SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0004
         (637 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_Q4JSC0 Cluster: Actin; n=13; Coelomata|Rep: Actin - Ano...   141   1e-32
UniRef50_O65314 Cluster: Actin; n=20; Eukaryota|Rep: Actin - Sch...   136   4e-31
UniRef50_P02581 Cluster: Actin-1; n=1852; Eukaryota|Rep: Actin-1...   122   1e-26
UniRef50_Q96483 Cluster: Actin-51; n=584; Eukaryota|Rep: Actin-5...   121   1e-26
UniRef50_P14883 Cluster: Actin-2; n=75; Eukaryota|Rep: Actin-2 -...   121   2e-26
UniRef50_A7RPC3 Cluster: Predicted protein; n=3; Eumetazoa|Rep: ...    98   2e-19
UniRef50_Q7XB26 Cluster: Ubiquitin/actin fusion protein 4; n=1; ...    96   7e-19
UniRef50_Q0VHZ5 Cluster: Actin deviating protein; n=7; Eukaryota...    95   1e-18
UniRef50_A2DKQ5 Cluster: Actin 58, putative; n=2; Trichomonas va...    95   2e-18
UniRef50_UPI0000F2D825 Cluster: PREDICTED: similar to actin; n=1...    94   3e-18
UniRef50_A5E2K2 Cluster: Actin; n=5; Saccharomycetales|Rep: Acti...    88   1e-16
UniRef50_Q8MVN5 Cluster: Cardiac actin-like protein; n=1; Bolten...    88   2e-16
UniRef50_UPI000065FC19 Cluster: Homolog of Homo sapiens "Actin, ...    87   3e-16
UniRef50_Q0VHZ6 Cluster: Actin deviating protein; n=2; Bolivina ...    86   6e-16
UniRef50_UPI0000F2D326 Cluster: PREDICTED: similar to actin; n=1...    85   1e-15
UniRef50_UPI0000E466A7 Cluster: PREDICTED: similar to actin, alp...    85   2e-15
UniRef50_Q2GY63 Cluster: Putative uncharacterized protein; n=1; ...    84   3e-15
UniRef50_UPI0000449751 Cluster: PREDICTED: similar to gamma-acti...    83   4e-15
UniRef50_A4QNT8 Cluster: Si:ch211-241j12.3 protein; n=3; Danio r...    83   5e-15
UniRef50_Q7M3B0 Cluster: Actin beta; n=1; Sus scrofa domestica|R...    83   5e-15
UniRef50_A7QKV4 Cluster: Chromosome chr8 scaffold_115, whole gen...    80   5e-14
UniRef50_UPI0000605B09 Cluster: PREDICTED: similar to actin alph...    79   7e-14
UniRef50_UPI00001E426E Cluster: PREDICTED: similar to actin-12; ...    79   7e-14
UniRef50_P61163 Cluster: Alpha-centractin; n=356; root|Rep: Alph...    79   7e-14
UniRef50_A2FRF9 Cluster: Actin family protein; n=1; Trichomonas ...    79   1e-13
UniRef50_UPI0000588EB0 Cluster: PREDICTED: similar to actin; n=1...    77   3e-13
UniRef50_UPI00005864C8 Cluster: PREDICTED: similar to Actin; n=4...    76   6e-13
UniRef50_UPI0000E23780 Cluster: PREDICTED: hypothetical protein ...    75   1e-12
UniRef50_Q4CV94 Cluster: Actin 2, putative; n=2; Trypanosoma cru...    75   1e-12
UniRef50_Q9XZB9 Cluster: Actin; n=1; Sterkiella nova|Rep: Actin ...    73   6e-12
UniRef50_Q24C02 Cluster: Actin family protein; n=3; Oligohymenop...    73   8e-12
UniRef50_UPI00005A2ACF Cluster: PREDICTED: similar to cytoplasmi...    72   1e-11
UniRef50_Q55DY5 Cluster: Putative uncharacterized protein; n=1; ...    72   1e-11
UniRef50_Q0J646 Cluster: Os08g0369300 protein; n=2; Oryza sativa...    71   2e-11
UniRef50_A2YUL5 Cluster: Putative uncharacterized protein; n=1; ...    71   2e-11
UniRef50_Q4N681 Cluster: Actin, putative; n=3; Piroplasmida|Rep:...    71   2e-11
UniRef50_UPI00015B6274 Cluster: PREDICTED: similar to putative m...    71   2e-11
UniRef50_Q38F20 Cluster: Actin-like protein 3, putative; n=1; Tr...    71   3e-11
UniRef50_Q8TDY3 Cluster: Actin-related protein T2; n=26; Amniota...    70   4e-11
UniRef50_UPI00006C1719 Cluster: PREDICTED: similar to actin, alp...    69   7e-11
UniRef50_Q5KB93 Cluster: Actin binding protein, putative; n=3; F...    69   7e-11
UniRef50_UPI0000D9A391 Cluster: PREDICTED: actin related protein...    69   9e-11
UniRef50_Q55DS6 Cluster: Putative uncharacterized protein; n=1; ...    68   2e-10
UniRef50_Q9BYD9 Cluster: Actin-related protein M1; n=12; Theria|...    67   4e-10
UniRef50_Q54UQ7 Cluster: Actin-like protein 6A; n=1; Dictyosteli...    66   5e-10
UniRef50_Q4QG59 Cluster: Actin-like protein, putative; n=3; Leis...    66   5e-10
UniRef50_A2FH22 Cluster: Actin family protein; n=1; Trichomonas ...    66   5e-10
UniRef50_UPI0000449ED3 Cluster: PREDICTED: similar to RIKEN cDNA...    66   9e-10
UniRef50_Q9Y615 Cluster: Actin-like protein 7A; n=11; Mammalia|R...    65   1e-09
UniRef50_P61160 Cluster: Actin-related protein 2; n=96; Eukaryot...    64   3e-09
UniRef50_Q6BG22 Cluster: Actin, putative; n=2; Paramecium tetrau...    62   8e-09
UniRef50_A0CQQ2 Cluster: Chromosome undetermined scaffold_24, wh...    62   1e-08
UniRef50_Q9Y614 Cluster: Actin-like protein 7B; n=12; Theria|Rep...    62   1e-08
UniRef50_Q54JL1 Cluster: Putative uncharacterized protein; n=1; ...    61   2e-08
UniRef50_O96819 Cluster: Actin-related protein; n=5; Trypanosoma...    61   2e-08
UniRef50_Q9DFB8 Cluster: Actin; n=1; Scomberomorus maculatus|Rep...    61   3e-08
UniRef50_A5B4L4 Cluster: Putative uncharacterized protein; n=1; ...    60   3e-08
UniRef50_UPI0001554F81 Cluster: PREDICTED: similar to actin; n=1...    60   4e-08
UniRef50_Q4SGD5 Cluster: Chromosome 17 SCAF14597, whole genome s...    59   1e-07
UniRef50_A2DNQ0 Cluster: Actin family protein; n=1; Trichomonas ...    59   1e-07
UniRef50_A2DBN6 Cluster: Actin family protein; n=1; Trichomonas ...    59   1e-07
UniRef50_Q6X960 Cluster: HSD21; n=13; Theria|Rep: HSD21 - Homo s...    59   1e-07
UniRef50_A2YQV6 Cluster: Putative uncharacterized protein; n=1; ...    58   2e-07
UniRef50_Q14BL3 Cluster: RIKEN cDNA 4921517D21 gene; n=7; Euther...    58   2e-07
UniRef50_A3BPG0 Cluster: Putative uncharacterized protein; n=3; ...    58   2e-07
UniRef50_A0E1S8 Cluster: Chromosome undetermined scaffold_73, wh...    58   2e-07
UniRef50_Q8LKR2 Cluster: Actin-related protein 4; n=7; core eudi...    57   3e-07
UniRef50_Q4QF44 Cluster: Actin-related protein 3, putative; n=3;...    57   3e-07
UniRef50_P61158 Cluster: Actin-related protein 3; n=107; Eukaryo...    57   3e-07
UniRef50_UPI00005A3B5D Cluster: PREDICTED: similar to Actin-5C; ...    57   4e-07
UniRef50_A2VD47 Cluster: Zgc:158823 protein; n=3; Eukaryota|Rep:...    57   4e-07
UniRef50_P32392 Cluster: Actin-related protein 3; n=27; Eukaryot...    57   4e-07
UniRef50_UPI0000F2DE11 Cluster: PREDICTED: similar to testis-spe...    56   5e-07
UniRef50_UPI0000E47BC7 Cluster: PREDICTED: similar to ubiquitin/...    55   2e-06
UniRef50_UPI0000E80C06 Cluster: PREDICTED: hypothetical protein;...    54   3e-06
UniRef50_Q383R8 Cluster: Actin-like protein, putative; n=4; Tryp...    53   7e-06
UniRef50_A2ECQ8 Cluster: Actin family protein; n=1; Trichomonas ...    53   7e-06
UniRef50_UPI000049A548 Cluster: actin; n=1; Entamoeba histolytic...    52   1e-05
UniRef50_Q5C683 Cluster: SJCHGC08418 protein; n=1; Schistosoma j...    52   1e-05
UniRef50_Q00UL2 Cluster: Alpha amylase 1; n=3; Ostreococcus|Rep:...    52   2e-05
UniRef50_Q6FRF2 Cluster: Similar to sp|P38696 Saccharomyces cere...    52   2e-05
UniRef50_Q19R57 Cluster: Actin-like protein 1; n=2; Trypanosoma ...    51   3e-05
UniRef50_A2EUM6 Cluster: Actin family protein; n=1; Trichomonas ...    51   3e-05
UniRef50_A7S2B1 Cluster: Predicted protein; n=1; Nematostella ve...    50   4e-05
UniRef50_UPI0000EBF019 Cluster: PREDICTED: similar to ribosomal ...    50   6e-05
UniRef50_Q4DMP2 Cluster: Actin-related protein 2, putative; n=4;...    50   6e-05
UniRef50_A0D9D5 Cluster: Chromosome undetermined scaffold_42, wh...    49   1e-04
UniRef50_Q9N4N4 Cluster: Putative uncharacterized protein; n=2; ...    48   1e-04
UniRef50_Q8IIQ4 Cluster: Actin, putative; n=7; Apicomplexa|Rep: ...    48   1e-04
UniRef50_UPI0000F2D272 Cluster: PREDICTED: similar to actin; n=1...    48   2e-04
UniRef50_Q9P7X7 Cluster: Actin-related protein 4; n=1; Schizosac...    48   2e-04
UniRef50_UPI0000EC9F4D Cluster: HSD21.; n=2; Gallus gallus|Rep: ...    46   8e-04
UniRef50_Q6BG23 Cluster: Actin, putative; n=1; Paramecium tetrau...    46   8e-04
UniRef50_Q17GZ9 Cluster: Actin-related protein 5; n=4; Endoptery...    46   8e-04
UniRef50_Q75JT2 Cluster: Similar to Drosophila melanogaster (Fru...    46   0.001
UniRef50_O96019 Cluster: Actin-like protein 6A; n=63; Eumetazoa|...    46   0.001
UniRef50_Q5CKL2 Cluster: BRG1/brm-associated factor 53A; n=2; Cr...    45   0.001
UniRef50_A4RW28 Cluster: Predicted protein; n=2; Ostreococcus|Re...    45   0.002
UniRef50_Q5CSX9 Cluster: Actin; n=2; Cryptosporidium|Rep: Actin ...    45   0.002
UniRef50_Q9LHH0 Cluster: Actin-like protein; n=11; Magnoliophyta...    44   0.003
UniRef50_Q5C3R3 Cluster: SJCHGC08022 protein; n=1; Schistosoma j...    44   0.003
UniRef50_A4S826 Cluster: Predicted protein; n=1; Ostreococcus lu...    44   0.004
UniRef50_Q22WQ4 Cluster: Actin family protein; n=1; Tetrahymena ...    43   0.005
UniRef50_Q5KLG9 Cluster: 53 kDa brg1-associated factor b (Actin-...    43   0.007
UniRef50_Q9H568 Cluster: Actin-like protein 8; n=10; Eutheria|Re...    43   0.007
UniRef50_Q9SRK2 Cluster: Putative actin; n=1; Arabidopsis thalia...    42   0.009
UniRef50_Q8LKR0 Cluster: Actin-related protein 6; n=26; Magnolio...    42   0.009
UniRef50_Q54E71 Cluster: Putative uncharacterized protein; n=1; ...    42   0.009
UniRef50_A2DEE0 Cluster: Actin family protein; n=1; Trichomonas ...    42   0.009
UniRef50_UPI0000498FDF Cluster: actin; n=1; Entamoeba histolytic...    42   0.012
UniRef50_Q7M3Y5 Cluster: Actin; n=1; Aplysia californica|Rep: Ac...    42   0.016
UniRef50_Q9Y7X8 Cluster: Actin-like protein Arp5; n=1; Schizosac...    42   0.016
UniRef50_A6R1X8 Cluster: Putative uncharacterized protein; n=1; ...    41   0.022
UniRef50_Q6C061 Cluster: Actin-related protein 4; n=1; Yarrowia ...    41   0.022
UniRef50_Q4P2E8 Cluster: Actin-related protein 4; n=1; Ustilago ...    41   0.022
UniRef50_UPI0000499930 Cluster: actin; n=1; Entamoeba histolytic...    41   0.029
UniRef50_Q8IS27 Cluster: Actin-related protein 2; n=5; Oligohyme...    40   0.038
UniRef50_Q9VEC3 Cluster: Actin-related protein 5; n=1; Drosophil...    40   0.038
UniRef50_Q54KZ7 Cluster: Putative uncharacterized protein; n=1; ...    40   0.050
UniRef50_Q4N7N1 Cluster: Actin, putative; n=2; Theileria|Rep: Ac...    40   0.050
UniRef50_Q12406 Cluster: Actin-related protein 7; n=2; Saccharom...    40   0.050
UniRef50_Q6C0A9 Cluster: Yarrowia lipolytica chromosome F of str...    40   0.066
UniRef50_Q0H7S7 Cluster: Actin; n=29; Sordariomycetes|Rep: Actin...    40   0.066
UniRef50_Q7M3Y6 Cluster: Actin homolog fat, testicular; n=3; Deu...    39   0.088
UniRef50_Q6FMT7 Cluster: Similar to sp|Q12406 Saccharomyces cere...    39   0.12 
UniRef50_Q4WA13 Cluster: Chromatin remodeling complex subunit (A...    39   0.12 
UniRef50_Q09849 Cluster: Uncharacterized protein C23D3.09; n=1; ...    39   0.12 
UniRef50_Q9NZ32 Cluster: Actin-related protein 10; n=40; Eumetaz...    39   0.12 
UniRef50_Q18PR4 Cluster: Actin-related protein; n=1; Porphyra ye...    38   0.15 
UniRef50_Q4P303 Cluster: Putative uncharacterized protein; n=1; ...    38   0.15 
UniRef50_P80428 Cluster: Actin-related protein 4; n=4; Saccharom...    38   0.15 
UniRef50_Q6BIA3 Cluster: CA5059|IPF3691 Candida albicans IPF3691...    38   0.20 
UniRef50_Q293V2 Cluster: Actin-related protein 5; n=2; Drosophil...    38   0.20 
UniRef50_Q4Q187 Cluster: Actin-like protein, putative; n=3; Leis...    38   0.27 
UniRef50_A3FQE6 Cluster: Putative uncharacterized protein; n=2; ...    38   0.27 
UniRef50_Q0V0G6 Cluster: Putative uncharacterized protein; n=1; ...    38   0.27 
UniRef50_Q7SHR0 Cluster: Actin-related protein 4; n=16; Pezizomy...    38   0.27 
UniRef50_Q2H0E9 Cluster: Putative uncharacterized protein; n=1; ...    37   0.35 
UniRef50_A7TST0 Cluster: Putative uncharacterized protein; n=1; ...    37   0.35 
UniRef50_A7TM96 Cluster: Putative uncharacterized protein; n=1; ...    37   0.35 
UniRef50_Q4UGT7 Cluster: Actin-related protein, putative; n=2; T...    37   0.47 
UniRef50_A6RD01 Cluster: Putative uncharacterized protein; n=1; ...    37   0.47 
UniRef50_UPI0000498A93 Cluster: actin; n=1; Entamoeba histolytic...    36   0.62 
UniRef50_A1C924 Cluster: Actin family protein; n=4; Eurotiomycet...    36   0.62 
UniRef50_Q7S6X6 Cluster: Actin-like protein arp-6; n=5; Pezizomy...    36   0.62 
UniRef50_Q6CSB9 Cluster: Actin-related protein 4; n=1; Kluyverom...    36   0.62 
UniRef50_Q19R56 Cluster: Actin-like protein 3; n=4; Trypanosoma ...    36   0.82 
UniRef50_Q6C982 Cluster: Actin-like protein ARP6; n=1; Yarrowia ...    36   0.82 
UniRef50_Q6BXN0 Cluster: Actin-related protein 4; n=7; Saccharom...    36   0.82 
UniRef50_A3PQT7 Cluster: Binding-protein-dependent transport sys...    36   1.1  
UniRef50_A7AQU0 Cluster: Actin-related, putative; n=1; Babesia b...    35   1.4  
UniRef50_Q5AXH1 Cluster: Actin-like protein arp6; n=5; Trichocom...    35   1.4  
UniRef50_UPI0000E4A464 Cluster: PREDICTED: similar to thyroid ho...    35   1.9  
UniRef50_A6CGF0 Cluster: Cation efflux system protein, AcrB/AcrD...    35   1.9  
UniRef50_Q8I450 Cluster: Actin-related protein, putative; n=5; P...    35   1.9  
UniRef50_Q7QA11 Cluster: ENSANGP00000003921; n=1; Anopheles gamb...    35   1.9  
UniRef50_Q6GDP8 Cluster: Ferrous iron transport protein B; n=42;...    35   1.9  
UniRef50_Q7RR61 Cluster: Actin-like 6; n=3; Plasmodium (Vinckeia...    34   2.5  
UniRef50_Q7Q440 Cluster: ENSANGP00000021850; n=1; Anopheles gamb...    34   2.5  
UniRef50_Q09443 Cluster: Actin-like protein C08B11.6; n=2; Caeno...    34   2.5  
UniRef50_UPI0000E46266 Cluster: PREDICTED: similar to actin; n=1...    34   3.3  
UniRef50_Q2J6P3 Cluster: Putative uncharacterized protein; n=2; ...    34   3.3  
UniRef50_Q9LZY1 Cluster: Actin-like protein; n=4; core eudicotyl...    34   3.3  
UniRef50_Q75BT7 Cluster: ACR184Cp; n=1; Eremothecium gossypii|Re...    34   3.3  
UniRef50_UPI0000F2D271 Cluster: PREDICTED: similar to actin-like...    33   4.4  
UniRef50_UPI0000E477BD Cluster: PREDICTED: similar to uncharacte...    33   4.4  
UniRef50_Q95XG3 Cluster: Putative uncharacterized protein; n=5; ...    33   4.4  
UniRef50_A5KAY0 Cluster: Actin-related protein, putative; n=1; P...    33   4.4  
UniRef50_A7EFN6 Cluster: Putative uncharacterized protein; n=1; ...    33   4.4  
UniRef50_Q5KAQ4 Cluster: Actin-like protein ARP6; n=1; Filobasid...    33   4.4  
UniRef50_UPI0000E4A0BF Cluster: PREDICTED: similar to Actin-rela...    33   5.8  
UniRef50_UPI0000E254E7 Cluster: PREDICTED: similar to putative c...    33   5.8  
UniRef50_UPI000069FC4E Cluster: Uncharacterized protein KIAA2032...    33   5.8  
UniRef50_Q0S0C2 Cluster: Putative uncharacterized protein; n=1; ...    33   5.8  
UniRef50_Q8SRZ3 Cluster: ACTIN-RELATED PROTEIN; n=1; Encephalito...    33   5.8  
UniRef50_Q2UQI4 Cluster: Predicted protein; n=1; Aspergillus ory...    33   5.8  
UniRef50_Q0UJ41 Cluster: Putative uncharacterized protein; n=1; ...    33   5.8  
UniRef50_Q8NK72 Cluster: DNA repair and recombination protein rh...    33   5.8  
UniRef50_A5E5Q2 Cluster: Putative uncharacterized protein; n=1; ...    33   7.6  

