SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0005
         (609 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_A0MNZ0 Cluster: NADPH oxidoreductase; n=1; Bombyx mori|...    44   0.004
UniRef50_Q0HDB3 Cluster: Putative uncharacterized protein; n=2; ...    33   4.0  

>UniRef50_A0MNZ0 Cluster: NADPH oxidoreductase; n=1; Bombyx
           mori|Rep: NADPH oxidoreductase - Bombyx mori (Silk moth)
          Length = 191

 Score = 43.6 bits (98), Expect = 0.004
 Identities = 20/35 (57%), Positives = 24/35 (68%)
 Frame = -2

Query: 506 QLFQNLINLCMFFFKLHRCVDDLTAHLVLSGYWNP 402
           Q+  N    C+  F L R VD+LTAHLVLSGYW+P
Sbjct: 141 QINANPKRFCLSRFLLLRWVDELTAHLVLSGYWSP 175


>UniRef50_Q0HDB3 Cluster: Putative uncharacterized protein; n=2;
           Shewanella|Rep: Putative uncharacterized protein -
           Shewanella sp. (strain MR-4)
          Length = 521

 Score = 33.5 bits (73), Expect = 4.0
 Identities = 20/48 (41%), Positives = 28/48 (58%), Gaps = 3/48 (6%)
 Frame = +3

Query: 114 KHQIQKIQLSFCKELSLPDNH---QVDKDHLETNHINITLTNILLVVG 248
           +HQIQKI       LSLPD++   +VD   L  ++INI  T + L +G
Sbjct: 35  QHQIQKIPKGKSIYLSLPDSYKIPEVDNSWLAAHNINIIRTPVNLSIG 82


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 635,011,873
Number of Sequences: 1657284
Number of extensions: 12682543
Number of successful extensions: 26640
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 25832
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 26630
length of database: 575,637,011
effective HSP length: 97
effective length of database: 414,880,463
effective search space used: 43562448615
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).