           cerevisiae YHR129c ACT5; n=1; Candida glabrata|Rep:
           Similar to sp|P38696 Saccharomyces cerevisiae YHR129c
           ACT5 - Candida glabrata (Yeast) (Torulopsis glabrata)
          Length = 387

 Score = 54.4 bits (125), Expect = 2e-06
 Identities = 37/130 (28%), Positives = 60/130 (46%), Gaps = 4/130 (3%)
 Frame = +2

Query: 110 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGVRHRAKXXXXXX 289
           +++DNGS + KAGFAG   P  +  + +G P  +  MV +  K++Y+G    +       
Sbjct: 13  VILDNGSSVIKAGFAGSQQPDVLEYAWIGNPLAERSMVTVSNKETYIG---NSAYERRAT 69

Query: 290 XXXXXXXXXLTGMTWRR----FGIIPSTMSWVSPPEEHPVLLTEAPLNPKATERKMTHIM 457
                       M+W R    +  +      +   +EHPV+LT +    K  E KM  ++
Sbjct: 70  LHLESPYSTNAIMSWDRLEDLWDYVLLNKLEIEQLQEHPVVLTNSMSTSKKEEEKMCEVL 129

Query: 458 FPKHFTRPAI 487
           F K F+ PAI
Sbjct: 130 FEK-FSIPAI 138


>UniRef50_Q4QG59 Cluster: Actin-like protein, putative; n=3;
           Leishmania|Rep: Actin-like protein, putative -
           Leishmania major
          Length = 483

 Score = 54.0 bits (124), Expect = 3e-06
 Identities = 20/42 (47%), Positives = 30/42 (71%)
 Frame = +1

Query: 256 EAQSKRGFLTLKYPIEHGIVTNWDDMEKIWHHTFYNELGVAP 381
           EA  K+G L + +PI +G + +W D+EK+W H F+NEL V+P
Sbjct: 59  EALLKQGILDVHHPIRNGFINDWGDVEKLWSHLFFNELRVSP 100



 Score = 48.4 bits (110), Expect = 1e-04
 Identities = 21/50 (42%), Positives = 31/50 (62%)
 Frame = +2

Query: 104 AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVG 253
           AA+V+D GS   +AGF G+  PR   P++VG PRH+ + +  G  +  VG
Sbjct: 8   AAVVLDCGSFHSRAGFGGEKGPRLDVPTLVGYPRHRSIAMAAGMNEQEVG 57


>UniRef50_O96819 Cluster: Actin-related protein; n=5;
           Trypanosoma|Rep: Actin-related protein - Trypanosoma
           brucei
          Length = 433

 Score = 53.6 bits (123), Expect = 3e-06
 Identities = 22/41 (53%), Positives = 29/41 (70%)
 Frame = +1

Query: 259 AQSKRGFLTLKYPIEHGIVTNWDDMEKIWHHTFYNELGVAP 381
           A +KRG LT+  PIE G V +W++MEK+W H  Y+EL V P
Sbjct: 61  ALAKRGMLTVSSPIESGRVVSWENMEKLWGHVMYSELRVRP 101



 Score = 51.2 bits (117), Expect = 2e-05
 Identities = 24/57 (42%), Positives = 35/57 (61%), Gaps = 1/57 (1%)
 Frame = +2

Query: 86  MCDEEVAALVV-DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVG 253
           +C  E A +V+ D GS   +AG+A D APR   P++VG PR++GV V  G  +  +G
Sbjct: 2   VCSTERAPVVILDGGSHHLRAGYASDGAPRLDIPALVGHPRNRGVAVAAGMNEYEIG 58


>UniRef50_Q4N681 Cluster: Actin, putative; n=3; Piroplasmida|Rep:
           Actin, putative - Theileria parva
          Length = 380

 Score = 53.2 bits (122), Expect = 4e-06
 Identities = 42/140 (30%), Positives = 61/140 (43%), Gaps = 9/140 (6%)
 Frame = +2

Query: 95  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQ---------GVMVGMGQKDSY 247
           +E  AL++D GS + KAGFAG + P+  FP++V    +Q         GV+  + + +S 
Sbjct: 3   DETLALIIDTGSAVTKAGFAGSETPKVRFPTLVAIDGNQESDDPLVGNGVLEKLDKLNSN 62

Query: 248 VGVRHRAKXXXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSWVSPPEEHPVLLTEAPLNPK 427
                 +                L    WR       T       EEHPVLLTE PL PK
Sbjct: 63  KSQELASFEVYRPVQHGIVRNWALAESVWRH----TFTNELKISQEEHPVLLTEPPLTPK 118

Query: 428 ATERKMTHIMFPKHFTRPAI 487
              R++   +F + F  PA+
Sbjct: 119 -LHRELCCQLFFESFGVPAL 137



 Score = 44.8 bits (101), Expect = 0.002
 Identities = 20/48 (41%), Positives = 26/48 (54%)
 Frame = +1

Query: 295 PIEHGIVTNWDDMEKIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHRE 438
           P++HGIV NW   E +W HTF NEL ++    P         P+ HRE
Sbjct: 75  PVQHGIVRNWALAESVWRHTFTNELKISQEEHPVLLTEPPLTPKLHRE 122


>UniRef50_Q9BYD9 Cluster: Actin-related protein M1; n=12;
           Theria|Rep: Actin-related protein M1 - Homo sapiens
           (Human)
          Length = 372

 Score = 52.4 bits (120), Expect = 8e-06
 Identities = 42/132 (31%), Positives = 63/132 (47%), Gaps = 3/132 (2%)
 Frame = +2

Query: 110 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGVRHRAKXXXXXX 289
           +V+DNGSGM KAG AG   P+ ++P+I+GR + Q      G  +  VG   +A+      
Sbjct: 8   VVIDNGSGMIKAGVAGCREPQFIYPNIIGRAKGQS-RAAQGGLELCVG--DQAQDWRSSL 64

Query: 290 XXXXXXXXXLTGMTWRRFGIIPSTM---SWVSPPEEHPVLLTEAPLNPKATERKMTHIMF 460
                    L   +W    I+   +   +    P + PVL+TE  LNP A  +++T  MF
Sbjct: 65  FISYPVERGLI-TSWEDMEIMWKHIYDYNLKLKPCDGPVLITEPALNPLANRQQITE-MF 122

Query: 461 PKHFTRPAIVPS 496
            +H   PA   S
Sbjct: 123 FEHLGVPAFYMS 134



 Score = 50.4 bits (115), Expect = 3e-05
 Identities = 24/67 (35%), Positives = 36/67 (53%)
 Frame = +1

Query: 193 GKAPPSGRDGRYGTEGLLCRSEAQSKRGFLTLKYPIEHGIVTNWDDMEKIWHHTFYNELG 372
           G+A    R  + G E L    +AQ  R  L + YP+E G++T+W+DME +W H +   L 
Sbjct: 36  GRAKGQSRAAQGGLE-LCVGDQAQDWRSSLFISYPVERGLITSWEDMEIMWKHIYDYNLK 94

Query: 373 VAPRGTP 393
           + P   P
Sbjct: 95  LKPCDGP 101


>UniRef50_UPI0000D9A391 Cluster: PREDICTED: actin related protein M1
           isoform 1; n=1; Macaca mulatta|Rep: PREDICTED: actin
           related protein M1 isoform 1 - Macaca mulatta
          Length = 319

 Score = 52.0 bits (119), Expect = 1e-05
 Identities = 25/67 (37%), Positives = 36/67 (53%)
 Frame = +1

Query: 193 GKAPPSGRDGRYGTEGLLCRSEAQSKRGFLTLKYPIEHGIVTNWDDMEKIWHHTFYNELG 372
           G+A    R    G E L    +AQ  R  L++ YP+E G++T+WDDME +W H +   L 
Sbjct: 99  GRAKGQSRAAPGGLE-LCVGDQAQDWRSSLSISYPVERGLITSWDDMEIMWKHIYDYNLK 157

Query: 373 VAPRGTP 393
           + P   P
Sbjct: 158 LKPCDGP 164



 Score = 49.6 bits (113), Expect = 6e-05
 Identities = 39/132 (29%), Positives = 62/132 (46%), Gaps = 3/132 (2%)
 Frame = +2

Query: 110 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGVRHRAKXXXXXX 289
           +V+DNGSG+ KAG AG   P+ ++P+I+GR + Q      G  +  VG   +A+      
Sbjct: 71  VVIDNGSGVIKAGLAGSREPQFIYPNIIGRAKGQS-RAAPGGLELCVG--DQAQDWRSSL 127

Query: 290 XXXXXXXXXLTGMTWRRFGIIPSTM---SWVSPPEEHPVLLTEAPLNPKATERKMTHIMF 460
                    L   +W    I+   +   +    P + PVL+TE  LNP A  +++  + F
Sbjct: 128 SISYPVERGLI-TSWDDMEIMWKHIYDYNLKLKPCDGPVLITEPALNPLANRQQIVEVFF 186

Query: 461 PKHFTRPAIVPS 496
            +H   PA   S
Sbjct: 187 -EHLGVPAFYMS 197


>UniRef50_A4RW28 Cluster: Predicted protein; n=2; Ostreococcus|Rep:
           Predicted protein - Ostreococcus lucimarinus CCE9901
          Length = 425

 Score = 52.0 bits (119), Expect = 1e-05
 Identities = 42/132 (31%), Positives = 54/132 (40%), Gaps = 7/132 (5%)
 Frame = +2

Query: 95  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGVRHRA-- 268
           +EV+A+V+D G+   KAG+AG D P+ VFPS VG    +G    M  +      RH    
Sbjct: 5   DEVSAVVIDLGTHSVKAGYAGQDTPQHVFPSAVGECA-KGGDADMTAEGENASARHFEVD 63

Query: 269 KXXXXXXXXXXXXXXXLTGM--TWRRFGII---PSTMSWVSPPEEHPVLLTEAPLNPKAT 433
                             GM   W     I             +EHPVLL+E   N  A 
Sbjct: 64  NMGIRRDGMEVTSPYGENGMLEDWEAVEAIWEHALKKRLALQTDEHPVLLSEPVHNSDAV 123

Query: 434 ERKMTHIMFPKH 469
             KM  +MF KH
Sbjct: 124 RAKMVELMFEKH 135


>UniRef50_A3BPG0 Cluster: Putative uncharacterized protein; n=3;
           Oryza sativa|Rep: Putative uncharacterized protein -
           Oryza sativa subsp. japonica (Rice)
          Length = 467

 Score = 52.0 bits (119), Expect = 1e-05
 Identities = 21/32 (65%), Positives = 28/32 (87%)
 Frame = +2

Query: 95  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSI 190
           +EV+A+V+D GS  CKAG+AGDD P+AVFPS+
Sbjct: 5   DEVSAIVIDVGSYSCKAGYAGDDTPKAVFPSL 36



 Score = 38.7 bits (86), Expect = 0.10
 Identities = 19/65 (29%), Positives = 30/65 (46%)
 Frame = +1

Query: 199 APPSGRDGRYGTEGLLCRSEAQSKRGFLTLKYPIEHGIVTNWDDMEKIWHHTFYNELGVA 378
           A P   D       L    E + +R  + +  P++ G VT+WD ++ IW+H F   L + 
Sbjct: 90  AKPMDVDKAKTKRKLYVGQELEFRRDHMEVISPMKDGTVTDWDIVDNIWNHAFRQRLLIN 149

Query: 379 PRGTP 393
           P   P
Sbjct: 150 PEEHP 154


>UniRef50_Q24C02 Cluster: Actin family protein; n=3;
           Oligohymenophorea|Rep: Actin family protein -
           Tetrahymena thermophila SB210
          Length = 398

 Score = 52.0 bits (119), Expect = 1e-05
 Identities = 37/128 (28%), Positives = 61/128 (47%), Gaps = 2/128 (1%)
 Frame = +2

Query: 110 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGVRHRAKXXXXXX 289
           +V+DNGSG+ +AG AG+D  +  F S +GRP+++ V+    Q D Y+G     +      
Sbjct: 13  VVIDNGSGIIRAGIAGEDKAKLQFDSYIGRPKYKMVLPTNTQSDYYLGNISDEQRGLLKL 72

Query: 290 XXXXXXXXXLTGMTWRRFGII-PSTMSWVS-PPEEHPVLLTEAPLNPKATERKMTHIMFP 463
                         W    +I     S +    +E+PVLLTE  +NP   + ++    F 
Sbjct: 73  QYPINHGII---QNWNDMDLIWKYCYSELKVSAKEYPVLLTEPAINPINHKFRVAQQFF- 128

Query: 464 KHFTRPAI 487
           ++F  PA+
Sbjct: 129 ENFNAPAL 136



 Score = 50.8 bits (116), Expect = 2e-05
 Identities = 21/45 (46%), Positives = 31/45 (68%)
 Frame = +1

Query: 259 AQSKRGFLTLKYPIEHGIVTNWDDMEKIWHHTFYNELGVAPRGTP 393
           +  +RG L L+YPI HGI+ NW+DM+ IW +  Y+EL V+ +  P
Sbjct: 63  SDEQRGLLKLQYPINHGIIQNWNDMDLIWKYC-YSELKVSAKEYP 106


>UniRef50_Q00UL2 Cluster: Alpha amylase 1; n=3; Ostreococcus|Rep:
           Alpha amylase 1 - Ostreococcus tauri
          Length = 913

 Score = 51.6 bits (118), Expect = 1e-05
 Identities = 25/33 (75%), Positives = 28/33 (84%)
 Frame = -1

Query: 189 IEGNTARGASSPAKPALHIPEPLSTTNAATSSS 91
           ++GNTA GASSPAKPAL IPEPLS T+A TS S
Sbjct: 1   MDGNTAFGASSPAKPALTIPEPLSHTSAETSPS 33


>UniRef50_Q5C3R3 Cluster: SJCHGC08022 protein; n=1; Schistosoma
           japonicum|Rep: SJCHGC08022 protein - Schistosoma
           japonicum (Blood fluke)
          Length = 209

 Score = 50.8 bits (116), Expect = 2e-05
 Identities = 39/142 (27%), Positives = 67/142 (47%), Gaps = 1/142 (0%)
 Frame = +2

Query: 110 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPR-HQGVMVGMGQKDSYVGVRHRAKXXXXX 286
           +V+DNG+  C+AG++  + P   FP++V RPR  +GV+VG   +D    VRH  K     
Sbjct: 39  IVIDNGNFECRAGYSNFEKPHMTFPNVVYRPRMSKGVLVGNDIQD-LESVRHSLKSPFID 97

Query: 287 XXXXXXXXXXLTGMTWRRFGIIPSTMSWVSPPEEHPVLLTEAPLNPKATERKMTHIMFPK 466
                        +  +    I   ++ V  P  +PV++ EA  NP     ++T ++F +
Sbjct: 98  NLVIN------LDVQEQVISHIFDKLN-VQKPLSNPVVINEALCNPGVCRSQLTELLF-E 149

Query: 467 HFTRPAIVPSAFKPCFLLLHRF 532
            F  P ++   +  CF   + F
Sbjct: 150 SFNTPKLM--YYVDCFASYYNF 169


>UniRef50_P61160 Cluster: Actin-related protein 2; n=96;
           Eukaryota|Rep: Actin-related protein 2 - Homo sapiens
           (Human)
          Length = 394