>UniRef50_Q4JSC0 Cluster: Actin; n=13; Coelomata|Rep: Actin -
           Anopheles gambiae (African malaria mosquito)
          Length = 376

 Score =  141 bits (342), Expect = 1e-32
 Identities = 76/142 (53%), Positives = 84/142 (59%)
 Frame = +3

Query: 66  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 245
           MCD++  ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMG KD+YVGDEAQ
Sbjct: 1   MCDDDAGALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGNKDAYVGDEAQ 60

Query: 246 SKRVXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSCVSPPRNTQSCLLRLPSTPRATERKM 425
           SKR                     +             P      L   P  P++   KM
Sbjct: 61  SKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKSNREKM 120

Query: 426 TQIMFETFNTPRHVRLAFKPVL 491
           TQIMFETF  P  V +A + VL
Sbjct: 121 TQIMFETFAAPA-VYVAIQAVL 141



 Score =  122 bits (295), Expect = 5e-27
 Identities = 52/58 (89%), Positives = 55/58 (94%)
 Frame = +2

Query: 248 QKSILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           ++ ILTLKYPIEHGI+TNWDDMEKIWHHTFYNELRVAPEEHPVLLTEA LNPK NREK
Sbjct: 62  KRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKSNREK 119


>UniRef50_O65314 Cluster: Actin; n=20; Eukaryota|Rep: Actin -
           Scherffelia dubia
          Length = 378

 Score =  136 bits (329), Expect = 4e-31
 Identities = 73/129 (56%), Positives = 77/129 (59%)
 Frame = +3

Query: 72  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 251
           D EV+ALV DNGSGM KAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKD+YVGDEAQSK
Sbjct: 5   DGEVSALVCDNGSGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDEAQSK 64

Query: 252 RVXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSCVSPPRNTQSCLLRLPSTPRATERKMTQ 431
           R                     +             P      L   P  P+A   KMTQ
Sbjct: 65  RGILTLKYPIEHGVVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQ 124

Query: 432 IMFETFNTP 458
           IMFETFN P
Sbjct: 125 IMFETFNVP 133



 Score =  121 bits (291), Expect = 2e-26
 Identities = 51/58 (87%), Positives = 55/58 (94%)
 Frame = +2

Query: 248 QKSILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           ++ ILTLKYPIEHG+V+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEA LNPK NREK
Sbjct: 64  KRGILTLKYPIEHGVVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK 121


>UniRef50_P02581 Cluster: Actin-1; n=1852; Eukaryota|Rep: Actin-1 -
           Glycine max (Soybean)
          Length = 377

 Score =  122 bits (293), Expect = 1e-26
 Identities = 53/58 (91%), Positives = 55/58 (94%)
 Frame = +2

Query: 248 QKSILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           Q+ ILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEA LNPK NREK
Sbjct: 63  QRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKYNREK 120



 Score =  108 bits (260), Expect = 1e-22
 Identities = 58/128 (45%), Positives = 68/128 (53%)
 Frame = +3

Query: 75  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKR 254
           E++  LV DNG+GM KAG AGDDAPRAVFPSIVGRPRH  V+VGMGQKD+YVGDEAQ +R
Sbjct: 5   EDIQPLVCDNGTGMVKAGLAGDDAPRAVFPSIVGRPRHTXVVVGMGQKDAYVGDEAQVQR 64

Query: 255 VXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSCVSPPRNTQSCLLRLPSTPRATERKMTQI 434
                                +             P      L   P  P+    KM ++
Sbjct: 65  GILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKYNREKMXRV 124

Query: 435 MFETFNTP 458
           MFETF  P
Sbjct: 125 MFETFGAP 132


>UniRef50_Q96483 Cluster: Actin-51; n=584; Eukaryota|Rep: Actin-51 -
           Solanum lycopersicum (Tomato) (Lycopersicon esculentum)
          Length = 336

 Score =  121 bits (292), Expect = 1e-26
 Identities = 52/58 (89%), Positives = 55/58 (94%)
 Frame = +2

Query: 248 QKSILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           ++ ILTLKYPIEHGIV+NWDDMEKIWHHTFYNELRVAPEEHPVLLTEA LNPK NREK
Sbjct: 43  KRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK 100



 Score =  106 bits (254), Expect = 5e-22
 Identities = 58/112 (51%), Positives = 61/112 (54%)
 Frame = +3

Query: 123 AGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRVXXXXXXXXXXXXXLT 302
           AGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKD+Y GDEAQSKR                
Sbjct: 1   AGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYDGDEAQSKRGILTLKYPIEHGIVSN 60

Query: 303 GMTWRRFGIIPSTMSCVSPPRNTQSCLLRLPSTPRATERKMTQIMFETFNTP 458
                +             P      L   P  P+A   KMTQIMFETFN P
Sbjct: 61  WDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNVP 112


>UniRef50_P14883 Cluster: Actin-2; n=75; Eukaryota|Rep: Actin-2 -
           Plasmodium falciparum
          Length = 376

 Score =  121 bits (291), Expect = 2e-26
 Identities = 52/58 (89%), Positives = 55/58 (94%)
 Frame = +2

Query: 248 QKSILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           ++ ILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRV+PEEHPVLLTEA LNPK NREK
Sbjct: 61  KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVSPEEHPVLLTEAPLNPKTNREK 118



 Score =  109 bits (262), Expect = 5e-23
 Identities = 58/128 (45%), Positives = 68/128 (53%)
 Frame = +3

Query: 75  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKR 254
           EE  ALVVDNGSGM K+G AGDDAP+ VFPSIVGRP+   +M+GM QK+ YVGDEAQ+KR
Sbjct: 3   EEAVALVVDNGSGMVKSGLAGDDAPKCVFPSIVGRPKMPNIMIGMEQKECYVGDEAQNKR 62

Query: 255 VXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSCVSPPRNTQSCLLRLPSTPRATERKMTQI 434
                                +             P      L   P  P+    KMTQI
Sbjct: 63  GILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVSPEEHPVLLTEAPLNPKTNREKMTQI 122

Query: 435 MFETFNTP 458
           MFETF+ P
Sbjct: 123 MFETFDVP 130


>UniRef50_A7RPC3 Cluster: Predicted protein; n=3; Eumetazoa|Rep:
           Predicted protein - Nematostella vectensis
          Length = 64

 Score = 97.9 bits (233), Expect = 2e-19
 Identities = 46/56 (82%), Positives = 48/56 (85%)
 Frame = +3

Query: 87  ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKR 254
           ALV+D GS M K GFAGDDAP+ VFP IVGRPRHQGVMVGMGQKDSYVG EA SKR
Sbjct: 1   ALVIDVGSHMWKVGFAGDDAPKGVFPPIVGRPRHQGVMVGMGQKDSYVGWEAHSKR 56


>UniRef50_Q7XB26 Cluster: Ubiquitin/actin fusion protein 4; n=1;
           Bigelowiella natans|Rep: Ubiquitin/actin fusion protein
           4 - Bigelowiella natans (Pedinomonas minutissima)
           (Chlorarachnion sp.(strain CCMP 621))
          Length = 234

 Score = 95.9 bits (228), Expect = 7e-19
 Identities = 42/58 (72%), Positives = 47/58 (81%)
 Frame = +2

Query: 248 QKSILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           ++ +L  KY IEHGIVT+WD M KIW HTF NEL+VAPEEHPVLLTE  LNPK NREK
Sbjct: 133 KRGVLINKYAIEHGIVTDWDAMLKIWDHTFLNELKVAPEEHPVLLTEPPLNPKANREK 190



 Score = 68.9 bits (161), Expect = 9e-11
 Identities = 45/128 (35%), Positives = 55/128 (42%)
 Frame = +3

Query: 75  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKR 254
           EE   LVVDNGS M KAGFAGD APR  FPS+   PR +  M   G++D Y+G    +KR
Sbjct: 78  EECQPLVVDNGSDMIKAGFAGDGAPRTAFPSVFKVPRVRNTMT--GKQDVYIG-SVNAKR 134

Query: 255 VXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSCVSPPRNTQSCLLRLPSTPRATERKMTQI 434
                                +             P      L   P  P+A   K  ++
Sbjct: 135 GVLINKYAIEHGIVTDWDAMLKIWDHTFLNELKVAPEEHPVLLTEPPLNPKANREKTIKV 194

Query: 435 MFETFNTP 458
           MFETF TP
Sbjct: 195 MFETFKTP 202


>UniRef50_Q0VHZ5 Cluster: Actin deviating protein; n=7;
           Eukaryota|Rep: Actin deviating protein - Bolivina sp.
           isolate 615
          Length = 360

 Score = 95.5 bits (227), Expect = 1e-18
 Identities = 37/58 (63%), Positives = 49/58 (84%)
 Frame = +2

Query: 248 QKSILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           ++ IL+L++PI HGI T+WDD+E+IW HTFY ELR+ PEEHP+L+TE  LNPK NR+K
Sbjct: 39  KRGILSLRWPIVHGISTSWDDVEEIWRHTFYQELRIQPEEHPILMTEPPLNPKANRQK 96



 Score = 87.4 bits (207), Expect = 3e-16
 Identities = 49/108 (45%), Positives = 55/108 (50%)
 Frame = +3

Query: 135 GDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRVXXXXXXXXXXXXXLTGMTW 314
           GDDAPRAVFP+I GR R  GVMVGM QK+ YVGDEAQSKR               +    
Sbjct: 1   GDDAPRAVFPAITGRRRRNGVMVGMAQKNCYVGDEAQSKRGILSLRWPIVHGISTSWDDV 60

Query: 315 RRFGIIPSTMSCVSPPRNTQSCLLRLPSTPRATERKMTQIMFETFNTP 458
                          P      +   P  P+A  +KMTQIMFETFNTP
Sbjct: 61  EEIWRHTFYQELRIQPEEHPILMTEPPLNPKANRQKMTQIMFETFNTP 108


>UniRef50_A2DKQ5 Cluster: Actin 58, putative; n=2; Trichomonas
           vaginalis G3|Rep: Actin 58, putative - Trichomonas
           vaginalis G3
          Length = 373

 Score = 94.7 bits (225), Expect = 2e-18
 Identities = 40/59 (67%), Positives = 50/59 (84%), Gaps = 1/59 (1%)
 Frame = +2

Query: 248 QKS-ILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           QKS +L L+ PIE+G ++NWDD+EKIWHHTFYNEL VAPEEHPV+L E  ++P+ NREK
Sbjct: 58  QKSDLLVLRQPIENGTISNWDDIEKIWHHTFYNELLVAPEEHPVILAEKPMSPRMNREK 116



 Score = 73.3 bits (172), Expect = 4e-12
 Identities = 42/121 (34%), Positives = 57/121 (47%)
 Frame = +3

Query: 90  LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRVXXXX 269
           +V+DNG+G+ KAGFAG +AP++VFP+I+G P+    MVG   KD +VG EA  K      
Sbjct: 6   IVIDNGTGLTKAGFAGAEAPKSVFPTIIGSPKSNMQMVGGQNKDFFVGFEAVQKSDLLVL 65

Query: 270 XXXXXXXXXLTGMTWRRFGIIPSTMSCVSPPRNTQSCLLRLPSTPRATERKMTQIMFETF 449
                           +          +  P      L   P +PR    K  Q+MFETF
Sbjct: 66  RQPIENGTISNWDDIEKIWHHTFYNELLVAPEEHPVILAEKPMSPRMNREKKIQMMFETF 125

Query: 450 N 452
           N
Sbjct: 126 N 126


>UniRef50_UPI0000F2D825 Cluster: PREDICTED: similar to actin; n=1;
           Monodelphis domestica|Rep: PREDICTED: similar to actin -
           Monodelphis domestica
          Length = 416

 Score = 93.9 bits (223), Expect = 3e-18
 Identities = 38/59 (64%), Positives = 47/59 (79%)
 Frame = +2

Query: 245 EQKSILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           E+ + L +KYPIEHGI+ NWDDMEKIWHH+FYN L V PE+HP+L+TE    PK N+EK
Sbjct: 104 EKWANLLVKYPIEHGIIVNWDDMEKIWHHSFYNVLHVDPEKHPLLVTEHLFTPKANKEK 162



 Score = 54.4 bits (125), Expect = 2e-06
 Identities = 32/127 (25%), Positives = 53/127 (41%)
 Frame = +3

Query: 78  EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRV 257
           E   ++ D GS   K G+ G+ +PR VFPS +G  R Q +  GM  +D+++G+E   K  
Sbjct: 48  ESLPVIFDGGSRYFKVGYGGEYSPRFVFPSAIGHYRWQNIKSGMDLRDTFIGNEVIEKWA 107

Query: 258 XXXXXXXXXXXXXLTGMTWRRFGIIPSTMSCVSPPRNTQSCLLRLPSTPRATERKMTQIM 437
                        +      +             P      +     TP+A + K+ ++M
Sbjct: 108 NLLVKYPIEHGIIVNWDDMEKIWHHSFYNVLHVDPEKHPLLVTEHLFTPKANKEKLIEVM 167

Query: 438 FETFNTP 458
           FE+F  P
Sbjct: 168 FESFRVP 174


>UniRef50_A5E2K2 Cluster: Actin; n=5; Saccharomycetales|Rep: Actin -
           Lodderomyces elongisporus (Yeast) (Saccharomyces
           elongisporus)
          Length = 417

 Score = 88.2 bits (209), Expect = 1e-16
 Identities = 34/59 (57%), Positives = 45/59 (76%)
 Frame = +2

Query: 245 EQKSILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           + + +L L YP+EHGIVT W DME IW H F  +L++ PE+HP+L+TEA LNP+ NREK
Sbjct: 73  KNRGLLRLNYPVEHGIVTKWSDMEIIWDHMFTQDLKIKPEDHPLLITEAPLNPRSNREK 131



 Score = 66.5 bits (155), Expect = 5e-10
 Identities = 47/137 (34%), Positives = 60/137 (43%), Gaps = 14/137 (10%)
 Frame = +3

Query: 90  LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVG-----------MGQKDSYVGD 236
           +VVDNG G  KAGFAG++ PR    SI+GRP++Q +M G               D +VGD
Sbjct: 10  VVVDNGLGTLKAGFAGEEKPRTYASSIIGRPKYQKLMAGSLTSSTSGSTIASDTDLFVGD 69

Query: 237 EAQSKRVXXXXXXXXXXXXXLTGMTWRRFGII---PSTMSCVSPPRNTQSCLLRLPSTPR 407
            AQ  R              +T   W    II     T      P +    +   P  PR
Sbjct: 70  AAQKNR-GLLRLNYPVEHGIVT--KWSDMEIIWDHMFTQDLKIKPEDHPLLITEAPLNPR 126

Query: 408 ATERKMTQIMFETFNTP 458
           +   KM Q+MFE FN P
Sbjct: 127 SNREKMCQVMFEQFNVP 143


>UniRef50_Q8MVN5 Cluster: Cardiac actin-like protein; n=1; Boltenia
           villosa|Rep: Cardiac actin-like protein - Boltenia
           villosa
          Length = 137

 Score = 87.8 bits (208), Expect = 2e-16
 Identities = 41/79 (51%), Positives = 50/79 (63%)
 Frame = +2

Query: 185 PSGRDGRYGTEGLLCRR*GTEQKSILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPE 364
           PSG  G    + ++  R  +  + I   K P+E  I+TNWD  EKIWHHT  NEL VAPE
Sbjct: 10  PSGVRGGRDRKTVMGYRTQSIGREICLSKIPLERXIITNWDXQEKIWHHTLNNELEVAPE 69

Query: 365 EHPVLLTEASLNPKGNREK 421
           EHP L T+A+ NPK NREK
Sbjct: 70  EHPTLFTKAAWNPKANREK 88


>UniRef50_UPI000065FC19 Cluster: Homolog of Homo sapiens "Actin,
           cytoplasmic 2; n=1; Takifugu rubripes|Rep: Homolog of
           Homo sapiens "Actin, cytoplasmic 2 - Takifugu rubripes
          Length = 396

 Score = 87.0 bits (206), Expect = 3e-16
 Identities = 35/57 (61%), Positives = 48/57 (84%)
 Frame = +2

Query: 251 KSILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           + +L LK+PI++GI+ NWD+MEKIWHHTF  ++RV PE+HPVLLTEA++NP  NR +
Sbjct: 56  RGVLALKHPIKNGIIQNWDEMEKIWHHTFL-QMRVDPEDHPVLLTEAAMNPLENRRR 111



 Score = 72.5 bits (170), Expect = 8e-12
 Identities = 40/125 (32%), Positives = 59/125 (47%), Gaps = 2/125 (1%)
 Frame = +3