 Score = 50.0 bits (114), Expect = 4e-05
 Identities = 20/46 (43%), Positives = 28/46 (60%)
 Frame = +1

Query: 220 GRYGTEGLLCRSEAQSKRGFLTLKYPIEHGIVTNWDDMEKIWHHTF 357
           G    + L+   EA   R  L + YP+E+GIV NWDDM+ +W +TF
Sbjct: 48  GNIEIKDLMVGDEASELRSMLEVNYPMENGIVRNWDDMKHLWDYTF 93



 Score = 46.0 bits (104), Expect = 7e-04
 Identities = 35/124 (28%), Positives = 54/124 (43%), Gaps = 7/124 (5%)
 Frame = +2

Query: 110 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRP--RHQGVMVGMGQKDSYVG-----VRHRA 268
           +V DNG+G  K G+AG + P  +FP++VGRP  R    +  +  KD  VG     +R   
Sbjct: 9   VVCDNGTGFVKCGYAGSNFPEHIFPALVGRPIIRSTTKVGNIEIKDLMVGDEASELRSML 68

Query: 269 KXXXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSWVSPPEEHPVLLTEAPLNPKATERKMT 448
           +               +  +    FG  P  ++         +LLTE P+NP     K+ 
Sbjct: 69  EVNYPMENGIVRNWDDMKHLWDYTFG--PEKLN--IDTRNCKILLTEPPMNPTKNREKIV 124

Query: 449 HIMF 460
            +MF
Sbjct: 125 EVMF 128


>UniRef50_UPI0000F2DE11 Cluster: PREDICTED: similar to
           testis-specific actin-related protein 3; n=1;
           Monodelphis domestica|Rep: PREDICTED: similar to
           testis-specific actin-related protein 3 - Monodelphis
           domestica
          Length = 939

 Score = 49.6 bits (113), Expect = 6e-05
 Identities = 40/150 (26%), Positives = 68/150 (45%)
 Frame = +2

Query: 95  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGVRHRAKX 274
           + +AA+V+D G+G  K G AG+D  RA+ P+ VG  RH   +   G K  Y  +   A+ 
Sbjct: 106 KNLAAVVIDTGTGYSKCGLAGEDRTRAIVPTRVG--RH---LNSEGDKTPYY-ITEEAEA 159

Query: 275 XXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSWVSPPEEHPVLLTEAPLNPKATERKMTHI 454
                            + W    I  S +     P+E  VL+ ++P++P+    K+  +
Sbjct: 160 ACSTLIRGVVTDWDALEVLWNH--IFYSKL--CVEPQELAVLVADSPVSPRTNREKVVEL 215

Query: 455 MFPKHFTRPAIVPSAFKPCFLLLHRFGAVT 544
           +F ++F  PA+         L L+ +G  T
Sbjct: 216 LF-ENFGVPAM--QTVHQALLSLYAYGRTT 242



 Score = 40.7 bits (91), Expect = 0.026
 Identities = 17/45 (37%), Positives = 27/45 (60%)
 Frame = +1

Query: 307 GIVTNWDDMEKIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHREK 441
           G+VT+WD +E +W+H FY++L V P+            P+ +REK
Sbjct: 167 GVVTDWDALEVLWNHIFYSKLCVEPQELAVLVADSPVSPRTNREK 211


>UniRef50_Q55DY5 Cluster: Putative uncharacterized protein; n=1;
           Dictyostelium discoideum AX4|Rep: Putative
           uncharacterized protein - Dictyostelium discoideum AX4
          Length = 355

 Score = 49.6 bits (113), Expect = 6e-05
 Identities = 24/58 (41%), Positives = 33/58 (56%)
 Frame = +1

Query: 211 GRDGRYGTEGLLCRSEAQSKRGFLTLKYPIEHGIVTNWDDMEKIWHHTFYNELGVAPR 384
           G   + G   L    EA ++     L YPI++GIV NW+DMEK   +TFY +L V P+
Sbjct: 34  GHPNKQGDTKLFYGKEAVARFSTSKLVYPIKNGIVCNWEDMEKFIENTFYYKLRVEPQ 91



 Score = 41.9 bits (94), Expect = 0.011
 Identities = 34/119 (28%), Positives = 46/119 (38%), Gaps = 2/119 (1%)
 Frame = +2

Query: 110 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGVRHRAKXXXXXX 289
           +++D GSG  K GF G+  P     +IVG P  Q      G    + G    A+      
Sbjct: 6   IIIDFGSGWTKCGFEGEVTPSVECLTIVGHPNKQ------GDTKLFYGKEAVARFSTSKL 59

Query: 290 XXXXXXXXXLTGMTWRRFGIIPSTMSWV--SPPEEHPVLLTEAPLNPKATERKMTHIMF 460
                           +F  I +T  +     P+ H VLLTE  +N K    KM  IMF
Sbjct: 60  VYPIKNGIVCNWEDMEKF--IENTFYYKLRVEPQYHSVLLTETTMNTKENRNKMAEIMF 116


>UniRef50_A7S2B1 Cluster: Predicted protein; n=1; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 265

 Score = 49.6 bits (113), Expect = 6e-05
 Identities = 19/40 (47%), Positives = 29/40 (72%)
 Frame = +2

Query: 107 ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVG 226
           A+V+DNG G+ K GFAGD  PR + P++VG P+   +++G
Sbjct: 1   AIVLDNGCGISKIGFAGDRVPRIIQPAVVGNPQRFSMLIG 40



 Score = 33.1 bits (72), Expect = 5.1
 Identities = 12/39 (30%), Positives = 21/39 (53%)
 Frame = +1

Query: 259 AQSKRGFLTLKYPIEHGIVTNWDDMEKIWHHTFYNELGV 375
           A +K G + L YP+    +  W D+  +W +  Y+EL +
Sbjct: 55  AVAKSGVMHLSYPMHADKLETWTDVVDLWEYLLYDELDI 93


>UniRef50_Q54UQ7 Cluster: Actin-like protein 6A; n=1; Dictyostelium
           discoideum AX4|Rep: Actin-like protein 6A -
           Dictyostelium discoideum AX4
          Length = 440

 Score = 49.2 bits (112), Expect = 7e-05
 Identities = 43/147 (29%), Positives = 71/147 (48%), Gaps = 16/147 (10%)
 Frame = +2

Query: 95  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVG---RPRHQGVMVG---MGQKD----- 241
           ++V+A+V+D G+   K G+AG+D+P+AVFP+ +G   +  ++ V  G   MG+KD     
Sbjct: 5   DDVSAIVIDVGTFSTKGGYAGEDSPKAVFPTDIGVVYKNENETVGTGDSEMGEKDDSEPK 64

Query: 242 -SYV----GVRHRAKXXXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSWVSPPEEHPVLLT 406
            +Y     G+ +R                    M  + +         ++P E HP+LL 
Sbjct: 65  RTYYCGTNGITYRRPHMEIINPLSDGLIKNWDAME-QIWNHTFYERLHINPIE-HPILLA 122

Query: 407 EAPLNPKATERKMTHIMFPKHFTRPAI 487
           E   N +A   K+T IMF K+   PA+
Sbjct: 123 EPTYNTRAIREKVTEIMFEKYHA-PAL 148



 Score = 46.0 bits (104), Expect = 7e-04
 Identities = 16/38 (42%), Positives = 25/38 (65%)
 Frame = +1

Query: 268 KRGFLTLKYPIEHGIVTNWDDMEKIWHHTFYNELGVAP 381
           +R  + +  P+  G++ NWD ME+IW+HTFY  L + P
Sbjct: 77  RRPHMEIINPLSDGLIKNWDAMEQIWNHTFYERLHINP 114


>UniRef50_A2EUM6 Cluster: Actin family protein; n=1; Trichomonas
           vaginalis G3|Rep: Actin family protein - Trichomonas
           vaginalis G3
          Length = 360

 Score = 49.2 bits (112), Expect = 7e-05
 Identities = 21/33 (63%), Positives = 26/33 (78%)
 Frame = +2

Query: 110 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRH 208
           LV+D GSG  KAGFAG+D+P  VFP++VG  RH
Sbjct: 8   LVLDFGSGFVKAGFAGNDSPSLVFPTVVGNLRH 40


>UniRef50_Q55DS6 Cluster: Putative uncharacterized protein; n=1;
           Dictyostelium discoideum AX4|Rep: Putative
           uncharacterized protein - Dictyostelium discoideum AX4
          Length = 392

 Score = 48.4 bits (110), Expect = 1e-04
 Identities = 31/136 (22%), Positives = 63/136 (46%), Gaps = 3/136 (2%)
 Frame = +2

Query: 92  DEEVA-ALVVDNGSGMCKAGFAGDD-APRAVFPSIVGRPRHQGVMVGM-GQKDSYVGVRH 262
           +EE+  ++++D GSG  K GF+ ++  PR  FP+I+GR ++  V+ G   +K  + G   
Sbjct: 8   NEEIRNSVIIDCGSGFTKVGFSNEELTPRNEFPTIIGRTKYYEVLYGAPNKKVIFAGHEV 67

Query: 263 RAKXXXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSWVSPPEEHPVLLTEAPLNPKATERK 442
             +               +      +              +E+P+L+T++P N K    +
Sbjct: 68  ETQKTNISIKHPIERGSIINWDDMEKLLNYSFHQVLNISCDEYPILITDSPFNSKMNRER 127

Query: 443 MTHIMFPKHFTRPAIV 490
           +T ++F  + ++ A V
Sbjct: 128 LTQLLFETYNSKLASV 143



 Score = 45.2 bits (102), Expect = 0.001
 Identities = 15/41 (36%), Positives = 31/41 (75%)
 Frame = +1

Query: 256 EAQSKRGFLTLKYPIEHGIVTNWDDMEKIWHHTFYNELGVA 378
           E ++++  +++K+PIE G + NWDDMEK+ +++F+  L ++
Sbjct: 66  EVETQKTNISIKHPIERGSIINWDDMEKLLNYSFHQVLNIS 106


>UniRef50_Q5C683 Cluster: SJCHGC08418 protein; n=1; Schistosoma
           japonicum|Rep: SJCHGC08418 protein - Schistosoma
           japonicum (Blood fluke)
          Length = 106

 Score = 48.0 bits (109), Expect = 2e-04
 Identities = 32/105 (30%), Positives = 49/105 (46%), Gaps = 2/105 (1%)
 Frame = +2

Query: 110 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGVRHRA--KXXXX 283
           +VVDNG+G  KAG+AGD  PR + P ++GRP+           D +VG    A       
Sbjct: 9   IVVDNGAGHLKAGYAGDGGPRILVPMLIGRPKKCSKYT-----DWFVGEHANAIRNELIL 63

Query: 284 XXXXXXXXXXXLTGMTWRRFGIIPSTMSWVSPPEEHPVLLTEAPL 418
                      + G++   + +    +   + PE HPVL++E PL
Sbjct: 64  NCPIANGIVTDIDGLSLVWYYMFMKELR--TSPENHPVLISEYPL 106



 Score = 37.9 bits (84), Expect = 0.18
 Identities = 17/45 (37%), Positives = 25/45 (55%)
 Frame = +1

Query: 259 AQSKRGFLTLKYPIEHGIVTNWDDMEKIWHHTFYNELGVAPRGTP 393
           A + R  L L  PI +GIVT+ D +  +W++ F  EL  +P   P
Sbjct: 54  ANAIRNELILNCPIANGIVTDIDGLSLVWYYMFMKELRTSPENHP 98


>UniRef50_A2ECQ8 Cluster: Actin family protein; n=1; Trichomonas
           vaginalis G3|Rep: Actin family protein - Trichomonas
           vaginalis G3
          Length = 371

 Score = 48.0 bits (109), Expect = 2e-04
 Identities = 22/58 (37%), Positives = 33/58 (56%)
 Frame = +2

Query: 98  EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGVRHRAK 271
           ++  +V+DNG+   KAGFAG   P  + P++VG  +    MVG+  K  +VG    AK
Sbjct: 3   DMKTIVIDNGTFSVKAGFAGTKKPHFIIPTVVGTAKENADMVGIKNKAYFVGNEALAK 60



 Score = 38.7 bits (86), Expect = 0.10
 Identities = 15/38 (39%), Positives = 23/38 (60%)
 Frame = +1

Query: 253 SEAQSKRGFLTLKYPIEHGIVTNWDDMEKIWHHTFYNE 366
           +EA +K   L L  PIE+G+V NW+   ++W   F N+
Sbjct: 55  NEALAKENLLNLVNPIENGVVQNWEFQTQLWDELFANQ 92


>UniRef50_Q6BG22 Cluster: Actin, putative; n=2; Paramecium
           tetraurelia|Rep: Actin, putative - Paramecium
           tetraurelia
          Length = 370

 Score = 47.6 bits (108), Expect = 2e-04
 Identities = 35/118 (29%), Positives = 50/118 (42%), Gaps = 1/118 (0%)
 Frame = +2

Query: 110 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRH-QGVMVGMGQKDSYVGVRHRAKXXXXX 286
           +V++N S   +AG  G+ APR  FP+ V + +  Q +   +G +   +            
Sbjct: 8   VVIENSSCNIRAGIVGEAAPRCCFPTRVDKVQESQTIKFLIGNQ---IEENQYNNQPCYP 64

Query: 287 XXXXXXXXXXLTGMTWRRFGIIPSTMSWVSPPEEHPVLLTEAPLNPKATERKMTHIMF 460
                          WR    +   +S    P  HPVLLTEAP N K  + KMT IMF
Sbjct: 65  IQNGQIMDWESIEQIWRYIFEVQLKIS----PSNHPVLLTEAPCNSKINQEKMTQIMF 118



 Score = 37.5 bits (83), Expect = 0.24
 Identities = 12/34 (35%), Positives = 23/34 (67%)
 Frame = +1

Query: 292 YPIEHGIVTNWDDMEKIWHHTFYNELGVAPRGTP 393
           YPI++G + +W+ +E+IW + F  +L ++P   P
Sbjct: 63  YPIQNGQIMDWESIEQIWRYIFEVQLKISPSNHP 96


>UniRef50_Q54E71 Cluster: Putative uncharacterized protein; n=1;
           Dictyostelium discoideum AX4|Rep: Putative
           uncharacterized protein - Dictyostelium discoideum AX4
          Length = 684

 Score = 47.6 bits (108), Expect = 2e-04
 Identities = 31/118 (26%), Positives = 53/118 (44%), Gaps = 1/118 (0%)
 Frame = +2

Query: 110 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRH-QGVMVGMGQKDSYVGVRHRAKXXXXX 286
           +++DNGS  C+AGFA D +P+ +F S+VG+ +     +VG   K+  +            
Sbjct: 33  IIIDNGSYQCRAGFANDISPKLIFRSLVGKVKSTSSPIVGNSLKEGDISRLTIKSPFDSN 92

Query: 287 XXXXXXXXXXLTGMTWRRFGIIPSTMSWVSPPEEHPVLLTEAPLNPKATERKMTHIMF 460
                     +    + +FGI            E+PVL+TE   NP    + M+ ++F
Sbjct: 93  LLVHPPSQESIFDYIFHKFGI--------ENEIENPVLITEPTSNPTFCRKYMSELLF 142


>UniRef50_UPI0000EBF019 Cluster: PREDICTED: similar to ribosomal
           protein L10; n=1; Bos taurus|Rep: PREDICTED: similar to
           ribosomal protein L10 - Bos taurus
          Length = 289

 Score = 47.2 bits (107), Expect = 3e-04
 Identities = 25/48 (52%), Positives = 30/48 (62%)
 Frame = +2

Query: 110 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVG 253
           LVVD G   CK GF  D+    V P+    P+HQ  MVG+GQKDSY+G
Sbjct: 4   LVVDCGFDTCKTGFTEDNTLSCV-PTHRLVPQHQDCMVGVGQKDSYMG 50



 Score = 33.9 bits (74), Expect = 2.9
 Identities = 15/36 (41%), Positives = 22/36 (61%)
 Frame = +1

Query: 262 QSKRGFLTLKYPIEHGIVTNWDDMEKIWHHTFYNEL 369
           Q +    T +YP+E GI+T+ DD+ KIW     N+L
Sbjct: 54  QGRLSVQTPEYPMEQGIITHPDDVGKIWITIAINQL 89


>UniRef50_Q9LHH0 Cluster: Actin-like protein; n=11;
           Magnoliophyta|Rep: Actin-like protein - Arabidopsis
           thaliana (Mouse-ear cress)
          Length = 724

 Score = 47.2 bits (107), Expect = 3e-04
 Identities = 39/149 (26%), Positives = 68/149 (45%), Gaps = 10/149 (6%)
 Frame = +2

Query: 110 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGVRHRAKXXXXXX 289
           +V+DNG+   + G+AG+  PR VF +IV RPRH+      G+  + VG    +       
Sbjct: 22  IVIDNGASYFRIGWAGETEPRVVFRNIVQRPRHKAT----GETVTIVGDLDPSMMKYFDC 77

Query: 290 XXXXXXXXXLTGMTWRRFGIIPSTMSWV-------SPPEEHPVLLTEAPLNPKATERKMT 448
                     + + + +F I+   + +            +HP+L+TE   NP  +  KM 
Sbjct: 78  TRSGPRSPFDSNVVY-QFEIMEYILDYAFDRLGANGSGIDHPILITECACNPVQSRSKMA 136

Query: 449 HIMFPKHFTRPAI---VPSAFKPCFLLLH 526
            ++F + +  PA+   V +AF   +  LH
Sbjct: 137 ELLF-ETYGVPAVAFGVDAAFSYKYNQLH 164


>UniRef50_UPI0000E80C06 Cluster: PREDICTED: hypothetical protein;
           n=1; Gallus gallus|Rep: PREDICTED: hypothetical protein
           - Gallus gallus
          Length = 65

 Score = 46.8 bits (106), Expect = 4e-04
 Identities = 25/53 (47%), Positives = 28/53 (52%)
 Frame = +3

Query: 96  KKLPRW**TMAPVCARPVSQEMMLLAPCSPRSWEGPAIRA*WSVWDRRTLM*E 254
           +KL  W  TMA VCAR     MM    CS   W+ P I+  W VW RRT M E
Sbjct: 2   RKLLPWWWTMALVCARQALLGMMPPGLCSLPLWDAPGIKVSWWVWGRRTAMWE 54


>UniRef50_UPI0000449ED3 Cluster: PREDICTED: similar to RIKEN cDNA
           4921517D21 gene; n=2; Gallus gallus|Rep: PREDICTED:
           similar to RIKEN cDNA 4921517D21 gene - Gallus gallus
          Length = 321

 Score = 46.8 bits (106), Expect = 4e-04
 Identities = 20/48 (41%), Positives = 28/48 (58%)
 Frame = +1

Query: 298 IEHGIVTNWDDMEKIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHREK 441
           + HG+VT+WD +E++WH  FY+EL V P      A      P  +REK
Sbjct: 48  LTHGVVTDWDRLEELWHRIFYHELAVCPEELAVLATDAPLSPIINREK 95



 Score = 37.1 bits (82), Expect = 0.32
 Identities = 14/31 (45%), Positives = 23/31 (74%)
 Frame = +2

Query: 95  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPS 187
           +++ A+V+D G G  ++G AGD+ PR+V PS
Sbjct: 10  KDLCAVVIDTGMGHTRSGLAGDERPRSVAPS 40



 Score = 32.3 bits (70), Expect = 9.0
 Identities = 16/37 (43%), Positives = 23/37 (62%)
 Frame = +2

Query: 380 PEEHPVLLTEAPLNPKATERKMTHIMFPKHFTRPAIV 490
           PEE  VL T+APL+P     KM  ++F + F  PA++
Sbjct: 75  PEELAVLATDAPLSPIINREKMAELLF-EGFGVPAVL 110


>UniRef50_Q75JT2 Cluster: Similar to Drosophila melanogaster (Fruit
           fly). RE12057p; n=4; Dictyostelium discoideum|Rep:
           Similar to Drosophila melanogaster (Fruit fly). RE12057p
           - Dictyostelium discoideum (Slime mold)
          Length = 414

 Score = 46.8 bits (106), Expect = 4e-04
 Identities = 35/105 (33%), Positives = 47/105 (44%)
 Frame = +2

Query: 146 GFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGVRHRAKXXXXXXXXXXXXXXXLTG 325
           GF+GD++P A FPS+VG  + +     +GQ DSY+                      LTG
Sbjct: 198 GFSGDESPHA-FPSVVGFSKPK-----IGQVDSYL--------------------LLLTG 231

Query: 326 MTWRRFGIIPSTMSWVSPPEEHPVLLTEAPLNPKATERKMTHIMF 460
             W++F             ++HPV LTE P NPK    KM   MF
Sbjct: 232 KIWKKFWNHAFNDQLCVSSDQHPVFLTEPPFNPKVNTEKMAQYMF 276


>UniRef50_Q5CKL2 Cluster: BRG1/brm-associated factor 53A; n=2;
           Cryptosporidium|Rep: BRG1/brm-associated factor 53A -
           Cryptosporidium hominis
          Length = 423

 Score = 46.8 bits (106), Expect = 4e-04
 Identities = 43/134 (32%), Positives = 59/134 (44%), Gaps = 3/134 (2%)
 Frame = +2

Query: 95  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSY---VGVRHR 265
           ++V A++VD GS M K G+ G+D PR V+PS+VG  +  G         SY   V V   
Sbjct: 11  DDVGAIIVDVGSYMTKIGYGGEDCPRQVWPSVVG-VKESGDKRFPLNFLSYLEDVSVEPC 69

Query: 266 AKXXXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSWVSPPEEHPVLLTEAPLNPKATERKM 445
            K               +   T  + G+  ST        EHP+LLTE   + +    K 
Sbjct: 70  LKYVDGDLILNGDVFEEIIRTTSGKIGL--ST-----DLREHPILLTEPSKHNRQIREKE 122

Query: 446 THIMFPKHFTRPAI 487
             IMF K F  PA+
Sbjct: 123 VEIMFEK-FDVPAV 135


>UniRef50_Q38F20 Cluster: Actin-like protein 3, putative; n=1;
           Trypanosoma brucei|Rep: Actin-like protein 3, putative -
           Trypanosoma brucei
          Length = 416

 Score = 46.8 bits (106), Expect = 4e-04
 Identities = 20/42 (47%), Positives = 25/42 (59%)
 Frame = +1

Query: 256 EAQSKRGFLTLKYPIEHGIVTNWDDMEKIWHHTFYNELGVAP 381
           EA +      L +PI+HGIV +WD ME+IW H  Y  L V P
Sbjct: 57  EALAHSSSCNLYHPIKHGIVEDWDKMERIWQHCVYKYLRVDP 98



 Score = 36.7 bits (81), Expect = 0.42
 Identities = 32/122 (26%), Positives = 43/122 (35%), Gaps = 5/122 (4%)
 Frame = +2

Query: 110 LVVDNGSGMCKAGFAGDDAPRAVFPSI-----VGRPRHQGVMVGMGQKDSYVGVRHRAKX 274
           +V+DNG+G  K G+AG++ P  + P+        R R   V   +   D YVG    A  
Sbjct: 6   VVIDNGTGYTKMGYAGNEEPTYIIPTAYADNEASRRRSHDVFSDL---DFYVGDEALAHS 62

Query: 275 XXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSWVSPPEEHPVLLTEAPLNPKATERKMTHI 454
                                R             PEEH  +LTE P NP         +
Sbjct: 63  SSCNLYHPIKHGIVEDWDKMERIWQHCVYKYLRVDPEEHGFILTEPPANPPENREHTAEV 122

Query: 455 MF 460
           MF
Sbjct: 123 MF 124


>UniRef50_Q9P7X7 Cluster: Actin-related protein 4; n=1;
           Schizosaccharomyces pombe|Rep: Actin-related protein 4 -
           Schizosaccharomyces pombe (Fission yeast)
          Length = 433

 Score = 46.4 bits (105), Expect = 5e-04
 Identities = 34/122 (27%), Positives = 52/122 (42%)
 Frame = +2

Query: 95  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGVRHRAKX 274
           +EV+A+V+D GS   + GF+G+D P+ V PS  G       + G    + Y+   +    
Sbjct: 9   DEVSAIVIDPGSKWTRIGFSGEDIPKCVLPSYCGEFSDGRRLFG----EEYIYKSNPGME 64

Query: 275 XXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSWVSPPEEHPVLLTEAPLNPKATERKMTHI 454
                         +T   W R+G+        + P EHP+L+TE   NP     K    
Sbjct: 65  IKNAIRNGWVENWDVTVDLW-RYGL---EQQLKTNPLEHPILITEPFDNPPENRVKTLET 120

Query: 455 MF 460
           MF
Sbjct: 121 MF 122


>UniRef50_Q17GZ9 Cluster: Actin-related protein 5; n=4;
           Endopterygota|Rep: Actin-related protein 5 - Aedes
           aegypti (Yellowfever mosquito)
          Length = 655

 Score = 46.0 bits (104), Expect = 7e-04
 Identities = 18/34 (52%), Positives = 26/34 (76%)
 Frame = +2

Query: 104 AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPR 205
           AA+V+DNGS  C+AG+AG D P  VF +++ +PR
Sbjct: 28  AAIVIDNGSYHCRAGWAGKDVPSLVFKNVLAKPR 61


>UniRef50_A2FH22 Cluster: Actin family protein; n=1; Trichomonas
           vaginalis G3|Rep: Actin family protein - Trichomonas
           vaginalis G3
          Length = 390

 Score = 44.8 bits (101), Expect = 0.002
 Identities = 24/55 (43%), Positives = 34/55 (61%), Gaps = 1/55 (1%)
 Frame = +2

Query: 383 EEHPVLLTEAPLNPKATERKMTHIMFPK-HFTRPAIVPSAFKPCFLLLHRFGAVT 544
           E+HP+L+TEAPLNPK   +KM  I F + +F R  + P A     L+L+  G +T
Sbjct: 99  EDHPLLITEAPLNPKDNRKKMCEIFFEQFNFPRLQVCPQA----LLVLYAQGLMT 149



 Score = 38.3 bits (85), Expect = 0.14
 Identities = 20/67 (29%), Positives = 32/67 (47%)
 Frame = +1

Query: 241 LLCRSEAQSKRGFLTLKYPIEHGIVTNWDDMEKIWHHTFYNELGVAPRGTPSPAH*GSPQ 420
           ++C  E    R +L L  P+EHGIV NW+D   +  + F  +L +     P         
Sbjct: 53  MVC-DETYPVRQYLDLTLPVEHGIVKNWEDEALVLDYVFKEKLKIRNEDHPLLITEAPLN 111

Query: 421 PQGHREK 441
           P+ +R+K
Sbjct: 112 PKDNRKK 118


>UniRef50_Q383R8 Cluster: Actin-like protein, putative; n=4;
           Trypanosoma|Rep: Actin-like protein, putative -
           Trypanosoma brucei
          Length = 394

 Score = 44.4 bits (100), Expect = 0.002
 Identities = 20/55 (36%), Positives = 33/55 (60%), Gaps = 2/55 (3%)
 Frame = +2

Query: 95  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQ--KDSYVG 253
           ++   +V D GS   + GFAG++APR +  ++VG PR +G++  + Q   D Y G
Sbjct: 3   QQQPVVVFDMGSNKTRVGFAGEEAPRVISSTVVGVPRQRGLVGSLMQHYSDDYAG 57


>UniRef50_Q4SGD5 Cluster: Chromosome 17 SCAF14597, whole genome
           shotgun sequence; n=1; Tetraodon nigroviridis|Rep:
           Chromosome 17 SCAF14597, whole genome shotgun sequence -
           Tetraodon nigroviridis (Green puffer)
          Length = 425

 Score = 43.6 bits (98), Expect = 0.004
 Identities = 17/38 (44%), Positives = 26/38 (68%)
 Frame = +1

Query: 244 LCRSEAQSKRGFLTLKYPIEHGIVTNWDDMEKIWHHTF 357
           + RS A+     + + YP+E+GIV NWDDM+ +W +TF
Sbjct: 40  IIRSTAKVGNIEIKVNYPMENGIVRNWDDMKHLWDYTF 77



 Score = 43.2 bits (97), Expect = 0.005
 Identities = 16/31 (51%), Positives = 23/31 (74%)
 Frame = +2

Query: 110 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRP 202
           +V DNG+G  K G+AG + P  +FP++VGRP
Sbjct: 9   VVCDNGTGFVKCGYAGSNFPEHIFPALVGRP 39


>UniRef50_A4S826 Cluster: Predicted protein; n=1; Ostreococcus
           lucimarinus CCE9901|Rep: Predicted protein -
           Ostreococcus lucimarinus CCE9901
          Length = 346

 Score = 43.6 bits (98), Expect = 0.004
 Identities = 21/27 (77%), Positives = 23/27 (85%), Gaps = 1/27 (3%)
 Frame = +2

Query: 86  MCDE-EVAALVVDNGSGMCKAGFAGDD 163
           M DE E++ALV DNGSGM KAGFAGDD
Sbjct: 1   MADEGELSALVCDNGSGMVKAGFAGDD 27


>UniRef50_Q4QF44 Cluster: Actin-related protein 3, putative; n=3;
           Leishmania|Rep: Actin-related protein 3, putative -
           Leishmania major
          Length = 405

 Score = 43.6 bits (98), Expect = 0.004
 Identities = 25/74 (33%), Positives = 36/74 (48%)
 Frame = +1

Query: 295 PIEHGIVTNWDDMEKIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHREKDDPYHVSKTFY 474
           P+EHG+V NWD ME+ W H F   L V P+         +  P   RE      + ++F 
Sbjct: 68  PLEHGLVVNWDVMEEYWCHLFNRYLCVEPQDVGVLLTEAAVTPYEQREMTAEI-MFESFG 126

Query: 475 TPRHCSVGIQTVLL 516
            PR C +G Q + +
Sbjct: 127 VPRLC-IGSQALFV 139


>UniRef50_Q9Y614 Cluster: Actin-like protein 7B; n=12; Theria|Rep:
           Actin-like protein 7B - Homo sapiens (Human)
          Length = 415