Query: 90  LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRVXXXX 269
           +V+D GSG  KAGFA +D P  VFP+I+G P+++ +M G  ++++Y+G EAQ  R     
Sbjct: 2   IVLDTGSGFMKAGFADEDLPNVVFPTIIGMPKYEEIMNGRAERETYIGHEAQHMRGVLAL 61

Query: 270 XXXXXXXXXLTGMTWRRFGII--PSTMSCVSPPRNTQSCLLRLPSTPRATERKMTQIMFE 443
                         W     I   + +     P +    L      P    R+M +IMFE
Sbjct: 62  KHPIKNGII---QNWDEMEKIWHHTFLQMRVDPEDHPVLLTEAAMNPLENRRRMVEIMFE 118

Query: 444 TFNTP 458
            FN P
Sbjct: 119 CFNVP 123


>UniRef50_Q0VHZ6 Cluster: Actin deviating protein; n=2; Bolivina sp.
           isolate 615|Rep: Actin deviating protein - Bolivina sp.
           isolate 615
          Length = 387

 Score = 86.2 bits (204), Expect = 6e-16
 Identities = 34/58 (58%), Positives = 45/58 (77%)
 Frame = +2

Query: 248 QKSILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           ++ IL L +P++ G+V NWDDMEKIWHHT Y+ELRV PEEHP+L+T+     K +REK
Sbjct: 39  KRGILKLMHPMQRGVVKNWDDMEKIWHHTLYHELRVQPEEHPILMTDTPFASKMDREK 96



 Score = 72.5 bits (170), Expect = 8e-12
 Identities = 42/109 (38%), Positives = 51/109 (46%)
 Frame = +3

Query: 135 GDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRVXXXXXXXXXXXXXLTGMTW 314
           G DAPRAVFP+IVG  +H+G+ VGM QK  YVGDEAQSKR                    
Sbjct: 1   GVDAPRAVFPTIVGTLKHRGIFVGMAQKSYYVGDEAQSKRGILKLMHPMQRGVVKNWDDM 60

Query: 315 RRFGIIPSTMSCVSPPRNTQSCLLRLPSTPRATERKMTQIMFETFNTPR 461
            +             P      +   P   +    KM QIMFETF+TP+
Sbjct: 61  EKIWHHTLYHELRVQPEEHPILMTDTPFASKMDREKMAQIMFETFDTPK 109


>UniRef50_UPI0000F2D326 Cluster: PREDICTED: similar to actin; n=1;
           Monodelphis domestica|Rep: PREDICTED: similar to actin -
           Monodelphis domestica
          Length = 378

 Score = 85.4 bits (202), Expect = 1e-15
 Identities = 35/59 (59%), Positives = 46/59 (77%)
 Frame = +2

Query: 245 EQKSILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           + +SILTL +P++HG+VT+WDDMEKIW H + + LR  P++ PVLLTEA LNP  NR K
Sbjct: 64  DNRSILTLNHPMQHGVVTSWDDMEKIWEHLYKDGLRETPKQRPVLLTEAPLNPPENRAK 122



 Score = 61.7 bits (143), Expect = 1e-08
 Identities = 35/127 (27%), Positives = 51/127 (40%)
 Frame = +3

Query: 78  EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRV 257
           ++ + + DNGSG+CK G +G+  PR +  +++G P+    M    QK  YVG EAQ  R 
Sbjct: 8   KIPSAIFDNGSGLCKVGISGEQNPRFIQATVLGYPQSINSMANTWQKAYYVGQEAQDNRS 67

Query: 258 XXXXXXXXXXXXXLTGMTWRRFGIIPSTMSCVSPPRNTQSCLLRLPSTPRATERKMTQIM 437
                         +     +             P+     L   P  P     KM +I 
Sbjct: 68  ILTLNHPMQHGVVTSWDDMEKIWEHLYKDGLRETPKQRPVLLTEAPLNPPENRAKMVEIF 127

Query: 438 FETFNTP 458
           FETF  P
Sbjct: 128 FETFQVP 134


>UniRef50_UPI0000E466A7 Cluster: PREDICTED: similar to actin, alpha
           1, skeletal muscle; n=1; Strongylocentrotus
           purpuratus|Rep: PREDICTED: similar to actin, alpha 1,
           skeletal muscle - Strongylocentrotus purpuratus
          Length = 258

 Score = 84.6 bits (200), Expect = 2e-15
 Identities = 35/58 (60%), Positives = 45/58 (77%)
 Frame = +2

Query: 248 QKSILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           ++ +L++KYPIE GIVTNW+DME IWHHTFYNELRV P+E  V  T+   + K +REK
Sbjct: 20  KRGLLSIKYPIERGIVTNWEDMETIWHHTFYNELRVDPKELLVFFTDVPKSTKASREK 77


>UniRef50_Q2GY63 Cluster: Putative uncharacterized protein; n=1;
           Chaetomium globosum|Rep: Putative uncharacterized
           protein - Chaetomium globosum (Soil fungus)
          Length = 350

 Score = 83.8 bits (198), Expect = 3e-15
 Identities = 34/58 (58%), Positives = 46/58 (79%)
 Frame = +2

Query: 245 EQKSILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNRE 418
           E + +L ++YP+EHGIVT+WDDMEKIW H  Y+EL+   E+HP+LLTE  LNP+ NR+
Sbjct: 63  ELRGLLKIRYPLEHGIVTDWDDMEKIWSHV-YSELKCDAEQHPLLLTEPPLNPRSNRD 119



 Score = 64.5 bits (150), Expect = 2e-09
 Identities = 39/126 (30%), Positives = 61/126 (48%), Gaps = 2/126 (1%)
 Frame = +3

Query: 87  ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRVXXX 266
           A+V+DNGSG  +AG++G+  P+  FPS VGRP+H  V+ G  + + +VG +A ++     
Sbjct: 9   AVVLDNGSGNIRAGYSGESEPKVNFPSWVGRPKHLRVLAGALEGEVFVGKKAAAELRGLL 68

Query: 267 XXXXXXXXXXLTGM--TWRRFGIIPSTMSCVSPPRNTQSCLLRLPSTPRATERKMTQIMF 440
                     +T      + +  + S + C          L   P  PR+      QI+F
Sbjct: 69  KIRYPLEHGIVTDWDDMEKIWSHVYSELKC--DAEQHPLLLTEPPLNPRSNRDTAAQILF 126

Query: 441 ETFNTP 458
           ETFN P
Sbjct: 127 ETFNVP 132


>UniRef50_UPI0000449751 Cluster: PREDICTED: similar to gamma-actin;
           n=3; Amniota|Rep: PREDICTED: similar to gamma-actin -
           Gallus gallus
          Length = 377

 Score = 83.4 bits (197), Expect = 4e-15
 Identities = 45/123 (36%), Positives = 60/123 (48%)
 Frame = +3

Query: 90  LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRVXXXX 269
           +V DNGSG CKAG +G+ APR+V P+IVG P+   VM+GM  +D YVG+EAQSKR     
Sbjct: 12  VVFDNGSGQCKAGLSGEQAPRSVIPTIVGYPKFTFVMIGMEHRDWYVGEEAQSKRGILSL 71

Query: 270 XXXXXXXXXLTGMTWRRFGIIPSTMSCVSPPRNTQSCLLRLPSTPRATERKMTQIMFETF 449
                     +     +             P      L   P  P +   KM ++MFE+F
Sbjct: 72  TYPMENGVVTSWDNMEKIWRYLYEHELGVKPSEGPVLLTETPLNPPSHREKMAELMFESF 131

Query: 450 NTP 458
             P
Sbjct: 132 QVP 134



 Score = 79.0 bits (186), Expect = 9e-14
 Identities = 33/58 (56%), Positives = 45/58 (77%)
 Frame = +2

Query: 248 QKSILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           ++ IL+L YP+E+G+VT+WD+MEKIW + + +EL V P E PVLLTE  LNP  +REK
Sbjct: 65  KRGILSLTYPMENGVVTSWDNMEKIWRYLYEHELGVKPSEGPVLLTETPLNPPSHREK 122


>UniRef50_A4QNT8 Cluster: Si:ch211-241j12.3 protein; n=3; Danio
           rerio|Rep: Si:ch211-241j12.3 protein - Danio rerio
           (Zebrafish) (Brachydanio rerio)
          Length = 389

 Score = 83.0 bits (196), Expect = 5e-15
 Identities = 34/57 (59%), Positives = 45/57 (78%)
 Frame = +2

Query: 251 KSILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           + +LTL+YPI HG+V+NWD+ME +W H F   L  APE+HPVLLTEA+LNP  NR++
Sbjct: 79  RGVLTLRYPIRHGVVSNWDEMEMLWTHAF-QLLSAAPEDHPVLLTEAALNPLQNRQR 134



 Score = 66.1 bits (154), Expect = 7e-10
 Identities = 37/125 (29%), Positives = 60/125 (48%), Gaps = 2/125 (1%)
 Frame = +3

Query: 90  LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRVXXXX 269
           +V+D+GSG+ KAGFA  D P AVFP+++GRP+++ VM     ++ YVG +AQ  R     
Sbjct: 25  IVLDSGSGLMKAGFADQDLPAAVFPTVIGRPKYEEVMNSCVDRELYVGHDAQHMRGVLTL 84

Query: 270 XXXXXXXXXLTGMTWRRFGII--PSTMSCVSPPRNTQSCLLRLPSTPRATERKMTQIMFE 443
                         W    ++   +     + P +    L      P    ++M ++MFE
Sbjct: 85  RYPIRHGVV---SNWDEMEMLWTHAFQLLSAAPEDHPVLLTEAALNPLQNRQRMVELMFE 141

Query: 444 TFNTP 458
            F+ P
Sbjct: 142 AFSVP 146


>UniRef50_Q7M3B0 Cluster: Actin beta; n=1; Sus scrofa domestica|Rep:
           Actin beta - Sus scrofa domestica (domestic pig)
          Length = 195

 Score = 83.0 bits (196), Expect = 5e-15
 Identities = 36/50 (72%), Positives = 39/50 (78%)
 Frame = +2

Query: 254 SILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNP 403
           SI+   YPIEHGIVTNWDDMEKIWHHTFYNELRVAPEE   ++ E    P
Sbjct: 15  SIVGRPYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEMTQIMFETFNTP 64



 Score = 46.4 bits (105), Expect = 6e-04
 Identities = 20/20 (100%), Positives = 20/20 (100%)
 Frame = +3

Query: 123 AGFAGDDAPRAVFPSIVGRP 182
           AGFAGDDAPRAVFPSIVGRP
Sbjct: 1   AGFAGDDAPRAVFPSIVGRP 20


>UniRef50_A7QKV4 Cluster: Chromosome chr8 scaffold_115, whole genome
           shotgun sequence; n=1; Vitis vinifera|Rep: Chromosome
           chr8 scaffold_115, whole genome shotgun sequence - Vitis
           vinifera (Grape)
          Length = 431

 Score = 79.8 bits (188), Expect = 5e-14
 Identities = 39/59 (66%), Positives = 43/59 (72%), Gaps = 1/59 (1%)
 Frame = +2

Query: 248 QKSILTLKYPIEHGIVTNWDDMEK-IWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           +K +LTLKYP + GIV NWDD  K IWHHTFY EL VAPE H VLLTE  LN K N +K
Sbjct: 33  KKDMLTLKYPTKSGIVGNWDDKGKTIWHHTFYIELCVAPEAHLVLLTEVLLNLKVNHDK 91



 Score = 33.1 bits (72), Expect = 5.8
 Identities = 30/87 (34%), Positives = 38/87 (43%), Gaps = 5/87 (5%)
 Frame = +3

Query: 213 QKDSYVGDEAQSKR----VXXXXXXXXXXXXXLTGMT-WRRFGIIPSTMSCVSPPRNTQS 377
           QKD+YV DEAQSK+    +               G T W     I     CV+P  +   
Sbjct: 21  QKDAYVEDEAQSKKDMLTLKYPTKSGIVGNWDDKGKTIWHHTFYIEL---CVAPEAHLV- 76

Query: 378 CLLRLPSTPRATERKMTQIMFETFNTP 458
            L  +    +    KMTQ MFETF+TP
Sbjct: 77  LLTEVLLNLKVNHDKMTQSMFETFSTP 103


>UniRef50_UPI0000605B09 Cluster: PREDICTED: similar to actin alpha 1
           skeletal muscle protein; n=1; Mus musculus|Rep:
           PREDICTED: similar to actin alpha 1 skeletal muscle
           protein - Mus musculus
          Length = 255