 Score = 43.6 bits (98), Expect = 0.004
 Identities = 35/133 (26%), Positives = 58/133 (43%), Gaps = 3/133 (2%)
 Frame = +2

Query: 98  EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGVRHRAKXX 277
           ++ A+++D GS  CK G+AG+  P     S VG+   +    G  +K + VG  H     
Sbjct: 48  KIKAVIIDLGSQYCKCGYAGEPRPTYFISSTVGKRCPEAADAGDTRKWTLVG--HELLNT 105

Query: 278 XXXXXXXXXXXXXLTGMTWRRFGIIPSTMSWVSP---PEEHPVLLTEAPLNPKATERKMT 448
                        +  + W     I   +   +    PEEH VL+++ PL+P +   K  
Sbjct: 106 EAPLKLVNPLKHGIV-VDWDCVQDIWEYIFRTAMKILPEEHAVLVSDPPLSPSSNREKYA 164

Query: 449 HIMFPKHFTRPAI 487
            +MF + F  PA+
Sbjct: 165 ELMF-ETFGIPAM 176



 Score = 39.9 bits (89), Expect = 0.045
 Identities = 23/83 (27%), Positives = 34/83 (40%)
 Frame = +1

Query: 193 GKAPPSGRDGRYGTEGLLCRSEAQSKRGFLTLKYPIEHGIVTNWDDMEKIWHHTFYNELG 372
           GK  P   D     +  L   E  +    L L  P++HGIV +WD ++ IW + F   + 
Sbjct: 80  GKRCPEAADAGDTRKWTLVGHELLNTEAPLKLVNPLKHGIVVDWDCVQDIWEYIFRTAMK 139

Query: 373 VAPRGTPSPAH*GSPQPQGHREK 441
           + P             P  +REK
Sbjct: 140 ILPEEHAVLVSDPPLSPSSNREK 162


>UniRef50_Q54JL1 Cluster: Putative uncharacterized protein; n=1;
           Dictyostelium discoideum AX4|Rep: Putative
           uncharacterized protein - Dictyostelium discoideum AX4
          Length = 414

 Score = 43.2 bits (97), Expect = 0.005
 Identities = 18/34 (52%), Positives = 24/34 (70%)
 Frame = +1

Query: 280 LTLKYPIEHGIVTNWDDMEKIWHHTFYNELGVAP 381
           L+L  P++ GIV+NW+DMEKI+    Y E  VAP
Sbjct: 64  LSLTCPMKRGIVSNWEDMEKIYSRLLYYEFKVAP 97


>UniRef50_Q22WQ4 Cluster: Actin family protein; n=1; Tetrahymena
           thermophila SB210|Rep: Actin family protein -
           Tetrahymena thermophila SB210
          Length = 444

 Score = 43.2 bits (97), Expect = 0.005
 Identities = 19/37 (51%), Positives = 26/37 (70%)
 Frame = +2

Query: 86  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVG 196
           M  E++ A+VVD GS   +AG++G+D PR V PS VG
Sbjct: 1   MFTEDITAIVVDPGSLSIRAGYSGEDTPRLVMPSQVG 37


>UniRef50_Q5KLG9 Cluster: 53 kDa brg1-associated factor b
           (Actin-related protein baf53b), putative; n=1;
           Filobasidiella neoformans|Rep: 53 kDa brg1-associated
           factor b (Actin-related protein baf53b), putative -
           Cryptococcus neoformans (Filobasidiella neoformans)
          Length = 476

 Score = 42.7 bits (96), Expect = 0.006
 Identities = 19/34 (55%), Positives = 25/34 (73%)
 Frame = +2

Query: 95  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVG 196
           +EV+ALV+D GS   +AG+AG+D PR V PS  G
Sbjct: 6   DEVSALVLDFGSYTTRAGYAGEDCPRVVCPSFYG 39


>UniRef50_UPI000049A548 Cluster: actin; n=1; Entamoeba histolytica
           HM-1:IMSS|Rep: actin - Entamoeba histolytica HM-1:IMSS
          Length = 365

 Score = 42.3 bits (95), Expect = 0.008
 Identities = 15/41 (36%), Positives = 27/41 (65%)
 Frame = +2

Query: 110 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMG 232
           +++DNGSG+ KAG + ++ P+ VFP +VG  +    +  +G
Sbjct: 6   IIIDNGSGLIKAGESSEELPKIVFPCVVGHSKETNKLENIG 46



 Score = 35.5 bits (78), Expect = 0.97
 Identities = 19/54 (35%), Positives = 27/54 (50%)
 Frame = +1

Query: 280 LTLKYPIEHGIVTNWDDMEKIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHREK 441
           L L+ PI+ GI+ +W+D+E IW   F  EL V            +  P  H+EK
Sbjct: 55  LNLQQPIQRGIINDWNDIEDIWDFAF-EELQVESSDQVVMLTQAALTPPIHKEK 107


>UniRef50_UPI00005A3B5D Cluster: PREDICTED: similar to Actin-5C; n=3;
            Laurasiatheria|Rep: PREDICTED: similar to Actin-5C -
            Canis familiaris
          Length = 1248

 Score = 41.9 bits (94), Expect = 0.011
 Identities = 19/51 (37%), Positives = 27/51 (52%), Gaps = 1/51 (1%)
 Frame = +1

Query: 292  YPI-EHGIVTNWDDMEKIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHREK 441
            YP+   G+V++WD +E +W H FY  LGV P             P+ +REK
Sbjct: 952  YPVLNRGVVSDWDALEVLWQHLFYCRLGVRPEELAVLVADSPISPRTNREK 1002



 Score = 40.3 bits (90), Expect = 0.034
 Identities = 35/150 (23%), Positives = 61/150 (40%)
 Frame = +2

Query: 95   EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGVRHRAKX 274
            +++AA+V+D G+G  K G A +D   +V PS V   +H        Q +    V    + 
Sbjct: 897  QDMAAVVIDTGTGFTKCGLAREDHVLSVLPSRVQLLQHP------AQDEPRYAVPENQEG 950

Query: 275  XXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSWVSPPEEHPVLLTEAPLNPKATERKMTHI 454
                             + W+        +     PEE  VL+ ++P++P+    K+  I
Sbjct: 951  SYPVLNRGVVSDWDALEVLWQHLFYCRLGVR----PEELAVLVADSPISPRTNREKVAEI 1006

Query: 455  MFPKHFTRPAIVPSAFKPCFLLLHRFGAVT 544
            +F + F  PA+         L L+ +G  T
Sbjct: 1007 LF-ERFHVPAM--QTVHQALLALYAYGRTT 1033


>UniRef50_Q14BL3 Cluster: RIKEN cDNA 4921517D21 gene; n=7;
            Eutheria|Rep: RIKEN cDNA 4921517D21 gene - Mus musculus
            (Mouse)
          Length = 1207

 Score = 41.9 bits (94), Expect = 0.011
 Identities = 38/150 (25%), Positives = 64/150 (42%)
 Frame = +2

Query: 95   EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGVRHRAKX 274
            +++AA+V+D G+G  K G A ++   +V PS V   +H       GQ   YV   H+   
Sbjct: 856  QKMAAIVIDTGTGFTKCGLAQENHVLSVVPSQVQMLQHPP----QGQPQ-YVVPEHQEGS 910

Query: 275  XXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSWVSPPEEHPVLLTEAPLNPKATERKMTHI 454
                          L  + W+        +     PEE  VL+ ++P++P+    K+  I
Sbjct: 911  YSVLNRGVVSDWDALE-VLWQHLFYCKLKVQ----PEEMAVLVADSPISPRTNREKVAEI 965

Query: 455  MFPKHFTRPAIVPSAFKPCFLLLHRFGAVT 544
            +F + F  PA+         L L+ +G  T
Sbjct: 966  LF-ERFHVPAM--QTVHQALLTLYAYGRTT 992



 Score = 37.5 bits (83), Expect = 0.24
 Identities = 16/48 (33%), Positives = 25/48 (52%)
 Frame = +1

Query: 298  IEHGIVTNWDDMEKIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHREK 441
            +  G+V++WD +E +W H FY +L V P             P+ +REK
Sbjct: 914  LNRGVVSDWDALEVLWQHLFYCKLKVQPEEMAVLVADSPISPRTNREK 961


>UniRef50_UPI0000499930 Cluster: actin; n=1; Entamoeba histolytica
           HM-1:IMSS|Rep: actin - Entamoeba histolytica HM-1:IMSS
          Length = 372

 Score = 41.5 bits (93), Expect = 0.015
 Identities = 35/128 (27%), Positives = 52/128 (40%), Gaps = 2/128 (1%)
 Frame = +2

Query: 110 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVG-VRHRAKXXXXX 286
           +V+D GS  C+ G AG+  P  +FPS VG PR +  +    + D YVG +    K     
Sbjct: 5   IVLDFGSQTCRVGNAGESMPTNIFPSYVGIPREKSQL----KPDFYVGKILKEQKREFQI 60

Query: 287 XXXXXXXXXXLTGMTWRRF-GIIPSTMSWVSPPEEHPVLLTEAPLNPKATERKMTHIMFP 463
                        M    F   +     +       P+L TE  LNPK    K   ++F 
Sbjct: 61  KSPIKNGTIEDISMASALFKNALDECQGY-----GKPILFTEPALNPKQIREKTIQLLF- 114

Query: 464 KHFTRPAI 487
           + F  P++
Sbjct: 115 ERFKVPSV 122


>UniRef50_Q7M3Y5 Cluster: Actin; n=1; Aplysia californica|Rep: Actin
           - Aplysia californica (California sea hare)
          Length = 92

 Score = 41.5 bits (93), Expect = 0.015
 Identities = 19/20 (95%), Positives = 19/20 (95%)
 Frame = +2

Query: 101 VAALVVDNGSGMCKAGFAGD 160
           VAALVVDNGSGM KAGFAGD
Sbjct: 1   VAALVVDNGSGMXKAGFAGD 20


>UniRef50_Q4DMP2 Cluster: Actin-related protein 2, putative; n=4;
           Trypanosoma|Rep: Actin-related protein 2, putative -
           Trypanosoma cruzi
          Length = 403

 Score = 41.5 bits (93), Expect = 0.015
 Identities = 18/35 (51%), Positives = 24/35 (68%)
 Frame = +2

Query: 98  EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRP 202
           E   +V+DNGSG  K G+AG + P AVF + +GRP
Sbjct: 4   EKRPVVLDNGSGFIKCGYAGANFPTAVFQTALGRP 38



 Score = 37.9 bits (84), Expect = 0.18
 Identities = 16/42 (38%), Positives = 23/42 (54%)
 Frame = +1

Query: 256 EAQSKRGFLTLKYPIEHGIVTNWDDMEKIWHHTFYNELGVAP 381
           E    R  L + YPI +GI+ N D+M  +W +TF   L + P
Sbjct: 72  ECSGVRHLLDMTYPIRNGIIQNMDEMCHLWDYTFGEMLQINP 113


>UniRef50_A0CQQ2 Cluster: Chromosome undetermined scaffold_24, whole
           genome shotgun sequence; n=7; Oligohymenophorea|Rep:
           Chromosome undetermined scaffold_24, whole genome
           shotgun sequence - Paramecium tetraurelia
          Length = 869

 Score = 41.5 bits (93), Expect = 0.015
 Identities = 16/33 (48%), Positives = 21/33 (63%)
 Frame = +1

Query: 292 YPIEHGIVTNWDDMEKIWHHTFYNELGVAPRGT 390
           YP++ GIV NWD MEK WH + ++ L   P  T
Sbjct: 80  YPMKSGIVENWDLMEKFWHRSIFDYLRAEPDET 112


>UniRef50_A2YQV6 Cluster: Putative uncharacterized protein; n=1;
           Oryza sativa (indica cultivar-group)|Rep: Putative
           uncharacterized protein - Oryza sativa subsp. indica
           (Rice)
          Length = 581

 Score = 41.1 bits (92), Expect = 0.019
 Identities = 16/36 (44%), Positives = 20/36 (55%)
 Frame = +1

Query: 274 GFLTLKYPIEHGIVTNWDDMEKIWHHTFYNELGVAP 381
           G  T K+PI HG V +WD ME+ W    +N L   P
Sbjct: 383 GLYTRKHPINHGQVDDWDTMERFWQQCIFNYLRCNP 418


>UniRef50_Q8IS27 Cluster: Actin-related protein 2; n=5;
           Oligohymenophorea|Rep: Actin-related protein 2 -
           Tetrahymena thermophila
          Length = 393

 Score = 41.1 bits (92), Expect = 0.019
 Identities = 18/49 (36%), Positives = 27/49 (55%)
 Frame = +1

Query: 241 LLCRSEAQSKRGFLTLKYPIEHGIVTNWDDMEKIWHHTFYNELGVAPRG 387
           ++   EA   +  L L  P+E G V NW DME +W ++F  +LG   +G
Sbjct: 53  IMIGGEAAPYQAMLELTKPVEEGTVKNWQDMELLWDYSF-KKLGAETKG 100



 Score = 38.7 bits (86), Expect = 0.10
 Identities = 14/31 (45%), Positives = 23/31 (74%)
 Frame = +2

Query: 110 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRP 202
           +V D+G+G  K G+AGD+ P+   P+++GRP
Sbjct: 7   IVCDSGTGYIKIGYAGDNFPKYSIPAMIGRP 37


>UniRef50_A6R1X8 Cluster: Putative uncharacterized protein; n=1;
           Ajellomyces capsulatus NAm1|Rep: Putative
           uncharacterized protein - Ajellomyces capsulatus NAm1
          Length = 444

 Score = 41.1 bits (92), Expect = 0.019
 Identities = 15/35 (42%), Positives = 26/35 (74%)
 Frame = +2

Query: 95  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGR 199
           +EV+A+++D G    +AGFAG+D P++V P+  G+
Sbjct: 15  DEVSAIILDPGYSTVRAGFAGEDTPKSVIPTCYGK 49



 Score = 32.3 bits (70), Expect = 9.0
 Identities = 14/39 (35%), Positives = 22/39 (56%), Gaps = 1/39 (2%)
 Frame = +1

Query: 280 LTLKYPI-EHGIVTNWDDMEKIWHHTFYNELGVAPRGTP 393
           L++  P+   GIV +WD  EK+W ++F + L     G P
Sbjct: 72  LSIHNPMGREGIVEDWDAAEKVWEYSFTSRLTGPKSGNP 110


>UniRef50_Q4P2E8 Cluster: Actin-related protein 4; n=1; Ustilago
           maydis|Rep: Actin-related protein 4 - Ustilago maydis
           (Smut fungus)
          Length = 534

 Score = 41.1 bits (92), Expect = 0.019
 Identities = 17/34 (50%), Positives = 23/34 (67%)
 Frame = +2

Query: 95  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVG 196
           +E+ ALV+D G    + G+AG+DAPR V PS  G
Sbjct: 8   DEINALVIDAGHSSSRVGWAGEDAPRVVLPSYYG 41


>UniRef50_A0D9D5 Cluster: Chromosome undetermined scaffold_42, whole
           genome shotgun sequence; n=1; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_42,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 94

 Score = 40.7 bits (91), Expect = 0.026
 Identities = 16/31 (51%), Positives = 23/31 (74%)
 Frame = +2

Query: 110 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRP 202
           ++ D+G+G  K GFAGD+ P   FP++VGRP
Sbjct: 5   IIEDSGTGYLKIGFAGDNFPSHSFPAMVGRP 35


>UniRef50_A5B4L4 Cluster: Putative uncharacterized protein; n=1;
           Vitis vinifera|Rep: Putative uncharacterized protein -
           Vitis vinifera (Grape)
          Length = 571

 Score = 40.3 bits (90), Expect = 0.034
 Identities = 16/32 (50%), Positives = 18/32 (56%)
 Frame = +1

Query: 286 LKYPIEHGIVTNWDDMEKIWHHTFYNELGVAP 381
           L YPI HG V NWD ME+ W    +N L   P
Sbjct: 143 LSYPIVHGQVDNWDAMERFWQQCIFNYLRCDP 174


>UniRef50_Q19R57 Cluster: Actin-like protein 1; n=2; Trypanosoma
           cruzi|Rep: Actin-like protein 1 - Trypanosoma cruzi
           strain CL Brener
          Length = 390

 Score = 40.3 bits (90), Expect = 0.034
 Identities = 18/38 (47%), Positives = 24/38 (63%)
 Frame = +1

Query: 244 LCRSEAQSKRGFLTLKYPIEHGIVTNWDDMEKIWHHTF 357
           L  +EA  +    TL +PI HGIV +W  ME++ HHTF
Sbjct: 55  LVGAEAIHEMHRATLHHPIRHGIVKDWPRMEQVIHHTF 92



 Score = 33.9 bits (74), Expect = 2.9
 Identities = 13/31 (41%), Positives = 20/31 (64%)
 Frame = +2

Query: 110 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRP 202
           ++VD GS + KAG   +  P  +FP++VG P
Sbjct: 2   IIVDFGSSLVKAGTVTESLPSLIFPAVVGVP 32


>UniRef50_Q6X960 Cluster: HSD21; n=13; Theria|Rep: HSD21 - Homo
           sapiens (Human)
          Length = 416

 Score = 40.3 bits (90), Expect = 0.034
 Identities = 21/54 (38%), Positives = 27/54 (50%)
 Frame = +1

Query: 280 LTLKYPIEHGIVTNWDDMEKIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHREK 441
           LTL  P+  GIV +WD  E IW H   ++L VA    P  +      P  +REK
Sbjct: 108 LTLVQPLRSGIVVDWDAAELIWRHLLEHDLRVATHDHPLLSSDPPFSPATNREK 161



 Score = 39.9 bits (89), Expect = 0.045
 Identities = 26/124 (20%), Positives = 49/124 (39%), Gaps = 3/124 (2%)
 Frame = +2

Query: 98  EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGVRHRA--- 268
           +  A+V+D G+G CK GFAG  +P     +I+G    +    G     +++G   R    
Sbjct: 48  KTGAVVIDMGTGTCKVGFAGQASPTYTVATILGCQPKKPATSGQSGLQTFIGEAARVLPE 107

Query: 269 KXXXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSWVSPPEEHPVLLTEAPLNPKATERKMT 448
                              + WR   ++   +   +   +HP+L ++ P +P     K+ 
Sbjct: 108 LTLVQPLRSGIVVDWDAAELIWRH--LLEHDLRVAT--HDHPLLSSDPPFSPATNREKLV 163

Query: 449 HIMF 460
            + F
Sbjct: 164 EVAF 167


>UniRef50_UPI0000E47BC7 Cluster: PREDICTED: similar to ubiquitin/actin
            fusion protein; n=1; Strongylocentrotus purpuratus|Rep:
            PREDICTED: similar to ubiquitin/actin fusion protein -
            Strongylocentrotus purpuratus
          Length = 1608

 Score = 39.9 bits (89), Expect = 0.045
 Identities = 19/48 (39%), Positives = 29/48 (60%)
 Frame = +2

Query: 110  LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVG 253
            +++DNGS M +AG A   AP    P++VGR + + +     +KD YVG
Sbjct: 1236 IILDNGSSMLRAGLADGVAPSVTMPTVVGRLK-KDIESYRNRKDVYVG 1282



 Score = 32.3 bits (70), Expect = 9.0
 Identities = 13/30 (43%), Positives = 18/30 (60%)
 Frame = +1

Query: 286  LKYPIEHGIVTNWDDMEKIWHHTFYNELGV 375
            L+Y    G+V NW ++E IW H   +EL V
Sbjct: 1303 LRYLPIGGVVDNWAELEHIWDHVVSHELNV 1332


>UniRef50_Q19R56 Cluster: Actin-like protein 3; n=4; Trypanosoma
           cruzi|Rep: Actin-like protein 3 - Trypanosoma cruzi
           strain CL Brener
          Length = 426

 Score = 39.9 bits (89), Expect = 0.045
 Identities = 15/34 (44%), Positives = 22/34 (64%)
 Frame = +1

Query: 226 YGTEGLLCRSEAQSKRGFLTLKYPIEHGIVTNWD 327
           +G + +    +A  +RG L L YPI+HGI+ NWD
Sbjct: 44  HGCDVVSVGKDAAERRGLLHLTYPIQHGIIVNWD 77


>UniRef50_Q4WA13 Cluster: Chromatin remodeling complex subunit
           (Arp5), putative; n=14; Pezizomycotina|Rep: Chromatin
           remodeling complex subunit (Arp5), putative -
           Aspergillus fumigatus (Sartorya fumigata)
          Length = 757

 Score = 39.9 bits (89), Expect = 0.045
 Identities = 30/130 (23%), Positives = 57/130 (43%), Gaps = 2/130 (1%)
 Frame = +2

Query: 104 AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMG--QKDSYVGVRHRAKXX 277
           +A+V+DNGS + KAG++ D +PR + P ++ R R + +  G      D+YV    R +  
Sbjct: 59  SAIVIDNGSSLLKAGWSFDVSPRFILPPVMSRYRDRKLNKGCQFIGYDAYVDATTRGQLR 118

Query: 278 XXXXXXXXXXXXXLTGMTWRRFGIIPSTMSWVSPPEEHPVLLTEAPLNPKATERKMTHIM 457
                                +  I   +   +   + P+++TE   N     R M  I+
Sbjct: 119 YAFDPGTSVVGNWDVMEGLLDYVFIKLGVDGANGGVDRPIVMTEPIANLNYPRRMMNEIL 178

Query: 458 FPKHFTRPAI 487
           F + ++ P++
Sbjct: 179 F-ECYSAPSV 187


>UniRef50_Q5CSX9 Cluster: Actin; n=2; Cryptosporidium|Rep: Actin -
           Cryptosporidium parvum Iowa II
          Length = 405

 Score = 39.5 bits (88), Expect = 0.059
 Identities = 31/120 (25%), Positives = 51/120 (42%), Gaps = 3/120 (2%)
 Frame = +2

Query: 110 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGVRHRAKXXXXXX 289
           +V+D GS   KAG   D +P  +FPS+VG+ R + V         +VG    A+      
Sbjct: 22  IVIDCGSAYMKAGTDSDKSPTCIFPSMVGQYRSRYVPEDEDNNPIFVGEEAIAQRKKLSL 81

Query: 290 XXXXXXXXXLTGMTWRRFGIIPSTMSWVS---PPEEHPVLLTEAPLNPKATERKMTHIMF 460
                         W +F  + + + +      P +  V++T+ PL     E K+T +MF
Sbjct: 82  TFPIDHGHI---DDWTKFEELLNYLFYRGLDIDPIDSSVIITKPPLCSNRHEEKITELMF 138



 Score = 38.3 bits (85), Expect = 0.14
 Identities = 15/42 (35%), Positives = 27/42 (64%)
 Frame = +1

Query: 256 EAQSKRGFLTLKYPIEHGIVTNWDDMEKIWHHTFYNELGVAP 381
           EA ++R  L+L +PI+HG + +W   E++ ++ FY  L + P
Sbjct: 71  EAIAQRKKLSLTFPIDHGHIDDWTKFEELLNYLFYRGLDIDP 112


>UniRef50_Q2H0E9 Cluster: Putative uncharacterized protein; n=1;
           Chaetomium globosum|Rep: Putative uncharacterized
           protein - Chaetomium globosum (Soil fungus)
          Length = 656

 Score = 39.5 bits (88), Expect = 0.059
 Identities = 31/131 (23%), Positives = 53/131 (40%), Gaps = 2/131 (1%)
 Frame = +2

Query: 104 AALVVDNGSGMCKAGFAGDDAPRAVFPSIVG--RPRHQGVMVGMGQKDSYVGVRHRAKXX 277
           A +V+DNGS   +AG++ +D PR   P I+   R R  G       +D Y     R    
Sbjct: 54  AVIVIDNGSSTVRAGWSFEDKPRLAIPPIMSKYRDRKAGKTFSFAGQDCYADTTARGHIR 113

Query: 278 XXXXXXXXXXXXXLTGMTWRRFGIIPSTMSWVSPPEEHPVLLTEAPLNPKATERKMTHIM 457
                                   I   M+ V    + P+++TEA  N   + + M+ ++
Sbjct: 114 NAFEAGTGIVSSWDVVEHVLDHVFIKLGMNGVEGGIDMPIVMTEAVANLPYSRKTMSEML 173

Query: 458 FPKHFTRPAIV 490
           F + +  P++V
Sbjct: 174 F-ECYNAPSVV 183


>UniRef50_Q0H7S7 Cluster: Actin; n=29; Sordariomycetes|Rep: Actin -
           Phaeoacremonium sphinctrophorum
          Length = 39

 Score = 39.5 bits (88), Expect = 0.059
 Identities = 16/19 (84%), Positives = 18/19 (94%)
 Frame = +2

Query: 134 MCKAGFAGDDAPRAVFPSI 190
           MCKAGFAGDDAPRAVF ++
Sbjct: 1   MCKAGFAGDDAPRAVFRNL 19


>UniRef50_UPI0000F2D272 Cluster: PREDICTED: similar to actin; n=1;
           Monodelphis domestica|Rep: PREDICTED: similar to actin -
           Monodelphis domestica
          Length = 790

 Score = 39.1 bits (87), Expect = 0.078
 Identities = 17/33 (51%), Positives = 22/33 (66%)
 Frame = +2

Query: 98  EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVG 196
           E + LVVD GS  CKAG+ G+  P  + PS+VG
Sbjct: 423 ERSCLVVDIGSACCKAGWCGEKFPPIIVPSVVG 455



 Score = 35.9 bits (79), Expect = 0.73
 Identities = 15/33 (45%), Positives = 22/33 (66%)
 Frame = +2

Query: 98  EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVG 196
           E +++V+D GS  CKAG A ++ P    PS+VG
Sbjct: 68  ESSSVVIDIGSAWCKAGLAMENYPTLAVPSVVG 100



 Score = 35.1 bits (77), Expect = 1.3
 Identities = 14/35 (40%), Positives = 23/35 (65%)
 Frame = +1

Query: 289 KYPIEHGIVTNWDDMEKIWHHTFYNELGVAPRGTP 393
           ++ I+ G V NWD ME IW+++F + LG+  +  P
Sbjct: 141 QFAIDRGRVLNWDAMEDIWYYSF-DYLGIKTKNHP 174



 Score = 32.3 bits (70), Expect = 9.0
 Identities = 11/26 (42%), Positives = 16/26 (61%)
 Frame = +1

Query: 280 LTLKYPIEHGIVTNWDDMEKIWHHTF 357
           L  ++ I  G +TNW+ ME IW + F
Sbjct: 489 LRTEFVINRGTITNWEAMESIWRYIF 514


>UniRef50_Q8IIQ4 Cluster: Actin, putative; n=7; Apicomplexa|Rep:
           Actin, putative - Plasmodium falciparum (isolate 3D7)
          Length = 392

 Score = 39.1 bits (87), Expect = 0.078
 Identities = 17/33 (51%), Positives = 21/33 (63%)
 Frame = +2

Query: 98  EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVG 196
           E   +V+DNGSG  KAG    + P  VFP+IVG
Sbjct: 2   ENKTIVIDNGSGYIKAGINSSEEPTIVFPTIVG 34



 Score = 34.3 bits (75), Expect = 2.2
 Identities = 13/41 (31%), Positives = 23/41 (56%)
 Frame = +1

Query: 232 TEGLLCRSEAQSKRGFLTLKYPIEHGIVTNWDDMEKIWHHT 354
           T+ +    EA      L +  PI+HG +++WD  +K+W +T
Sbjct: 41  TKRIYTGDEAFFHESNLNIYRPIDHGHISDWDKAQKVWDYT 81


>UniRef50_A2DNQ0 Cluster: Actin family protein; n=1; Trichomonas
           vaginalis G3|Rep: Actin family protein - Trichomonas
           vaginalis G3
          Length = 358

 Score = 39.1 bits (87), Expect = 0.078
 Identities = 14/37 (37%), Positives = 24/37 (64%)
 Frame = +1

Query: 283 TLKYPIEHGIVTNWDDMEKIWHHTFYNELGVAPRGTP 393
           T + PIE+ ++TN+D+M++IW   F  +L + P   P
Sbjct: 56  TFRSPIENRVITNFDNMKRIWQELFTEQLQIQPEQHP 92



 Score = 35.1 bits (77), Expect = 1.3
 Identities = 34/130 (26%), Positives = 53/130 (40%), Gaps = 1/130 (0%)
 Frame = +2

Query: 110 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGVRHRAKXXXXXX 289
           +V+D G  + KAGF GD  P  VFPS  G    + +  G   K      R+ +K      
Sbjct: 6   IVLDCGGSIIKAGFGGDSEPGIVFPS-TGPKLKKDIESGFDDK------RYISK--FGPT 56

Query: 290 XXXXXXXXXLTGM-TWRRFGIIPSTMSWVSPPEEHPVLLTEAPLNPKATERKMTHIMFPK 466
                    +T     +R      T      PE+HP L+ ++ LN     R+ T  +F +
Sbjct: 57  FRSPIENRVITNFDNMKRIWQELFTEQLQIQPEQHPFLVADSALN-SLENRQQTLQIFME 115

Query: 467 HFTRPAIVPS 496
            +  P+  P+
Sbjct: 116 EYNVPSFCPA 125


>UniRef50_P61158 Cluster: Actin-related protein 3; n=107;
           Eukaryota|Rep: Actin-related protein 3 - Homo sapiens
           (Human)
          Length = 418

 Score = 39.1 bits (87), Expect = 0.078
 Identities = 38/135 (28%), Positives = 52/135 (38%), Gaps = 8/135 (5%)
 Frame = +2

Query: 107 ALVVDNGSGMCKAGFAGDDAPRAVFPSI--------VGRPRHQGVMVGMGQKDSYVGVRH 262
           A VVD G+G  K G+AG+  P+ + PS         VG    + VM G+   D ++G   
Sbjct: 7   ACVVDCGTGYTKLGYAGNTEPQFIIPSCIAIKESAKVGDQAQRRVMKGVDDLDFFIGDEA 66

Query: 263 RAKXXXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSWVSPPEEHPVLLTEAPLNPKATERK 442
             K                  +   RF          + PE+H  LLTE PLN       
Sbjct: 67  IEKPTYATKWPIRHGIVEDWDL-MERFMEQVIFKYLRAEPEDHYFLLTEPPLNTPENREY 125