 Score = 79.4 bits (187), Expect = 7e-14
 Identities = 42/127 (33%), Positives = 61/127 (48%)
 Frame = +3

Query: 78  EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRV 257
           E   LV D GSG  K GF+G  AP+AVFP+I+G+ +H  V+ G+G++D ++G E Q+ R 
Sbjct: 2   EKTPLVCDYGSGFSKVGFSGTQAPQAVFPTILGKMKHTNVLEGLGEQDWFIGAETQTNRT 61

Query: 258 XXXXXXXXXXXXXLTGMTWRRFGIIPSTMSCVSPPRNTQSCLLRLPSTPRATERKMTQIM 437
                               +        S    P      +   P T +  + +MTQI+
Sbjct: 62  ELNMYYPISRGAITNWDNVEKIWHYSFYHSLQIAPEQHPILITEAPLTSKEAKSRMTQIL 121

Query: 438 FETFNTP 458
           FETFN P
Sbjct: 122 FETFNFP 128



 Score = 77.0 bits (181), Expect = 4e-13
 Identities = 28/49 (57%), Positives = 40/49 (81%)
 Frame = +2

Query: 260 LTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPK 406
           L + YPI  G +TNWD++EKIWH++FY+ L++APE+HP+L+TEA L  K
Sbjct: 63  LNMYYPISRGAITNWDNVEKIWHYSFYHSLQIAPEQHPILITEAPLTSK 111


>UniRef50_UPI00001E426E Cluster: PREDICTED: similar to actin-12;
           n=11; Eutheria|Rep: PREDICTED: similar to actin-12 - Mus
           musculus
          Length = 372

 Score = 79.4 bits (187), Expect = 7e-14
 Identities = 42/127 (33%), Positives = 61/127 (48%)
 Frame = +3

Query: 78  EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRV 257
           E   LV D GSG  K GF+G  AP+AVFP+I+G+ +H  V+ G+G++D ++G E Q+ R 
Sbjct: 2   EKTPLVCDYGSGFSKVGFSGTQAPQAVFPTILGKMKHTNVLEGLGEQDWFIGAETQTNRT 61

Query: 258 XXXXXXXXXXXXXLTGMTWRRFGIIPSTMSCVSPPRNTQSCLLRLPSTPRATERKMTQIM 437
                               +        S    P      +   P T +  + +MTQI+
Sbjct: 62  ELNMYYPISRGAITNWDNVEKIWHYSFYHSLQIAPEQHPILITEAPLTSKEAKSRMTQIL 121

Query: 438 FETFNTP 458
           FETFN P
Sbjct: 122 FETFNFP 128



 Score = 77.0 bits (181), Expect = 4e-13
 Identities = 28/49 (57%), Positives = 40/49 (81%)
 Frame = +2

Query: 260 LTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPK 406
           L + YPI  G +TNWD++EKIWH++FY+ L++APE+HP+L+TEA L  K
Sbjct: 63  LNMYYPISRGAITNWDNVEKIWHYSFYHSLQIAPEQHPILITEAPLTSK 111


>UniRef50_P61163 Cluster: Alpha-centractin; n=356; root|Rep:
           Alpha-centractin - Homo sapiens (Human)
          Length = 376

 Score = 79.4 bits (187), Expect = 7e-14
 Identities = 32/60 (53%), Positives = 48/60 (80%), Gaps = 1/60 (1%)
 Frame = +2

Query: 245 EQKSILTLKYPIEHGIVTNWDDMEKIWHHTF-YNELRVAPEEHPVLLTEASLNPKGNREK 421
           E + +L+++YP+EHGIV +W+DME+IW + +  ++L+   EEHPVLLTEA LNP+ NRE+
Sbjct: 64  EHRGLLSIRYPMEHGIVKDWNDMERIWQYVYSKDQLQTFSEEHPVLLTEAPLNPRKNRER 123



 Score = 71.7 bits (168), Expect = 1e-11
 Identities = 40/124 (32%), Positives = 57/124 (45%), Gaps = 1/124 (0%)
 Frame = +3

Query: 90  LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRVXXXX 269
           +V+DNGSG+ KAGFAGD  P+  FP+ VGRP+H  VM G  + D ++G +A+  R     
Sbjct: 12  VVIDNGSGVIKAGFAGDQIPKYCFPNYVGRPKHVRVMAGALEGDIFIGPKAEEHRGLLSI 71

Query: 270 XXXXXXXXXLTGMTWRR-FGIIPSTMSCVSPPRNTQSCLLRLPSTPRATERKMTQIMFET 446
                           R +  + S     +        L   P  PR    +  ++ FET
Sbjct: 72  RYPMEHGIVKDWNDMERIWQYVYSKDQLQTFSEEHPVLLTEAPLNPRKNRERAAEVFFET 131

Query: 447 FNTP 458
           FN P
Sbjct: 132 FNVP 135


>UniRef50_A2FRF9 Cluster: Actin family protein; n=1; Trichomonas
           vaginalis G3|Rep: Actin family protein - Trichomonas
           vaginalis G3
          Length = 543

 Score = 78.6 bits (185), Expect = 1e-13
 Identities = 28/58 (48%), Positives = 43/58 (74%)
 Frame = +2

Query: 248 QKSILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           +  ++ +  PIE+G++ NWDD+EK+WHHT+YNEL V P++HPV++TE     +  REK
Sbjct: 59  KSDLVDISKPIENGVIVNWDDIEKVWHHTYYNELLVVPDQHPVIITEKQCATQHAREK 116



 Score = 50.8 bits (116), Expect = 3e-05
 Identities = 22/54 (40%), Positives = 33/54 (61%)
 Frame = +3

Query: 90  LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 251
           +V+D GSG  K GFAG   P+  FP++VG P+    ++G    D +VG+E  +K
Sbjct: 6   VVIDTGSGFTKVGFAGYYEPKVEFPTVVGVPKDSTALIGGKNVDFFVGNEVFTK 59


>UniRef50_UPI0000588EB0 Cluster: PREDICTED: similar to actin; n=1;
           Strongylocentrotus purpuratus|Rep: PREDICTED: similar to
           actin - Strongylocentrotus purpuratus
          Length = 386

 Score = 77.4 bits (182), Expect = 3e-13
 Identities = 49/129 (37%), Positives = 72/129 (55%), Gaps = 6/129 (4%)
 Frame = +3

Query: 90  LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQK----DSYVGDEAQSKRV 257
           +V+D+GS   +AGFA +D PR VF SIVGRPRHQ V+  +  K    DSYVG+EAQ++R 
Sbjct: 14  MVIDHGSFEIQAGFAEEDCPRTVFQSIVGRPRHQEVLDDLTTKLNFRDSYVGEEAQNRR- 72

Query: 258 XXXXXXXXXXXXXLTGMTWRRFGIIPS-TMSCVS-PPRNTQSCLLRLPSTPRATERKMTQ 431
                        +T   W     + S T S +   P++  + L ++P+ P+  + KM +
Sbjct: 73  GVLTLTYPIERGIIT--KWDDMEAVWSHTFSEIKFNPQDEGAVLSQIPNNPKPNKEKMAE 130

Query: 432 IMFETFNTP 458
           I FE F +P
Sbjct: 131 IFFEKFQSP 139



 Score = 70.5 bits (165), Expect = 3e-11
 Identities = 28/58 (48%), Positives = 42/58 (72%)
 Frame = +2

Query: 248 QKSILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           ++ +LTL YPIE GI+T WDDME +W HTF +E++  P++   +L++   NPK N+EK
Sbjct: 71  RRGVLTLTYPIERGIITKWDDMEAVWSHTF-SEIKFNPQDEGAVLSQIPNNPKPNKEK 127


>UniRef50_UPI00005864C8 Cluster: PREDICTED: similar to Actin; n=4;
           Strongylocentrotus purpuratus|Rep: PREDICTED: similar to
           Actin - Strongylocentrotus purpuratus
          Length = 383

 Score = 76.2 bits (179), Expect = 6e-13
 Identities = 32/59 (54%), Positives = 42/59 (71%)
 Frame = +2

Query: 245 EQKSILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           + + +L + YPIEHGIV +W+DMEKIWH+ F  +L V   EHPVL+TE   NP  NR+K
Sbjct: 61  KHREVLGINYPIEHGIVKDWEDMEKIWHYLFDVDLMVDTTEHPVLMTEPPGNPMYNRQK 119



 Score = 54.8 bits (126), Expect = 2e-06
 Identities = 36/129 (27%), Positives = 53/129 (41%)
 Frame = +3

Query: 72  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 251
           D+    +VVDNGSG  +AGFAG    RA FPS +GR +   V    G++++++G+     
Sbjct: 6   DDGPDPVVVDNGSGTIQAGFAGGKTCRATFPSCIGRSKKSHV---DGKREAFIGEAIYKH 62

Query: 252 RVXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSCVSPPRNTQSCLLRLPSTPRATERKMTQ 431
           R                     +       +  +         +   P  P    +KM Q
Sbjct: 63  REVLGINYPIEHGIVKDWEDMEKIWHYLFDVDLMVDTTEHPVLMTEPPGNPMYNRQKMAQ 122

Query: 432 IMFETFNTP 458
           IMFETF  P
Sbjct: 123 IMFETFQIP 131


>UniRef50_UPI0000E23780 Cluster: PREDICTED: hypothetical protein
           isoform 2; n=2; Amniota|Rep: PREDICTED: hypothetical
           protein isoform 2 - Pan troglodytes
          Length = 179

 Score = 75.4 bits (177), Expect = 1e-12
 Identities = 34/57 (59%), Positives = 43/57 (75%)
 Frame = -1

Query: 418 LSVALGVEGSLSKQDWVFLGGDTQLIVEGMMPNLLHVIPVSDDSVFDGVFEGQDTLL 248
           L V LGV+G L +QD V LG  TQL+VEG++P+LLHV+PV DD+V  GV +GQD  L
Sbjct: 57  LVVGLGVQGCLGQQDGVLLGSHTQLVVEGVVPDLLHVVPVGDDAVLHGVLQGQDASL 113



 Score = 58.0 bits (134), Expect = 2e-07
 Identities = 31/73 (42%), Positives = 41/73 (56%)
 Frame = -3

Query: 266 GSGYSFALCLISYIRVLLSHTDHHALMAGPSHDRGEHGARSIISCETGLAHTGAIVYYQR 87
           G   S AL LI++I + L H  HHAL+ G  HD  E     II+C+ GLAH  A+V    
Sbjct: 108 GQDASLALGLIAHIGLHLMHAPHHALVPGAPHDGREDSPGGIITCKAGLAHARAVVNDGH 167

Query: 86  GNFFVAHLELVKL 48
           G   + H EL++L
Sbjct: 168 GGIII-HGELIQL 179


>UniRef50_Q4CV94 Cluster: Actin 2, putative; n=2; Trypanosoma
           cruzi|Rep: Actin 2, putative - Trypanosoma cruzi
          Length = 392

 Score = 75.4 bits (177), Expect = 1e-12
 Identities = 34/58 (58%), Positives = 41/58 (70%)
 Frame = +2

Query: 248 QKSILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           Q+  L   YP+EHGIV++WD ME++W H  Y +LRV PE   VLLTEA LNP  NREK
Sbjct: 64  QEKGLRYFYPMEHGIVSDWDQMERVWRHA-YEQLRVPPERQAVLLTEAPLNPISNREK 120



 Score = 63.7 bits (148), Expect = 4e-09
 Identities = 44/137 (32%), Positives = 60/137 (43%), Gaps = 4/137 (2%)
 Frame = +3

Query: 75  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA-QSK 251
           +E  A+V+DNGSG  K GFAG++ PR VFPS+ G   +         +  YVGDEA Q K
Sbjct: 7   DEEPAVVLDNGSGNIKCGFAGEEIPRCVFPSVTGVSMNTRSSGSSSSQRVYVGDEALQEK 66

Query: 252 RVXXXXXXXXXXXXXLTGM--TWRRFGIIPSTMSCVSPPRNTQSCLLRLPSTPRATERKM 425
            +                M   WR      +      PP      L   P  P +   KM
Sbjct: 67  GLRYFYPMEHGIVSDWDQMERVWRH-----AYEQLRVPPERQAVLLTEAPLNPISNREKM 121

Query: 426 TQIMFETFNTPR-HVRL 473
            + +FE+F  P  HV++
Sbjct: 122 AETLFESFGVPALHVQI 138


>UniRef50_Q9XZB9 Cluster: Actin; n=1; Sterkiella nova|Rep: Actin -
           Oxytricha nova
          Length = 374

 Score = 72.9 bits (171), Expect = 6e-12
 Identities = 27/58 (46%), Positives = 42/58 (72%)
 Frame = +2

Query: 248 QKSILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           ++ +L   YP++HGI+ +WDDMEK+W+H F  EL+V   EHP L++E+ L P+  RE+
Sbjct: 60  KRGVLKFSYPVQHGIIKDWDDMEKVWNHLFSYELKVDSSEHPFLISESPLTPEFIREQ 117



 Score = 70.9 bits (166), Expect = 2e-11
 Identities = 38/128 (29%), Positives = 57/128 (44%)
 Frame = +3

Query: 75  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKR 254
           E    +V+DNGSG  KAGF G+D P  V  ++VGRP++Q  ++G+  KD ++G++A  KR
Sbjct: 2   ESSKTIVIDNGSGFVKAGFVGEDGPSVVLRNLVGRPKNQNAIIGVEAKDEFIGEDAYLKR 61

Query: 255 VXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSCVSPPRNTQSCLLRLPSTPRATERKMTQI 434
                                +      +             +   P TP     +  Q+
Sbjct: 62  GVLKFSYPVQHGIIKDWDDMEKVWNHLFSYELKVDSSEHPFLISESPLTPEFIREQTVQM 121

Query: 435 MFETFNTP 458
           MFETFN P
Sbjct: 122 MFETFNVP 129


>UniRef50_Q24C02 Cluster: Actin family protein; n=3;
           Oligohymenophorea|Rep: Actin family protein -
           Tetrahymena thermophila SB210
          Length = 398

 Score = 72.5 bits (170), Expect = 8e-12
 Identities = 33/79 (41%), Positives = 52/79 (65%)
 Frame = +2

Query: 245 EQKSILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREKD 424
           EQ+ +L L+YPI HGI+ NW+DM+ IW +  Y+EL+V+ +E+PVLLTE ++NP  ++ + 
Sbjct: 65  EQRGLLKLQYPINHGIIQNWNDMDLIWKYC-YSELKVSAKEYPVLLTEPAINPINHKFRV 123

Query: 425 DPDHVRNI*HAPPCTFGIQ 481
                 N  +AP     +Q
Sbjct: 124 AQQFFENF-NAPALFIAVQ 141



 Score = 52.4 bits (120), Expect = 9e-06
 Identities = 22/55 (40%), Positives = 37/55 (67%)
 Frame = +3

Query: 90  LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKR 254
           +V+DNGSG+ +AG AG+D  +  F S +GRP+++ V+    Q D Y+G+ +  +R
Sbjct: 13  VVIDNGSGIIRAGIAGEDKAKLQFDSYIGRPKYKMVLPTNTQSDYYLGNISDEQR 67


>UniRef50_UPI00005A2ACF Cluster: PREDICTED: similar to cytoplasmic
           beta-actin; n=1; Canis lupus familiaris|Rep: PREDICTED:
           similar to cytoplasmic beta-actin - Canis familiaris
          Length = 268

 Score = 72.1 bits (169), Expect = 1e-11
 Identities = 36/54 (66%), Positives = 39/54 (72%)
 Frame = +2

Query: 257 ILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNRE 418
           ILT KY IEHGIV NWDDME I HH FYN+L +APEE  +LLTE  LN K   E
Sbjct: 118 ILTFKYCIEHGIVINWDDME-IQHHNFYNKLCMAPEELYILLTEIPLNLKAKGE 170



 Score = 44.8 bits (101), Expect = 0.002
 Identities = 36/101 (35%), Positives = 46/101 (45%), Gaps = 2/101 (1%)
 Frame = +3

Query: 195 VMVGMGQKDSYVGDEAQSKRVXXXXXXXXXXXXXLTGMTWRRFGIIPSTM--SCVSPPRN 368
           +MVGMGQKDSY+ +EAQ K               +    W    I            P  
Sbjct: 97  IMVGMGQKDSYIRNEAQRKWGILTFKYCIEHGIVI---NWDDMEIQHHNFYNKLCMAPEE 153

Query: 369 TQSCLLRLPSTPRATERKMTQIMFETFNTPRHVRLAFKPVL 491
               L  +P   +A + +MTQIMFETFNTP  + LA + VL
Sbjct: 154 LYILLTEIPLNLKA-KGEMTQIMFETFNTPA-MYLAIQTVL 192


>UniRef50_Q55DY5 Cluster: Putative uncharacterized protein; n=1;
           Dictyostelium discoideum AX4|Rep: Putative
           uncharacterized protein - Dictyostelium discoideum AX4
          Length = 355

 Score = 71.7 bits (168), Expect = 1e-11
 Identities = 35/77 (45%), Positives = 46/77 (59%)
 Frame = +2

Query: 191 GRDGRYGTEGLLCRR*GTEQKSILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEH 370
           G   + G   L   +    + S   L YPI++GIV NW+DMEK   +TFY +LRV P+ H
Sbjct: 34  GHPNKQGDTKLFYGKEAVARFSTSKLVYPIKNGIVCNWEDMEKFIENTFYYKLRVEPQYH 93

Query: 371 PVLLTEASLNPKGNREK 421
            VLLTE ++N K NR K
Sbjct: 94  SVLLTETTMNTKENRNK 110



 Score = 35.1 bits (77), Expect = 1.4
 Identities = 15/35 (42%), Positives = 20/35 (57%)
 Frame = +3

Query: 90  LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQG 194
           +++D GSG  K GF G+  P     +IVG P  QG
Sbjct: 6   IIIDFGSGWTKCGFEGEVTPSVECLTIVGHPNKQG 40


>UniRef50_Q0J646 Cluster: Os08g0369300 protein; n=2; Oryza sativa
           (japonica cultivar-group)|Rep: Os08g0369300 protein -
           Oryza sativa subsp. japonica (Rice)
          Length = 495

 Score = 71.3 bits (167), Expect = 2e-11
 Identities = 30/54 (55%), Positives = 38/54 (70%)
 Frame = +2

Query: 260 LTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           L + YP+ +GIV +WDDM  IW H FY+EL+V P E  +LLT+  LNP  NREK
Sbjct: 66  LDVSYPVTNGIVQSWDDMGHIWDHAFYSELKVDPSECKILLTDPPLNPVKNREK 119



 Score = 45.6 bits (103), Expect = 0.001
 Identities = 18/31 (58%), Positives = 24/31 (77%)
 Frame = +3

Query: 90  LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRP 182
           +V DNG+G  K GFAG++ P +VFP +VGRP
Sbjct: 7   VVCDNGTGYVKCGFAGENFPTSVFPCVVGRP 37


>UniRef50_A2YUL5 Cluster: Putative uncharacterized protein; n=1;
           Oryza sativa (indica cultivar-group)|Rep: Putative
           uncharacterized protein - Oryza sativa subsp. indica
           (Rice)
          Length = 367

 Score = 71.3 bits (167), Expect = 2e-11
 Identities = 30/54 (55%), Positives = 38/54 (70%)
 Frame = +2

Query: 260 LTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           L + YP+ +GIV +WDDM  IW H FY+EL+V P E  +LLT+  LNP  NREK
Sbjct: 66  LDVSYPVTNGIVQSWDDMGHIWDHAFYSELKVDPSECKILLTDPPLNPVKNREK 119



 Score = 45.6 bits (103), Expect = 0.001
 Identities = 18/31 (58%), Positives = 24/31 (77%)
 Frame = +3

Query: 90  LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRP 182
           +V DNG+G  K GFAG++ P +VFP +VGRP
Sbjct: 7   VVCDNGTGYVKCGFAGENFPTSVFPCVVGRP 37


>UniRef50_Q4N681 Cluster: Actin, putative; n=3; Piroplasmida|Rep:
           Actin, putative - Theileria parva
          Length = 380

 Score = 71.3 bits (167), Expect = 2e-11
 Identities = 29/48 (60%), Positives = 36/48 (75%)
 Frame = +2

Query: 275 PIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNRE 418
           P++HGIV NW   E +W HTF NEL+++ EEHPVLLTE  L PK +RE
Sbjct: 75  PVQHGIVRNWALAESVWRHTFTNELKISQEEHPVLLTEPPLTPKLHRE 122



 Score = 46.4 bits (105), Expect = 6e-04
 Identities = 37/137 (27%), Positives = 54/137 (39%), Gaps = 9/137 (6%)
 Frame = +3

Query: 75  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQ---------GVMVGMGQKDSY 227
           +E  AL++D GS + KAGFAG + P+  FP++V    +Q         GV+  + + +S 
Sbjct: 3   DETLALIIDTGSAVTKAGFAGSETPKVRFPTLVAIDGNQESDDPLVGNGVLEKLDKLNSN 62

Query: 228 VGDEAQSKRVXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSCVSPPRNTQSCLLRLPSTPR 407
              E  S  V             L    WR        +S    P      L   P TP+
Sbjct: 63  KSQELASFEVYRPVQHGIVRNWALAESVWRHTFTNELKISQEEHP----VLLTEPPLTPK 118

Query: 408 ATERKMTQIMFETFNTP 458
                  Q+ FE+F  P
Sbjct: 119 LHRELCCQLFFESFGVP 135


>UniRef50_UPI00015B6274 Cluster: PREDICTED: similar to putative mRNA
           splicing factor; n=1; Nasonia vitripennis|Rep:
           PREDICTED: similar to putative mRNA splicing factor -
           Nasonia vitripennis
          Length = 515

 Score = 70.9 bits (166), Expect = 2e-11
 Identities = 34/57 (59%), Positives = 43/57 (75%)
 Frame = -1

Query: 418 LSVALGVEGSLSKQDWVFLGGDTQLIVEGMMPNLLHVIPVSDDSVFDGVFEGQDTLL 248
           LSV L VE SL +++ +FL GD QL+VEG+MP+LLHVIPV D SV D +F  +DT L
Sbjct: 383 LSVGLRVERSLGEENGMFLWGDAQLVVEGVMPDLLHVIPVGDYSVLDRIFNREDTAL 439



 Score = 52.0 bits (119), Expect = 1e-05
 Identities = 28/73 (38%), Positives = 44/73 (60%), Gaps = 10/73 (13%)
 Frame = -3

Query: 254 SFALCLISYIRVLLSHTDHHAL----------MAGPSHDRGEHGARSIISCETGLAHTGA 105
           +  L L++Y+ VLL+H DH AL          +AGP+ D  + G+R +++ ET LAH+ +
Sbjct: 438 ALGLGLVAYVGVLLAHADHDALWIKSMVDTHLIAGPADDGWKDGSRRVVAGETSLAHSRS 497

Query: 104 IVYYQRGNFFVAH 66
           IV ++ G   VAH
Sbjct: 498 IVNHESGYVVVAH 510


>UniRef50_Q38F20 Cluster: Actin-like protein 3, putative; n=1;
           Trypanosoma brucei|Rep: Actin-like protein 3, putative -
           Trypanosoma brucei
          Length = 416

 Score = 70.5 bits (165), Expect = 3e-11
 Identities = 31/55 (56%), Positives = 36/55 (65%)
 Frame = +2

Query: 254 SILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNRE 418
           S   L +PI+HGIV +WD ME+IW H  Y  LRV PEEH  +LTE   NP  NRE
Sbjct: 63  SSCNLYHPIKHGIVEDWDKMERIWQHCVYKYLRVDPEEHGFILTEPPANPPENRE 117



 Score = 36.7 bits (81), Expect = 0.47
 Identities = 21/56 (37%), Positives = 30/56 (53%), Gaps = 5/56 (8%)
 Frame = +3

Query: 90  LVVDNGSGMCKAGFAGDDAPRAVFPSI-----VGRPRHQGVMVGMGQKDSYVGDEA 242
           +V+DNG+G  K G+AG++ P  + P+        R R   V   +   D YVGDEA
Sbjct: 6   VVIDNGTGYTKMGYAGNEEPTYIIPTAYADNEASRRRSHDVFSDL---DFYVGDEA 58


>UniRef50_Q8TDY3 Cluster: Actin-related protein T2; n=26;
           Amniota|Rep: Actin-related protein T2 - Homo sapiens
           (Human)
          Length = 377

 Score = 70.1 bits (164), Expect = 4e-11
 Identities = 29/58 (50%), Positives = 39/58 (67%)
 Frame = +2