Query: 443 MTHIMFPKHFTRPAI 487
              IMF + F  P +
Sbjct: 126 TAEIMF-ESFNVPGL 139



 Score = 34.7 bits (76), Expect = 1.7
 Identities = 17/42 (40%), Positives = 22/42 (52%)
 Frame = +1

Query: 256 EAQSKRGFLTLKYPIEHGIVTNWDDMEKIWHHTFYNELGVAP 381
           EA  K  + T K+PI HGIV +WD ME+      +  L   P
Sbjct: 65  EAIEKPTYAT-KWPIRHGIVEDWDLMERFMEQVIFKYLRAEP 105


>UniRef50_Q9NZ32 Cluster: Actin-related protein 10; n=40;
           Eumetazoa|Rep: Actin-related protein 10 - Homo sapiens
           (Human)
          Length = 417

 Score = 38.7 bits (86), Expect = 0.10
 Identities = 15/34 (44%), Positives = 21/34 (61%)
 Frame = +2

Query: 98  EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGR 199
           E  A+V+D G    K GFAG+  PR + PS++ R
Sbjct: 12  EKTAVVIDLGEAFTKCGFAGETGPRCIIPSVIKR 45


>UniRef50_Q18PR4 Cluster: Actin-related protein; n=1; Porphyra
           yezoensis|Rep: Actin-related protein - Porphyra
           yezoensis
          Length = 573

 Score = 38.3 bits (85), Expect = 0.14
 Identities = 16/35 (45%), Positives = 23/35 (65%)
 Frame = +2

Query: 92  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVG 196
           D  V ++V D GS  CK GFAG+D P +++ S +G
Sbjct: 5   DGTVPSVVFDFGSHTCKVGFAGEDLPHSLYSSNIG 39


>UniRef50_Q6C0A9 Cluster: Yarrowia lipolytica chromosome F of strain
           CLIB122 of Yarrowia lipolytica; n=1; Yarrowia
           lipolytica|Rep: Yarrowia lipolytica chromosome F of
           strain CLIB122 of Yarrowia lipolytica - Yarrowia
           lipolytica (Candida lipolytica)
          Length = 427

 Score = 38.3 bits (85), Expect = 0.14
 Identities = 14/35 (40%), Positives = 24/35 (68%)
 Frame = +2

Query: 95  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGR 199
           +EV ++V++ GS   + GF+GDD P+ V P+  G+
Sbjct: 18  DEVTSIVIECGSSYTRVGFSGDDLPKVVIPTKYGK 52


>UniRef50_P80428 Cluster: Actin-related protein 4; n=4;
           Saccharomycetales|Rep: Actin-related protein 4 -
           Saccharomyces cerevisiae (Baker's yeast)
          Length = 489

 Score = 38.3 bits (85), Expect = 0.14
 Identities = 14/35 (40%), Positives = 25/35 (71%)
 Frame = +2

Query: 95  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGR 199
           +EV+A+V+D GS     G++G D P+++ PS+ G+
Sbjct: 12  DEVSAVVIDPGSYTTNIGYSGSDFPQSILPSVYGK 46


>UniRef50_Q9N4N4 Cluster: Putative uncharacterized protein; n=2;
           Caenorhabditis|Rep: Putative uncharacterized protein -
           Caenorhabditis elegans
          Length = 436

 Score = 37.9 bits (84), Expect = 0.18
 Identities = 19/37 (51%), Positives = 23/37 (62%)
 Frame = +2

Query: 374 SPPEEHPVLLTEAPLNPKATERKMTHIMFPKHFTRPA 484
           S P EHPVL +E+  N +A   K+T IMF K F  PA
Sbjct: 119 SNPSEHPVLFSESSWNDRARREKLTEIMFEK-FQVPA 154



 Score = 33.5 bits (73), Expect = 3.9
 Identities = 14/33 (42%), Positives = 21/33 (63%)
 Frame = +2

Query: 95  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIV 193
           +EV+ LV D GS   + GFAG++ P+   PS +
Sbjct: 9   DEVSGLVFDAGSQSFRVGFAGEEYPKGDIPSYI 41


>UniRef50_Q6BIA3 Cluster: CA5059|IPF3691 Candida albicans IPF3691;
           n=5; Saccharomycetales|Rep: CA5059|IPF3691 Candida
           albicans IPF3691 - Debaryomyces hansenii (Yeast)
           (Torulaspora hansenii)
          Length = 450

 Score = 37.9 bits (84), Expect = 0.18
 Identities = 22/45 (48%), Positives = 25/45 (55%)
 Frame = +2

Query: 107 ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKD 241
           A+V+DNGS   KAGFA DD P  VF S      +  V VG  Q D
Sbjct: 7   AVVIDNGSHTTKAGFALDDLPSLVFNSNYVVDSNSKVQVGDKQVD 51


>UniRef50_A6RD01 Cluster: Putative uncharacterized protein; n=1;
           Ajellomyces capsulatus NAm1|Rep: Putative
           uncharacterized protein - Ajellomyces capsulatus NAm1
          Length = 762

 Score = 37.9 bits (84), Expect = 0.18
 Identities = 31/130 (23%), Positives = 55/130 (42%), Gaps = 2/130 (1%)
 Frame = +2

Query: 104 AALVVDNGSGMCKAGFAGDDAPRAVFPSIVG--RPRHQGVMVGMGQKDSYVGVRHRAKXX 277
           +A+V+DNGS + KAG++ D +PR + P ++   R R           D+YV    R +  
Sbjct: 111 SAIVIDNGSYLVKAGWSFDKSPRFIIPPVMAKYRDRKFNRTCHFVGYDAYVDATTRGQVR 170

Query: 278 XXXXXXXXXXXXXLTGMTWRRFGIIPSTMSWVSPPEEHPVLLTEAPLNPKATERKMTHIM 457
                                +  +   +   +   + P++LTE   N   T R M  I+
Sbjct: 171 NAFDPGSSVIGNWDVMEGVLDYIFLKLGVDGANGSVDRPIVLTEPIANLGYTRRMMNEIL 230

Query: 458 FPKHFTRPAI 487
           F + ++ PA+
Sbjct: 231 F-ECYSAPAV 239


>UniRef50_A3FQE6 Cluster: Putative uncharacterized protein; n=2;
           Cryptosporidium|Rep: Putative uncharacterized protein -
           Cryptosporidium parvum Iowa II
          Length = 396

 Score = 37.5 bits (83), Expect = 0.24
 Identities = 13/36 (36%), Positives = 25/36 (69%)
 Frame = +2

Query: 104 AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQ 211
           +++++D G+   +AG+ GDD PR+V P+ +G P  +
Sbjct: 15  SSIILDIGTQSIRAGYGGDDLPRSVVPTCIGIPNKE 50


>UniRef50_Q7SHR0 Cluster: Actin-related protein 4; n=16;
           Pezizomycotina|Rep: Actin-related protein 4 - Neurospora
           crassa
          Length = 469

 Score = 37.5 bits (83), Expect = 0.24
 Identities = 16/34 (47%), Positives = 24/34 (70%)
 Frame = +2

Query: 95  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVG 196
           +EV+ALV+D G    +AG+AG++ P+ V PS  G
Sbjct: 20  DEVSALVLDPGYCNTRAGYAGEEMPKQVLPSFYG 53


>UniRef50_Q9Y7X8 Cluster: Actin-like protein Arp5; n=1;
           Schizosaccharomyces pombe|Rep: Actin-like protein Arp5 -
           Schizosaccharomyces pombe (Fission yeast)
          Length = 721

 Score = 37.1 bits (82), Expect = 0.32
 Identities = 27/117 (23%), Positives = 48/117 (41%)
 Frame = +2

Query: 110 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGVRHRAKXXXXXX 289
           LV+DNGS   +AG+ G+  P+ VF ++V R R +     + +  + VG     +      
Sbjct: 27  LVIDNGSWQLRAGWGGEKDPKLVFDNLVSRYRDR----KLSRTSTLVGNDTLIEVGSRSI 82

Query: 290 XXXXXXXXXLTGMTWRRFGIIPSTMSWVSPPEEHPVLLTEAPLNPKATERKMTHIMF 460
                    ++        +  + +       EHP+ +TE   NP      MT ++F
Sbjct: 83  ARSPFERNVISNWDLMEQVLDYTFLKLGIDRMEHPICMTEPLANPTYVRSTMTELLF 139


>UniRef50_A7TST0 Cluster: Putative uncharacterized protein; n=1;
           Vanderwaltozyma polyspora DSM 70294|Rep: Putative
           uncharacterized protein - Vanderwaltozyma polyspora DSM
           70294
          Length = 501

 Score = 37.1 bits (82), Expect = 0.32
 Identities = 14/34 (41%), Positives = 23/34 (67%)
 Frame = +2

Query: 95  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVG 196
           +E++A+V+D GS     G++G D P+A+ PS  G
Sbjct: 12  DEISAVVIDPGSFTTNIGYSGTDCPQAILPSYYG 45


>UniRef50_Q6C061 Cluster: Actin-related protein 4; n=1; Yarrowia
           lipolytica|Rep: Actin-related protein 4 - Yarrowia
           lipolytica (Candida lipolytica)
          Length = 432

 Score = 37.1 bits (82), Expect = 0.32
 Identities = 15/34 (44%), Positives = 22/34 (64%)
 Frame = +2

Query: 95  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVG 196
           +EVA LV+D GS   + G+AG+D P+ V  +  G
Sbjct: 14  DEVATLVIDTGSSYTRVGYAGEDTPKLVVSTECG 47


>UniRef50_Q9H568 Cluster: Actin-like protein 8; n=10; Eutheria|Rep:
           Actin-like protein 8 - Homo sapiens (Human)
          Length = 366

 Score = 37.1 bits (82), Expect = 0.32
 Identities = 30/118 (25%), Positives = 51/118 (43%), Gaps = 1/118 (0%)
 Frame = +2

Query: 110 LVVDNGSGMCKAGFAGDDAPRAVFPSIVG-RPRHQGVMVGMGQKDSYVGVRHRAKXXXXX 286
           +++D+GSG  KAG AG + P+ VFP+IV   P  +       ++   +G+          
Sbjct: 6   VIIDHGSGFLKAGTAGWNEPQMVFPNIVNYLPCKENPGPSYARRRVSLGI-DICHPDTFS 64

Query: 287 XXXXXXXXXXLTGMTWRRFGIIPSTMSWVSPPEEHPVLLTEAPLNPKATERKMTHIMF 460
                       G+ +    ++ +       P   PV++TE PL   A  +KM  I+F
Sbjct: 65  YPIERGRILNWEGVQYLWSFVLENHRREQEVP---PVIITETPLREPADRKKMLEILF 119


>UniRef50_A2VD47 Cluster: Zgc:158823 protein; n=3; Eukaryota|Rep:
           Zgc:158823 protein - Danio rerio (Zebrafish)
           (Brachydanio rerio)
          Length = 334

 Score = 36.7 bits (81), Expect = 0.42
 Identities = 17/42 (40%), Positives = 22/42 (52%)
 Frame = +1

Query: 256 EAQSKRGFLTLKYPIEHGIVTNWDDMEKIWHHTFYNELGVAP 381
           EA  K  + T K+PI HGI+ +WD MEK      +  L   P
Sbjct: 66  EAIDKPNYAT-KWPIRHGIIEDWDFMEKFMEQVIFKYLRAEP 106


>UniRef50_Q4UGT7 Cluster: Actin-related protein, putative; n=2;
           Theileria|Rep: Actin-related protein, putative -
           Theileria annulata
          Length = 575

 Score = 36.7 bits (81), Expect = 0.42
 Identities = 15/32 (46%), Positives = 22/32 (68%)
 Frame = +2

Query: 110 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPR 205
           +V++NGSG  K G AG+  P  V P+ VG+P+
Sbjct: 12  VVLENGSGYVKIGMAGNKKPPHVIPNCVGQPK 43


>UniRef50_Q09849 Cluster: Uncharacterized protein C23D3.09; n=1;
           Schizosaccharomyces pombe|Rep: Uncharacterized protein
           C23D3.09 - Schizosaccharomyces pombe (Fission yeast)
          Length = 430

 Score = 36.7 bits (81), Expect = 0.42
 Identities = 14/34 (41%), Positives = 23/34 (67%)
 Frame = +2

Query: 95  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVG 196
           EE+ +LV+D GS   + G+AG+++P  + PS  G
Sbjct: 8   EEIPSLVIDPGSCWTRFGYAGEESPMTILPSYYG 41


>UniRef50_UPI0000D56C2F Cluster: PREDICTED: similar to Actin-57B;
           n=1; Tribolium castaneum|Rep: PREDICTED: similar to
           Actin-57B - Tribolium castaneum
          Length = 291

 Score = 36.3 bits (80), Expect = 0.55
 Identities = 25/57 (43%), Positives = 33/57 (57%), Gaps = 2/57 (3%)
 Frame = +2

Query: 380 PEEHPVLLTEAPLNP--KATERKMTHIMFPKHFTRPAIVPSAFKPCFLLLHRFGAVT 544
           PE HPVLLT+ P  P  KAT  K+  IMF + F  PA+      P  L L+ +G++T
Sbjct: 21  PENHPVLLTK-PYFPISKATTEKIAQIMF-EDFKIPAL--HLIYPSVLSLYSYGSLT 73


>UniRef50_Q7S6X6 Cluster: Actin-like protein arp-6; n=5;
           Pezizomycotina|Rep: Actin-like protein arp-6 -
           Neurospora crassa
          Length = 446

 Score = 36.3 bits (80), Expect = 0.55
 Identities = 19/43 (44%), Positives = 26/43 (60%), Gaps = 4/43 (9%)
 Frame = +2

Query: 110 LVVDNGSGMCKAGFAGDD----APRAVFPSIVGRPRHQGVMVG 226
           LV+DNG+   KAGF  DD     PR + P+ + R RH+ + VG
Sbjct: 22  LVLDNGADTIKAGFVSDDKSDGKPR-IIPNCLARDRHRKIYVG 63



 Score = 33.1 bits (72), Expect = 5.1
 Identities = 12/40 (30%), Positives = 23/40 (57%), Gaps = 2/40 (5%)
 Frame = +1

Query: 253 SEAQSKRGF--LTLKYPIEHGIVTNWDDMEKIWHHTFYNE 366
           SE +  + F  L  + P+E G + NW+  ++IW   F+++
Sbjct: 64  SELEKCKDFSELAFRRPVEKGFIVNWEAQKEIWDREFFDD 103


>UniRef50_Q6CSB9 Cluster: Actin-related protein 4; n=1;
           Kluyveromyces lactis|Rep: Actin-related protein 4 -
           Kluyveromyces lactis (Yeast) (Candida sphaerica)
          Length = 520

 Score = 36.3 bits (80), Expect = 0.55
 Identities = 14/40 (35%), Positives = 24/40 (60%)
 Frame = +2

Query: 95  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQG 214
           +E+ A+V+D GS +   G++G D P+++ PS  G     G
Sbjct: 12  DEINAIVIDPGSFVTNIGYSGTDCPQSIMPSSYGNVETDG 51