Query: 248 QKSILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           ++  L L  P E G++T WDD+E++W H F  EL V P + P+L TE SLNP+ NREK
Sbjct: 65  KQEALQLHSPFERGLITGWDDVERLWKHLFEWELGVKPSDQPLLATEPSLNPRENREK 122



 Score = 59.3 bits (137), Expect = 8e-08
 Identities = 43/127 (33%), Positives = 58/127 (45%), Gaps = 3/127 (2%)
 Frame = +3

Query: 87  ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRVXXX 266
           A++ DNGSG CKAG +G+  PR +  SIVG  + Q       QK  +VG+EA  K+    
Sbjct: 11  AVIFDNGSGFCKAGLSGEFGPRHMVSSIVGHLKFQAPSAEANQKKYFVGEEALYKQ-EAL 69

Query: 267 XXXXXXXXXXLTGM--TWRRFGIIPSTMSCVSPPRNTQSCLLRLPS-TPRATERKMTQIM 437
                     +TG     R +  +      V P  + Q  L   PS  PR    KM ++M
Sbjct: 70  QLHSPFERGLITGWDDVERLWKHLFEWELGVKP--SDQPLLATEPSLNPRENREKMAEVM 127

Query: 438 FETFNTP 458
           FE F  P
Sbjct: 128 FENFGVP 134


>UniRef50_UPI00006C1719 Cluster: PREDICTED: similar to actin, alpha
           2, smooth muscle, aorta; n=3; Homo/Pan/Gorilla
           group|Rep: PREDICTED: similar to actin, alpha 2, smooth
           muscle, aorta - Homo sapiens
          Length = 183

 Score = 69.3 bits (162), Expect = 7e-11
 Identities = 29/35 (82%), Positives = 32/35 (91%)
 Frame = +2

Query: 257 ILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAP 361
           ILTLKYPIE G+VTN DDMEKIWHHTFYN+LR+ P
Sbjct: 18  ILTLKYPIEQGMVTNRDDMEKIWHHTFYNKLRLHP 52



 Score = 35.1 bits (77), Expect = 1.4
 Identities = 15/15 (100%), Positives = 15/15 (100%)
 Frame = +3

Query: 207 MGQKDSYVGDEAQSK 251
           MGQKDSYVGDEAQSK
Sbjct: 1   MGQKDSYVGDEAQSK 15


>UniRef50_Q5KB93 Cluster: Actin binding protein, putative; n=3;
           Filobasidiella neoformans|Rep: Actin binding protein,
           putative - Cryptococcus neoformans (Filobasidiella
           neoformans)
          Length = 390

 Score = 69.3 bits (162), Expect = 7e-11
 Identities = 26/59 (44%), Positives = 40/59 (67%)
 Frame = +2

Query: 245 EQKSILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           E +S L + +P+EHG+V NW+DM  +W +TF  ++ + P    +LLTE  +NPK NR+K
Sbjct: 61  ENRSYLQVTHPMEHGVVKNWEDMRHLWDYTFNEKMHMDPRGKKILLTEPPMNPKANRQK 119



 Score = 64.5 bits (150), Expect = 2e-09
 Identities = 42/122 (34%), Positives = 53/122 (43%), Gaps = 2/122 (1%)
 Frame = +3

Query: 90  LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRP-RHQGVMVGMGQ-KDSYVGDEAQSKRVXX 263
           LVVDNG+G  K G+AG + P  VFPSIVGRP       +G  Q KD  +GDEA   R   
Sbjct: 7   LVVDNGTGFVKCGWAGSNFPDYVFPSIVGRPILRAEERLGTSQLKDIMIGDEAAENRSYL 66

Query: 264 XXXXXXXXXXXLTGMTWRRFGIIPSTMSCVSPPRNTQSCLLRLPSTPRATERKMTQIMFE 443
                            R              PR  +  L   P  P+A  +KM ++MFE
Sbjct: 67  QVTHPMEHGVVKNWEDMRHLWDYTFNEKMHMDPRGKKILLTEPPMNPKANRQKMCEVMFE 126

Query: 444 TF 449
            +
Sbjct: 127 EY 128


>UniRef50_UPI0000D9A391 Cluster: PREDICTED: actin related protein M1
           isoform 1; n=1; Macaca mulatta|Rep: PREDICTED: actin
           related protein M1 isoform 1 - Macaca mulatta
          Length = 319

 Score = 68.9 bits (161), Expect = 9e-11
 Identities = 26/57 (45%), Positives = 42/57 (73%)
 Frame = +2

Query: 251 KSILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           +S L++ YP+E G++T+WDDME +W H +   L++ P + PVL+TE +LNP  NR++
Sbjct: 124 RSSLSISYPVERGLITSWDDMEIMWKHIYDYNLKLKPCDGPVLITEPALNPLANRQQ 180



 Score = 50.4 bits (115), Expect = 4e-05
 Identities = 24/55 (43%), Positives = 35/55 (63%)
 Frame = +3

Query: 90  LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKR 254
           +V+DNGSG+ KAG AG   P+ ++P+I+GR + Q      G  +  VGD+AQ  R
Sbjct: 71  VVIDNGSGVIKAGLAGSREPQFIYPNIIGRAKGQS-RAAPGGLELCVGDQAQDWR 124


>UniRef50_Q55DS6 Cluster: Putative uncharacterized protein; n=1;
           Dictyostelium discoideum AX4|Rep: Putative
           uncharacterized protein - Dictyostelium discoideum AX4
          Length = 392

 Score = 67.7 bits (158), Expect = 2e-10
 Identities = 25/58 (43%), Positives = 45/58 (77%)
 Frame = +2

Query: 248 QKSILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           QK+ +++K+PIE G + NWDDMEK+ +++F+  L ++ +E+P+L+T++  N K NRE+
Sbjct: 70  QKTNISIKHPIERGSIINWDDMEKLLNYSFHQVLNISCDEYPILITDSPFNSKMNRER 127



 Score = 44.0 bits (99), Expect = 0.003
 Identities = 30/132 (22%), Positives = 64/132 (48%), Gaps = 4/132 (3%)
 Frame = +3

Query: 72  DEEVA-ALVVDNGSGMCKAGFAGDD-APRAVFPSIVGRPRHQGVMVGM-GQKDSYVGDEA 242
           +EE+  ++++D GSG  K GF+ ++  PR  FP+I+GR ++  V+ G   +K  + G E 
Sbjct: 8   NEEIRNSVIIDCGSGFTKVGFSNEELTPRNEFPTIIGRTKYYEVLYGAPNKKVIFAGHEV 67

Query: 243 QSKRVXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSCVSPPRNTQSCLLR-LPSTPRATER 419
           ++++              +      +  +  S    ++   +    L+   P   +    
Sbjct: 68  ETQKTNISIKHPIERGSIINWDDMEKL-LNYSFHQVLNISCDEYPILITDSPFNSKMNRE 126

Query: 420 KMTQIMFETFNT 455
           ++TQ++FET+N+
Sbjct: 127 RLTQLLFETYNS 138


>UniRef50_Q9BYD9 Cluster: Actin-related protein M1; n=12;
           Theria|Rep: Actin-related protein M1 - Homo sapiens
           (Human)
          Length = 372

 Score = 66.9 bits (156), Expect = 4e-10
 Identities = 31/83 (37%), Positives = 50/83 (60%)
 Frame = +2

Query: 173 GKAPPSGRDGRYGTEGLLCRR*GTEQKSILTLKYPIEHGIVTNWDDMEKIWHHTFYNELR 352
           G+A    R  + G E L       + +S L + YP+E G++T+W+DME +W H +   L+
Sbjct: 36  GRAKGQSRAAQGGLE-LCVGDQAQDWRSSLFISYPVERGLITSWEDMEIMWKHIYDYNLK 94

Query: 353 VAPEEHPVLLTEASLNPKGNREK 421
           + P + PVL+TE +LNP  NR++
Sbjct: 95  LKPCDGPVLITEPALNPLANRQQ 117



 Score = 51.2 bits (117), Expect = 2e-05
 Identities = 25/55 (45%), Positives = 35/55 (63%)
 Frame = +3

Query: 90  LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKR 254
           +V+DNGSGM KAG AG   P+ ++P+I+GR + Q      G  +  VGD+AQ  R
Sbjct: 8   VVIDNGSGMIKAGVAGCREPQFIYPNIIGRAKGQS-RAAQGGLELCVGDQAQDWR 61


>UniRef50_Q54UQ7 Cluster: Actin-like protein 6A; n=1; Dictyostelium
           discoideum AX4|Rep: Actin-like protein 6A -
           Dictyostelium discoideum AX4
          Length = 440

 Score = 66.5 bits (155), Expect = 5e-10
 Identities = 25/49 (51%), Positives = 34/49 (69%)
 Frame = +2

Query: 275 PIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           P+  G++ NWD ME+IW+HTFY  L + P EHP+LL E + N +  REK
Sbjct: 86  PLSDGLIKNWDAMEQIWNHTFYERLHINPIEHPILLAEPTYNTRAIREK 134



 Score = 49.2 bits (112), Expect = 8e-05
 Identities = 22/61 (36%), Positives = 41/61 (67%), Gaps = 1/61 (1%)
 Frame = +3

Query: 75  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRP-RHQGVMVGMGQKDSYVGDEAQSK 251
           ++V+A+V+D G+   K G+AG+D+P+AVFP+ +G   +++   VG G  +    D+++ K
Sbjct: 5   DDVSAIVIDVGTFSTKGGYAGEDSPKAVFPTDIGVVYKNENETVGTGDSEMGEKDDSEPK 64

Query: 252 R 254
           R
Sbjct: 65  R 65


>UniRef50_Q4QG59 Cluster: Actin-like protein, putative; n=3;
           Leishmania|Rep: Actin-like protein, putative -
           Leishmania major
          Length = 483

 Score = 66.5 bits (155), Expect = 5e-10
 Identities = 26/58 (44%), Positives = 39/58 (67%)
 Frame = +2

Query: 248 QKSILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           ++ IL + +PI +G + +W D+EK+W H F+NELRV+PE H  LLT+    P   RE+
Sbjct: 63  KQGILDVHHPIRNGFINDWGDVEKLWSHLFFNELRVSPETHCFLLTQPVNTPAAQRER 120



 Score = 56.8 bits (131), Expect = 4e-07
 Identities = 40/125 (32%), Positives = 60/125 (48%), Gaps = 2/125 (1%)
 Frame = +3

Query: 84  AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKR-VX 260
           AA+V+D GS   +AGF G+  PR   P++VG PRH+ + +  G  +  VG+EA  K+ + 
Sbjct: 8   AAVVLDCGSFHSRAGFGGEKGPRLDVPTLVGYPRHRSIAMAAGMNEQEVGEEALLKQGIL 67

Query: 261 XXXXXXXXXXXXLTGMTWRRFGIIPSTMSCVSPPRNTQSCLLRLP-STPRATERKMTQIM 437
                         G   + +  +      VSP   T   LL  P +TP A   +  +IM
Sbjct: 68  DVHHPIRNGFINDWGDVEKLWSHLFFNELRVSP--ETHCFLLTQPVNTPAAQRERTLEIM 125

Query: 438 FETFN 452
            ETF+
Sbjct: 126 METFH 130


>UniRef50_A2FH22 Cluster: Actin family protein; n=1; Trichomonas
           vaginalis G3|Rep: Actin family protein - Trichomonas
           vaginalis G3
          Length = 390

 Score = 66.5 bits (155), Expect = 5e-10
 Identities = 27/57 (47%), Positives = 39/57 (68%)
 Frame = +2

Query: 251 KSILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           +  L L  P+EHGIV NW+D   +  + F  +L++  E+HP+L+TEA LNPK NR+K
Sbjct: 62  RQYLDLTLPVEHGIVKNWEDEALVLDYVFKEKLKIRNEDHPLLITEAPLNPKDNRKK 118


>UniRef50_UPI0000449ED3 Cluster: PREDICTED: similar to RIKEN cDNA
           4921517D21 gene; n=2; Gallus gallus|Rep: PREDICTED:
           similar to RIKEN cDNA 4921517D21 gene - Gallus gallus
          Length = 321

 Score = 65.7 bits (153), Expect = 9e-10
 Identities = 27/48 (56%), Positives = 36/48 (75%)
 Frame = +2

Query: 278 IEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           + HG+VT+WD +E++WH  FY+EL V PEE  VL T+A L+P  NREK
Sbjct: 48  LTHGVVTDWDRLEELWHRIFYHELAVCPEELAVLATDAPLSPIINREK 95