>UniRef50_Q6BXN0 Cluster: Actin-related protein 4; n=7;
           Saccharomycetales|Rep: Actin-related protein 4 -
           Debaryomyces hansenii (Yeast) (Torulaspora hansenii)
          Length = 492

 Score = 35.9 bits (79), Expect = 0.73
 Identities = 15/49 (30%), Positives = 28/49 (57%)
 Frame = +2

Query: 95  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKD 241
           +E+ A+V+D+ S   + G+AGDD P+ + PS    P    + +   +K+
Sbjct: 14  DEINAIVLDSSSFHTRIGYAGDDFPKIITPSSYASPNEDAMELDNKKKN 62


>UniRef50_UPI0000E4A0BF Cluster: PREDICTED: similar to Actin-related
           protein 5; n=2; Strongylocentrotus purpuratus|Rep:
           PREDICTED: similar to Actin-related protein 5 -
           Strongylocentrotus purpuratus
          Length = 602

 Score = 35.5 bits (78), Expect = 0.97
 Identities = 28/121 (23%), Positives = 49/121 (40%), Gaps = 4/121 (3%)
 Frame = +2

Query: 110 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPR---HQGVMVGMGQKDSYVGVRHRAK-XX 277
           +++DNGS   + G+A +  PR  F +I+ R R        +G     +   VR   K   
Sbjct: 93  IIIDNGSCFSRVGWASEGTPRLTFRNIIARQRGKKDSDAQIG-NDIPNVETVRWLLKTQF 151

Query: 278 XXXXXXXXXXXXXLTGMTWRRFGIIPSTMSWVSPPEEHPVLLTEAPLNPKATERKMTHIM 457
                        +    ++R GI            +HP+++TE P NP    + M+ ++
Sbjct: 152 DRDVVTHYDAQEQILDHAFQRLGIDS------EGAVKHPIVMTETPCNPNLCRQTMSELL 205

Query: 458 F 460
           F
Sbjct: 206 F 206


>UniRef50_Q4N7N1 Cluster: Actin, putative; n=2; Theileria|Rep:
           Actin, putative - Theileria parva
          Length = 383

 Score = 35.5 bits (78), Expect = 0.97
 Identities = 17/40 (42%), Positives = 24/40 (60%)
 Frame = +2

Query: 86  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPR 205
           M DE+   +V+DNGS   K G +G  +P  +  S+VG PR
Sbjct: 1   MADEQ--CVVIDNGSFSLKIGLSGSYSPSFIVHSVVGNPR 38



 Score = 33.5 bits (73), Expect = 3.9
 Identities = 13/42 (30%), Positives = 24/42 (57%)
 Frame = +1

Query: 232 TEGLLCRSEAQSKRGFLTLKYPIEHGIVTNWDDMEKIWHHTF 357
           TE      +  S   F++L + I+HG ++++D ME +W + F
Sbjct: 46  TEDFYYAEDVYSSLEFMSLDHLIDHGHISDFDKMEGLWQYCF 87


>UniRef50_P32392 Cluster: Actin-related protein 3; n=27;
           Eukaryota|Rep: Actin-related protein 3 - Drosophila
           melanogaster (Fruit fly)
          Length = 418

 Score = 35.1 bits (77), Expect = 1.3
 Identities = 15/42 (35%), Positives = 23/42 (54%)
 Frame = +1

Query: 256 EAQSKRGFLTLKYPIEHGIVTNWDDMEKIWHHTFYNELGVAP 381
           EA    G+ ++KYP+ HG+V +WD ME+      +  L   P
Sbjct: 65  EAFDATGY-SIKYPVRHGLVEDWDLMERFLEQCVFKYLRAEP 105



 Score = 34.7 bits (76), Expect = 1.7
 Identities = 32/127 (25%), Positives = 48/127 (37%), Gaps = 9/127 (7%)
 Frame = +2

Query: 107 ALVVDNGSGMCKAGFAGDDAPRAVFPSI--------VGRPRHQGVMVGMGQKDSYVGVRH 262
           A V+D G+G  K GFAG+  P+ + PS         VG    + +  G+   D ++G   
Sbjct: 7   ACVIDVGTGYSKLGFAGNKEPQFIIPSAIAIKESARVGDTNTRRITKGIEDLDFFIG--D 64

Query: 263 RAKXXXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSWV-SPPEEHPVLLTEAPLNPKATER 439
            A                +         +      ++ + PE+H  LLTE PLN      
Sbjct: 65  EAFDATGYSIKYPVRHGLVEDWDLMERFLEQCVFKYLRAEPEDHYFLLTEPPLNTPENRE 124

Query: 440 KMTHIMF 460
               IMF
Sbjct: 125 YTAEIMF 131


>UniRef50_Q8I450 Cluster: Actin-related protein, putative; n=5;
           Plasmodium|Rep: Actin-related protein, putative -
           Plasmodium falciparum (isolate 3D7)
          Length = 565

 Score = 34.7 bits (76), Expect = 1.7
 Identities = 15/35 (42%), Positives = 22/35 (62%)
 Frame = +2

Query: 98  EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRP 202
           ++ ++V+D G    K G+AGD+ P  VF S VG P
Sbjct: 6   DILSIVIDLGFENTKVGYAGDENPTNVFSSNVGMP 40


>UniRef50_Q7QA11 Cluster: ENSANGP00000003921; n=1; Anopheles gambiae
           str. PEST|Rep: ENSANGP00000003921 - Anopheles gambiae
           str. PEST
          Length = 390

 Score = 34.7 bits (76), Expect = 1.7
 Identities = 14/32 (43%), Positives = 22/32 (68%)
 Frame = +2

Query: 110 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPR 205
           +V+DNGS  C+AG+   + P  VF +I+ +PR
Sbjct: 5   IVIDNGSFNCRAGWMLKEKPALVFRNILAKPR 36


>UniRef50_A2DEE0 Cluster: Actin family protein; n=1; Trichomonas
           vaginalis G3|Rep: Actin family protein - Trichomonas
           vaginalis G3
          Length = 378

 Score = 34.7 bits (76), Expect = 1.7
 Identities = 15/42 (35%), Positives = 26/42 (61%)
 Frame = +1

Query: 256 EAQSKRGFLTLKYPIEHGIVTNWDDMEKIWHHTFYNELGVAP 381
           EA  K    +L  P ++G +TN DD+E+++H+ F  E+ + P
Sbjct: 64  EAIEKSDPNSLYNPFKNGYITNPDDIERLFHYIFEKEIHINP 105


>UniRef50_Q7RR61 Cluster: Actin-like 6; n=3; Plasmodium
           (Vinckeia)|Rep: Actin-like 6 - Plasmodium yoelii yoelii
          Length = 538

 Score = 34.3 bits (75), Expect = 2.2
 Identities = 14/35 (40%), Positives = 24/35 (68%)
 Frame = +2

Query: 98  EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRP 202
           +V+++V+D G    K G++GD+ P+ +F S VG P
Sbjct: 6   DVSSIVIDLGFENIKLGYSGDENPKNIFSSNVGVP 40


>UniRef50_Q4Q187 Cluster: Actin-like protein, putative; n=3;
           Leishmania|Rep: Actin-like protein, putative -
           Leishmania major
          Length = 407

 Score = 34.3 bits (75), Expect = 2.2
 Identities = 14/34 (41%), Positives = 23/34 (67%)
 Frame = +2

Query: 101 VAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRP 202
           + ++VVD G+   + GF+G++APR +  S VG P
Sbjct: 8   IQSVVVDVGTRNTRVGFSGEEAPRTMLRSCVGLP 41



 Score = 33.1 bits (72), Expect = 5.1
 Identities = 15/45 (33%), Positives = 24/45 (53%)
 Frame = +1

Query: 259 AQSKRGFLTLKYPIEHGIVTNWDDMEKIWHHTFYNELGVAPRGTP 393
           A +  G L+L YP+  G V ++D +EK+  +    E  V P  +P
Sbjct: 63  AYNDGGLLSLTYPVRAGHVCDYDALEKLLFYALVEEARVTPDTSP 107


>UniRef50_Q09443 Cluster: Actin-like protein C08B11.6; n=2;
           Caenorhabditis|Rep: Actin-like protein C08B11.6 -
           Caenorhabditis elegans
          Length = 418

 Score = 34.3 bits (75), Expect = 2.2
 Identities = 12/21 (57%), Positives = 14/21 (66%)
 Frame = +1

Query: 295 PIEHGIVTNWDDMEKIWHHTF 357
           PIE G V NWD  ++IW  TF
Sbjct: 62  PIERGYVVNWDTQQQIWEKTF 82


>UniRef50_A7AQU0 Cluster: Actin-related, putative; n=1; Babesia
           bovis|Rep: Actin-related, putative - Babesia bovis
          Length = 508

 Score = 33.9 bits (74), Expect = 2.9
 Identities = 17/52 (32%), Positives = 24/52 (46%)
 Frame = +2

Query: 113 VVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGVRHRA 268
           VVDNGSG+ K   A    P  V P+ +G P+ +     +    +  G  H A
Sbjct: 13  VVDNGSGLLKFSLASSVKPPFVLPNCIGHPKRKFTSQNLADGSASGGDDHGA 64


>UniRef50_UPI0000E477BD Cluster: PREDICTED: similar to
           uncharacterized hypothalamus protein HARP11; n=1;
           Strongylocentrotus purpuratus|Rep: PREDICTED: similar to
           uncharacterized hypothalamus protein HARP11 -
           Strongylocentrotus purpuratus
          Length = 481

 Score = 33.5 bits (73), Expect = 3.9
 Identities = 15/30 (50%), Positives = 18/30 (60%)
 Frame = +2

Query: 98  EVAALVVDNGSGMCKAGFAGDDAPRAVFPS 187
           E  A V D G+   K GFAG+ +PRA  PS
Sbjct: 12  EKTAAVFDIGAAYTKVGFAGETSPRATIPS 41


>UniRef50_UPI0000E254E7 Cluster: PREDICTED: similar to putative cell
           wall protein FLO11p, partial; n=1; Pan troglodytes|Rep:
           PREDICTED: similar to putative cell wall protein FLO11p,
           partial - Pan troglodytes
          Length = 295

 Score = 33.5 bits (73), Expect = 3.9
 Identities = 16/34 (47%), Positives = 19/34 (55%)
 Frame = -2

Query: 260 ASLLHKSPSVPYRPSRPDGGAFPRSRGTRREEHH 159
           A  LH++PS P  PS PD  + PRS  T   E H
Sbjct: 42  APRLHRTPSHPRSPSTPDTESHPRSPSTPDTESH 75


>UniRef50_Q81ND7 Cluster: Putative uncharacterized protein; n=3;
           Bacillus cereus group|Rep: Putative uncharacterized
           protein - Bacillus anthracis
          Length = 230

 Score = 33.5 bits (73), Expect = 3.9
 Identities = 20/63 (31%), Positives = 31/63 (49%), Gaps = 2/63 (3%)
 Frame = -3

Query: 304 VRWGI*GSGNLFCSVPHSYIRVLLSHTDHHALMAGPS--HDRGEHGARSIISCETGLAHT 131
           V W   G G L   +P  Y+ +L  HT +  L  G +  H++  +G  + I+  TG + T
Sbjct: 147 VLWNGGGRGRLVSVLPAVYVAILSEHTIYRRLTEGVTRIHEQVSNGLPACINFITGPSRT 206

Query: 130 GAI 122
           G I
Sbjct: 207 GDI 209


>UniRef50_Q6BG23 Cluster: Actin, putative; n=1; Paramecium
           tetraurelia|Rep: Actin, putative - Paramecium
           tetraurelia
          Length = 328

 Score = 33.5 bits (73), Expect = 3.9
 Identities = 12/32 (37%), Positives = 19/32 (59%)
 Frame = +1

Query: 286 LKYPIEHGIVTNWDDMEKIWHHTFYNELGVAP 381
           +KYPI +  + ++D ME +WH  F+  L   P
Sbjct: 21  IKYPILNSKIVDFDTMETVWHKAFFEYLMTNP 52


>UniRef50_A5KAY0 Cluster: Actin-related protein, putative; n=1;
           Plasmodium vivax|Rep: Actin-related protein, putative -
           Plasmodium vivax
          Length = 600

 Score = 33.5 bits (73), Expect = 3.9
 Identities = 15/35 (42%), Positives = 22/35 (62%)
 Frame = +2

Query: 98  EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRP 202
           ++ ++VVD G    K G+AGD+ P  +F S VG P
Sbjct: 6   DILSIVVDLGFENTKIGYAGDENPTNIFSSNVGVP 40


>UniRef50_Q0V0G6 Cluster: Putative uncharacterized protein; n=1;
           Phaeosphaeria nodorum|Rep: Putative uncharacterized
           protein - Phaeosphaeria nodorum (Septoria nodorum)
          Length = 443

 Score = 33.5 bits (73), Expect = 3.9
 Identities = 11/28 (39%), Positives = 16/28 (57%)
 Frame = +1

Query: 274 GFLTLKYPIEHGIVTNWDDMEKIWHHTF 357
           G L  + P+E G + NW+  + IW H F
Sbjct: 73  GELAFRRPVEKGFIVNWEAEKAIWEHEF 100


>UniRef50_UPI0000498FDF Cluster: actin; n=1; Entamoeba histolytica
           HM-1:IMSS|Rep: actin - Entamoeba histolytica HM-1:IMSS
          Length = 763

 Score = 33.1 bits (72), Expect = 5.1
 Identities = 17/47 (36%), Positives = 26/47 (55%)
 Frame = +2

Query: 113 VVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVG 253
           ++D GS   K+GF     P  V P++VG+  HQ    G  +++ YVG
Sbjct: 425 IIDIGSCSIKSGFESVGTPSIVTPTVVGKNLHQ--TSGFVEQNLYVG 469


>UniRef50_UPI000061673C Cluster: Thrombospondin repeat containing 1;
           n=1; Bos taurus|Rep: Thrombospondin repeat containing 1
           - Bos Taurus
          Length = 464

 Score = 33.1 bits (72), Expect = 5.1
 Identities = 16/45 (35%), Positives = 22/45 (48%)
 Frame = -2

Query: 308 PCSMGYLRVRKPLLLCASLLHKSPSVPYRPSRPDGGAFPRSRGTR 174
           PC +G  R  +   L  + LH+   +P RP R      PR +GTR
Sbjct: 18  PCGVGVQRRSRTCQLPTTQLHQGLPLPPRPPRHPEALLPRGQGTR 62


>UniRef50_Q7M3Y6 Cluster: Actin homolog fat, testicular; n=3;
           Deuterostomia|Rep: Actin homolog fat, testicular -
           Pisaster ochraceus (Sea star)
          Length = 155

 Score = 33.1 bits (72), Expect = 5.1
 Identities = 16/26 (61%), Positives = 18/26 (69%)
 Frame = +2

Query: 410 APLNPKATERKMTHIMFPKHFTRPAI 487
           APLNPKA   KMT IMF + F  PA+
Sbjct: 1   APLNPKANREKMTQIMF-ETFNTPAM 25


>UniRef50_Q8SRZ3 Cluster: ACTIN-RELATED PROTEIN; n=1;
           Encephalitozoon cuniculi|Rep: ACTIN-RELATED PROTEIN -
           Encephalitozoon cuniculi
          Length = 555

 Score = 33.1 bits (72), Expect = 5.1
 Identities = 13/32 (40%), Positives = 24/32 (75%)
 Frame = +2

Query: 110 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPR 205
           +V+DNG+  CKAG+ G ++P+ VF +++ R +
Sbjct: 23  IVIDNGTYECKAGYCG-ESPQMVFKNVLYRQK 53


>UniRef50_Q4P820 Cluster: Putative uncharacterized protein; n=1;
           Ustilago maydis|Rep: Putative uncharacterized protein -
           Ustilago maydis (Smut fungus)
          Length = 724

 Score = 33.1 bits (72), Expect = 5.1
 Identities = 14/36 (38%), Positives = 18/36 (50%)
 Frame = +1

Query: 280 LTLKYPIEHGIVTNWDDMEKIWHHTFYNELGVAPRG 387
           L L+ P + GIV +W   + IW H   N L   P G
Sbjct: 126 LHLRLPHQSGIVVDWAAQKTIWDHVLTNHLAKLPGG 161


>UniRef50_A1C924 Cluster: Actin family protein; n=4;
           Eurotiomycetidae|Rep: Actin family protein - Aspergillus
           clavatus
          Length = 436

 Score = 33.1 bits (72), Expect = 5.1
 Identities = 9/29 (31%), Positives = 19/29 (65%)
 Frame = +1

Query: 280 LTLKYPIEHGIVTNWDDMEKIWHHTFYNE 366
           +  + P+E G + NW+  ++IW  +F++E
Sbjct: 86  MAFRRPVEKGYIVNWEAQKEIWETSFFDE 114


>UniRef50_A1ZKI0 Cluster: Formiminoglutamate deiminase; n=2;
           Sphingobacteriales|Rep: Formiminoglutamate deiminase -
           Microscilla marina ATCC 23134
          Length = 466

 Score = 32.7 bits (71), Expect = 6.8
 Identities = 18/56 (32%), Positives = 26/56 (46%), Gaps = 1/56 (1%)
 Frame = -3

Query: 262 VPHSYIRVLLSHTDHHALMAGPSHDRGEHGARSIISCE-TGLAHTGAIVYYQRGNF 98
           V H Y  V   H  HH L   P  ++   G R I + +  G+  T   ++YQ+G F
Sbjct: 119 VRHGYTSVAEFHYVHHDLTGKPYSNKAALGERLIAAAQKAGIRITLVPIFYQKGGF 174


>UniRef50_Q9SRK2 Cluster: Putative actin; n=1; Arabidopsis
           thaliana|Rep: Putative actin - Arabidopsis thaliana
           (Mouse-ear cress)
          Length = 378

 Score = 32.7 bits (71), Expect = 6.8
 Identities = 13/31 (41%), Positives = 20/31 (64%)
 Frame = +2

Query: 110 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRP 202
           +V+DNG G+ KAG  G+  P  V P+ + +P
Sbjct: 5   VVLDNGGGLIKAGQGGERDPTTVIPNCLYKP 35


>UniRef50_A2SY08 Cluster: Trhombospondin Bi; n=1; Ciona
           intestinalis|Rep: Trhombospondin Bi - Ciona intestinalis
           (Transparent sea squirt)
          Length = 962

 Score = 32.7 bits (71), Expect = 6.8
 Identities = 20/58 (34%), Positives = 26/58 (44%)
 Frame = -3

Query: 502 ECRRNNGGACKMFWKHDMGHLSLCGLGVEGSLSEQDWVFLGGRHPAHCRRYDAKSSPC 329
           EC+ NNGG  K    H++   S CG  +EG    Q    +G     HC   D   +PC
Sbjct: 380 ECKVNNGGCVKYSVCHNLPGASRCGRCIEGFTGNQT---IGCTKIRHCS--DGGVNPC 432


>UniRef50_A5E5Q2 Cluster: Putative uncharacterized protein; n=1;
           Lodderomyces elongisporus NRRL YB-4239|Rep: Putative
           uncharacterized protein - Lodderomyces elongisporus
           (Yeast) (Saccharomyces elongisporus)
          Length = 541

 Score = 32.7 bits (71), Expect = 6.8
 Identities = 15/43 (34%), Positives = 26/43 (60%)
 Frame = +2

Query: 95  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMV 223
           +E+ A+++D G+   + G+AGDD P+ +  S  G+   QG  V
Sbjct: 13  DEINAIILDIGTHTTRIGYAGDDFPKIITTSNYGK-TSQGTKV 54


>UniRef50_Q6C982 Cluster: Actin-like protein ARP6; n=1; Yarrowia
           lipolytica|Rep: Actin-like protein ARP6 - Yarrowia
           lipolytica (Candida lipolytica)
          Length = 387

 Score = 32.7 bits (71), Expect = 6.8
 Identities = 12/28 (42%), Positives = 16/28 (57%)
 Frame = +1

Query: 280 LTLKYPIEHGIVTNWDDMEKIWHHTFYN 363
           L  K P E G + NWD  + +W + FYN
Sbjct: 47  LVFKRPSEKGQLINWDIQKAVWDNLFYN 74


>UniRef50_Q5AXH1 Cluster: Actin-like protein arp6; n=5;
           Trichocomaceae|Rep: Actin-like protein arp6 - Emericella
           nidulans (Aspergillus nidulans)
          Length = 479

 Score = 32.7 bits (71), Expect = 6.8
 Identities = 9/29 (31%), Positives = 19/29 (65%)
 Frame = +1

Query: 280 LTLKYPIEHGIVTNWDDMEKIWHHTFYNE 366
           +  + P+E G   NW+  ++IW ++F++E
Sbjct: 86  MLFRRPVEKGYTVNWEAQKEIWENSFFDE 114


>UniRef50_UPI000023F3F1 Cluster: hypothetical protein FG08918.1;
           n=1; Gibberella zeae PH-1|Rep: hypothetical protein
           FG08918.1 - Gibberella zeae PH-1
          Length = 782

 Score = 32.3 bits (70), Expect = 9.0
 Identities = 17/41 (41%), Positives = 20/41 (48%), Gaps = 1/41 (2%)
 Frame = +1

Query: 361 NELGVAPRGTPSPAH*GSPQPQGHRE-KDDPYHVSKTFYTP 480
           N L V P G  SP H    QP  H   + D   V++ FYTP
Sbjct: 215 NALSVEPSGLISPPHGHHSQPGSHHSTRSDSVGVAQHFYTP 255


>UniRef50_UPI0000EC9F4D Cluster: HSD21.; n=2; Gallus gallus|Rep:
           HSD21. - Gallus gallus
          Length = 373

 Score = 32.3 bits (70), Expect = 9.0
 Identities = 15/41 (36%), Positives = 25/41 (60%), Gaps = 1/41 (2%)
 Frame = +2

Query: 110 LVVDNGSGMCKAGFAGDDAPRAVFPSIVG-RPRHQGVMVGM 229
           +V+D G+  C+AGF+G  +P A   ++VG R   +G   G+
Sbjct: 15  IVIDMGTRSCRAGFSGHYSPSAEVSTLVGHRMGSEGASAGV 55


>UniRef50_Q8AXX1 Cluster: Putative gag protein; n=1; Danio
           rerio|Rep: Putative gag protein - Danio rerio
           (Zebrafish) (Brachydanio rerio)
          Length = 612

 Score = 32.3 bits (70), Expect = 9.0
 Identities = 13/27 (48%), Positives = 18/27 (66%)
 Frame = -1

Query: 159 SPAKPALHIPEPLSTTNAATSSSHILN 79
           SP  P+ H+P P S+  +A SSSH+ N
Sbjct: 62  SPITPSRHLPSPASSYASARSSSHVSN 88


>UniRef50_Q6SF88 Cluster: Esterase, putative; n=3; Bacteria|Rep:
           Esterase, putative - uncultured bacterium 581
          Length = 292

 Score = 32.3 bits (70), Expect = 9.0
 Identities = 28/95 (29%), Positives = 45/95 (47%)
 Frame = -1

Query: 369 QLIVEGMMPNLLHVIPVSDDSVFDGVFEGQETSFALCLTPT*ESFCPIPTITP*WRGLPT 190
           +LI  G++P  L V+P S     +G  E  ET+F   L P  E+  P+ T+    RG   
Sbjct: 94  RLIASGVIPPTLIVMPGSKSWWLNGHNELAETAFIDDLLPFVEANYPVATV----RGGRF 149

Query: 189 IEGNTARGASSPAKPALHIPEPLSTTNAATSSSHI 85
           I G +A G  +     +H PE      A + ++++
Sbjct: 150 IAGLSAGGFGATRFALMH-PERFGAAAALSPATYV 183


>UniRef50_Q1NK22 Cluster: Electron-transferring-flavoprotein
           dehydrogenase; n=2; delta proteobacterium MLMS-1|Rep:
           Electron-transferring-flavoprotein dehydrogenase - delta
           proteobacterium MLMS-1
          Length = 553

 Score = 32.3 bits (70), Expect = 9.0
 Identities = 21/43 (48%), Positives = 22/43 (51%), Gaps = 4/43 (9%)
 Frame = -2

Query: 236 SVPYRPSRP-DGGAFPRSRGT-RREEH--HLLRNRPCTYRSHC 120
           S PY+PSRP D  AF    GT  REE   HLL   P   R  C
Sbjct: 448 SYPYKPSRPFDKDAFTAKSGTGHREEEPCHLLIADPAICREQC 490


>UniRef50_Q1FM23 Cluster: Putative uncharacterized protein; n=1;
           Clostridium phytofermentans ISDg|Rep: Putative
           uncharacterized protein - Clostridium phytofermentans
           ISDg
          Length = 244

 Score = 32.3 bits (70), Expect = 9.0
 Identities = 19/53 (35%), Positives = 27/53 (50%), Gaps = 1/53 (1%)
 Frame = -1

Query: 450 WVIFLSVALGLRGASVSRTGCSSGGDTQLIVEGMMPNLLHVI-PVSDDSVFDG 295
           W  FL +  G  G  +S          ++IV   +P LL VI P+SD+ +FDG
Sbjct: 141 WKFFLYILAGAIGIFISLLYYRMNKLQKMIVSAGVPALLFVIYPISDEFLFDG 193


>UniRef50_A1WYM4 Cluster: Prepilin peptidase precursor; n=1;
           Halorhodospira halophila SL1|Rep: Prepilin peptidase
           precursor - Halorhodospira halophila (strain DSM 244 /
           SL1) (Ectothiorhodospirahalophila (strain DSM 244 /
           SL1))
          Length = 296

 Score = 32.3 bits (70), Expect = 9.0
 Identities = 18/40 (45%), Positives = 22/40 (55%), Gaps = 4/40 (10%)
 Frame = +1

Query: 331 MEKIWHHTFYNELGVAPRGTPSPA-H*GSPQ---PQGHRE 438
           +E+ W H   + LG   RGTP PA H G P    PQ HR+
Sbjct: 50  LERRWSHEARDILGTPKRGTPEPAYHLGWPPSHCPQCHRQ 89


>UniRef50_Q8ILM5 Cluster: Actin, putative; n=1; Plasmodium
           falciparum 3D7|Rep: Actin, putative - Plasmodium
           falciparum (isolate 3D7)
          Length = 522

 Score = 32.3 bits (70), Expect = 9.0
 Identities = 15/34 (44%), Positives = 20/34 (58%)
 Frame = +2

Query: 95  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVG 196
           E++++LVVD G   CK G   +D PR    SI G
Sbjct: 16  EDISSLVVDLGFYSCKIGHNQEDTPRIFLNSICG 49


>UniRef50_Q5BXM4 Cluster: SJCHGC05761 protein; n=1; Schistosoma
           japonicum|Rep: SJCHGC05761 protein - Schistosoma
           japonicum (Blood fluke)
          Length = 246

 Score = 32.3 bits (70), Expect = 9.0
 Identities = 14/35 (40%), Positives = 20/35 (57%)
 Frame = +2

Query: 98  EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRP 202
           E  A+V D G+   K GFAG+  PR + P+ +  P
Sbjct: 33  EKTAVVFDIGTVYTKCGFAGETGPRFIIPTAITLP 67


>UniRef50_Q2PE20 Cluster: CG10067-PB, isoform B; n=1; Drosophila
           melanogaster|Rep: CG10067-PB, isoform B - Drosophila
           melanogaster (Fruit fly)
          Length = 36

 Score = 32.3 bits (70), Expect = 9.0
 Identities = 13/15 (86%), Positives = 15/15 (100%)
 Frame = +2

Query: 86  MCDEEVAALVVDNGS 130
           MCD+EVAALVVDNG+
Sbjct: 1   MCDDEVAALVVDNGA 15


>UniRef50_A2QYF6 Cluster: Similarity to proteins with this domain;
            n=1; Aspergillus niger|Rep: Similarity to proteins with
            this domain - Aspergillus niger
          Length = 961

 Score = 32.3 bits (70), Expect = 9.0
 Identities = 22/73 (30%), Positives = 30/73 (41%), Gaps = 3/73 (4%)
 Frame = +2

Query: 377  PPEEHPVLLTEAPLNPKATERKMTHIMFPKHFTRPAIVPSAFKPCFLLLHRFGAVTQPGI 556
            PP  HP  L  +P      E   T   + ++  +P    SAF P +  +  FGA    G 
Sbjct: 832  PPHSHPHSLNPSPTTDSTAEPPSTSSNWVQYPPQPRQYYSAFSPGYQDVQGFGADPGSGS 891

Query: 557  RG---LDFPGGTG 586
             G   +  PGG G
Sbjct: 892  NGNGMVVTPGGAG 904


>UniRef50_Q0W6D4 Cluster: Putative uncharacterized protein; n=1;
           uncultured methanogenic archaeon RC-I|Rep: Putative
           uncharacterized protein - Uncultured methanogenic
           archaeon RC-I
          Length = 427

 Score = 32.3 bits (70), Expect = 9.0
 Identities = 16/45 (35%), Positives = 20/45 (44%)
 Frame = -1

Query: 231 PIPTITP*WRGLPTIEGNTARGASSPAKPALHIPEPLSTTNAATS 97
           P PT+TP     PT+E        +P       P P+ TT A TS
Sbjct: 353 PTPTVTPTPTPEPTVEATPVPATPTPTVEPTVAPSPVPTTTAQTS 397


>UniRef50_P23246 Cluster: Splicing factor, proline- and
           glutamine-rich; n=81; Eumetazoa|Rep: Splicing factor,
           proline- and glutamine-rich - Homo sapiens (Human)
          Length = 707

 Score = 32.3 bits (70), Expect = 9.0
 Identities = 12/26 (46%), Positives = 15/26 (57%)
 Frame = +1

Query: 379 PRGTPSPAH*GSPQPQGHREKDDPYH 456
           P G P P H G  +P+G R+   PYH
Sbjct: 227 PGGHPKPPHRGGGEPRGGRQHHPPYH 252


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 734,114,971
Number of Sequences: 1657284
Number of extensions: 18321530
Number of successful extensions: 57051
Number of sequences better than 10.0: 170
Number of HSP's better than 10.0 without gapping: 52435
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 56985
length of database: 575,637,011
effective HSP length: 97
effective length of database: 414,880,463
effective search space used: 42317807226
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).