 Score = 37.1 bits (82), Expect = 0.35
 Identities = 14/31 (45%), Positives = 23/31 (74%)
 Frame = +3

Query: 75  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPS 167
           +++ A+V+D G G  ++G AGD+ PR+V PS
Sbjct: 10  KDLCAVVIDTGMGHTRSGLAGDERPRSVAPS 40


>UniRef50_Q9Y615 Cluster: Actin-like protein 7A; n=11; Mammalia|Rep:
           Actin-like protein 7A - Homo sapiens (Human)
          Length = 435

 Score = 65.3 bits (152), Expect = 1e-09
 Identities = 25/54 (46%), Positives = 38/54 (70%)
 Frame = +2

Query: 260 LTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           L L  P+ HGI+ +WD ++ IW + F  E+++APEEH VL+++  L+P  NREK
Sbjct: 129 LKLVNPLRHGIIVDWDTVQDIWEYLFRQEMKIAPEEHAVLVSDPPLSPHTNREK 182



 Score = 54.4 bits (125), Expect = 2e-06
 Identities = 34/128 (26%), Positives = 51/128 (39%)
 Frame = +3

Query: 75  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKR 254
           E   A+VVD G+G CK GFAG   P     + VG+P  +    G  +K+++VG E  +  
Sbjct: 67  EVTKAVVVDLGTGYCKCGFAGLPRPTHKISTTVGKPYMETAKTGDNRKETFVGQELNNTN 126

Query: 255 VXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSCVSPPRNTQSCLLRLPSTPRATERKMTQI 434
           V             +   T +              P      +   P +P     K  ++
Sbjct: 127 VHLKLVNPLRHGIIVDWDTVQDIWEYLFRQEMKIAPEEHAVLVSDPPLSPHTNREKYAEM 186

Query: 435 MFETFNTP 458
           +FE FNTP
Sbjct: 187 LFEAFNTP 194


>UniRef50_P61160 Cluster: Actin-related protein 2; n=96;
           Eukaryota|Rep: Actin-related protein 2 - Homo sapiens
           (Human)
          Length = 394

 Score = 64.1 bits (149), Expect = 3e-09
 Identities = 29/61 (47%), Positives = 41/61 (67%), Gaps = 1/61 (1%)
 Frame = +2

Query: 242 TEQKSILTLKYPIEHGIVTNWDDMEKIWHHTFYNE-LRVAPEEHPVLLTEASLNPKGNRE 418
           +E +S+L + YP+E+GIV NWDDM+ +W +TF  E L +      +LLTE  +NP  NRE
Sbjct: 62  SELRSMLEVNYPMENGIVRNWDDMKHLWDYTFGPEKLNIDTRNCKILLTEPPMNPTKNRE 121

Query: 419 K 421
           K
Sbjct: 122 K 122



 Score = 52.4 bits (120), Expect = 9e-06
 Identities = 36/125 (28%), Positives = 54/125 (43%), Gaps = 5/125 (4%)
 Frame = +3

Query: 90  LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRP--RHQGVMVGMGQKDSYVGDEAQSKRVXX 263
           +V DNG+G  K G+AG + P  +FP++VGRP  R    +  +  KD  VGDEA   R   
Sbjct: 9   VVCDNGTGFVKCGYAGSNFPEHIFPALVGRPIIRSTTKVGNIEIKDLMVGDEASELRSML 68

Query: 264 XXXXXXXXXXXLTGMTWRR---FGIIPSTMSCVSPPRNTQSCLLRLPSTPRATERKMTQI 434
                            +    +   P  ++     RN +  L   P  P     K+ ++
Sbjct: 69  EVNYPMENGIVRNWDDMKHLWDYTFGPEKLNI--DTRNCKILLTEPPMNPTKNREKIVEV 126

Query: 435 MFETF 449
           MFET+
Sbjct: 127 MFETY 131


>UniRef50_Q6BG22 Cluster: Actin, putative; n=2; Paramecium
           tetraurelia|Rep: Actin, putative - Paramecium
           tetraurelia
          Length = 370

 Score = 62.5 bits (145), Expect = 8e-09
 Identities = 24/50 (48%), Positives = 37/50 (74%)
 Frame = +2

Query: 272 YPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           YPI++G + +W+ +E+IW + F  +L+++P  HPVLLTEA  N K N+EK
Sbjct: 63  YPIQNGQIMDWESIEQIWRYIFEVQLKISPSNHPVLLTEAPCNSKINQEK 112


>UniRef50_A0CQQ2 Cluster: Chromosome undetermined scaffold_24, whole
           genome shotgun sequence; n=7; Oligohymenophorea|Rep:
           Chromosome undetermined scaffold_24, whole genome
           shotgun sequence - Paramecium tetraurelia
          Length = 869

 Score = 62.1 bits (144), Expect = 1e-08
 Identities = 25/49 (51%), Positives = 33/49 (67%)
 Frame = +2

Query: 272 YPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNRE 418
           YP++ GIV NWD MEK WH + ++ LR  P+E   +LTE  +NP  NRE
Sbjct: 80  YPMKSGIVENWDLMEKFWHRSIFDYLRAEPDETTFILTEPPMNPPENRE 128



 Score = 39.5 bits (88), Expect = 0.066
 Identities = 35/128 (27%), Positives = 49/128 (38%), Gaps = 8/128 (6%)
 Frame = +3

Query: 93  VVDNGSGMCKAGFAGDDAPRAVFPSIVG-RPRHQGVMVGMGQK---DSYVGDEA----QS 248
           V+DNG+G  K G+AG+  P+   P++V      Q V +        D Y+G EA    +S
Sbjct: 16  VIDNGTGFTKMGWAGNTEPQFDIPTVVADHQEKQKVQMSKNTNENLDYYIGYEAYDYTKS 75

Query: 249 KRVXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSCVSPPRNTQSCLLRLPSTPRATERKMT 428
             +             L    W R  I        + P  T   L   P  P      + 
Sbjct: 76  HNIFYPMKSGIVENWDLMEKFWHR-SIFDYLR---AEPDETTFILTEPPMNPPENRENIA 131

Query: 429 QIMFETFN 452
           +I FETFN
Sbjct: 132 EIFFETFN 139


>UniRef50_Q9Y614 Cluster: Actin-like protein 7B; n=12; Theria|Rep:
           Actin-like protein 7B - Homo sapiens (Human)
          Length = 415

 Score = 62.1 bits (144), Expect = 1e-08
 Identities = 24/54 (44%), Positives = 37/54 (68%)
 Frame = +2

Query: 260 LTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           L L  P++HGIV +WD ++ IW + F   +++ PEEH VL+++  L+P  NREK
Sbjct: 109 LKLVNPLKHGIVVDWDCVQDIWEYIFRTAMKILPEEHAVLVSDPPLSPSSNREK 162



 Score = 39.5 bits (88), Expect = 0.066
 Identities = 34/132 (25%), Positives = 54/132 (40%), Gaps = 5/132 (3%)
 Frame = +3

Query: 78  EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVG-----DEA 242
           ++ A+++D GS  CK G+AG+  P     S VG+   +    G  +K + VG      EA
Sbjct: 48  KIKAVIIDLGSQYCKCGYAGEPRPTYFISSTVGKRCPEAADAGDTRKWTLVGHELLNTEA 107

Query: 243 QSKRVXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSCVSPPRNTQSCLLRLPSTPRATERK 422
             K V             +  + W    I  + M  +  P      +   P +P +   K
Sbjct: 108 PLKLVNPLKHGIVVDWDCVQDI-WEY--IFRTAMKIL--PEEHAVLVSDPPLSPSSNREK 162

Query: 423 MTQIMFETFNTP 458
             ++MFETF  P
Sbjct: 163 YAELMFETFGIP 174


>UniRef50_Q54JL1 Cluster: Putative uncharacterized protein; n=1;
           Dictyostelium discoideum AX4|Rep: Putative
           uncharacterized protein - Dictyostelium discoideum AX4
          Length = 414

 Score = 61.3 bits (142), Expect = 2e-08
 Identities = 27/54 (50%), Positives = 36/54 (66%)
 Frame = +2

Query: 260 LTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           L+L  P++ GIV+NW+DMEKI+    Y E +VAPEE  +LLTE  L  K +  K
Sbjct: 64  LSLTCPMKRGIVSNWEDMEKIYSRLLYYEFKVAPEESDILLTEPPLTSKNDHNK 117


>UniRef50_O96819 Cluster: Actin-related protein; n=5;
           Trypanosoma|Rep: Actin-related protein - Trypanosoma
           brucei
          Length = 433

 Score = 61.3 bits (142), Expect = 2e-08
 Identities = 24/58 (41%), Positives = 38/58 (65%)
 Frame = +2

Query: 248 QKSILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           ++ +LT+  PIE G V +W++MEK+W H  Y+ELRV PE H  ++ ++   P   +EK
Sbjct: 64  KRGMLTVSSPIESGRVVSWENMEKLWGHVMYSELRVRPESHCFIVPQSVNTPASQKEK 121



 Score = 58.0 bits (134), Expect = 2e-07
 Identities = 28/64 (43%), Positives = 40/64 (62%), Gaps = 1/64 (1%)
 Frame = +3

Query: 66  MCDEEVAALVV-DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA 242
           +C  E A +V+ D GS   +AG+A D APR   P++VG PR++GV V  G  +  +GD A
Sbjct: 2   VCSTERAPVVILDGGSHHLRAGYASDGAPRLDIPALVGHPRNRGVAVAAGMNEYEIGDVA 61

Query: 243 QSKR 254
            +KR
Sbjct: 62  LAKR 65


>UniRef50_Q9DFB8 Cluster: Actin; n=1; Scomberomorus maculatus|Rep:
           Actin - Scomberomorus maculatus (Spanish mackerel)
          Length = 101

 Score = 60.9 bits (141), Expect = 3e-08
 Identities = 26/43 (60%), Positives = 31/43 (72%)
 Frame = +1

Query: 250 KEYPDPQIPHRTRNRH*LG*HGEDLASYLLQ*AACRPRGTPSP 378
           K +PDP++ HR R+ H LG HGEDLA +LLQ AAC PR  P P
Sbjct: 26  KRHPDPEVSHRARHHHQLGRHGEDLAPHLLQRAACGPRRAPHP 68


>UniRef50_A5B4L4 Cluster: Putative uncharacterized protein; n=1;
           Vitis vinifera|Rep: Putative uncharacterized protein -
           Vitis vinifera (Grape)
          Length = 571

 Score = 60.5 bits (140), Expect = 3e-08
 Identities = 27/59 (45%), Positives = 33/59 (55%)
 Frame = +2

Query: 242 TEQKSILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNRE 418
           +   S   L YPI HG V NWD ME+ W    +N LR  PE+H  LLTE+ L    +RE
Sbjct: 135 SRNSSTYNLSYPIVHGQVDNWDAMERFWQQCIFNYLRCDPEDHYFLLTESPLTAPESRE 193


>UniRef50_UPI0001554F81 Cluster: PREDICTED: similar to actin; n=1;
           Ornithorhynchus anatinus|Rep: PREDICTED: similar to
           actin - Ornithorhynchus anatinus
          Length = 376

 Score = 60.1 bits (139), Expect = 4e-08
 Identities = 24/54 (44%), Positives = 37/54 (68%)
 Frame = +2

Query: 260 LTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           L L +P+  G+VT+WD+ME++W + F  +L   P +HPVLLTE+  N   +R+K
Sbjct: 67  LALTFPVTRGVVTDWDEMERLWGYVF-QKLHARPTKHPVLLTESPKNRAADRDK 119



 Score = 58.8 bits (136), Expect = 1e-07
 Identities = 42/133 (31%), Positives = 61/133 (45%), Gaps = 7/133 (5%)
 Frame = +3

Query: 81  VAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRVX 260
           +  LV+DNG+G+CKAGFAGD+AP+ V P+ VG       M   G ++  +    ++ R  
Sbjct: 1   MTTLVIDNGTGLCKAGFAGDNAPKLVVPTAVGIQISPDNMTASGLQNRNILTGWETSRSL 60

Query: 261 XXXXXXXXXXXXLT-GMT--W----RRFGIIPSTMSCVSPPRNTQSCLLRLPSTPRATER 419
                       +T G+   W    R +G +   +   + P      L   P    A   
Sbjct: 61  LEPGPTLALTFPVTRGVVTDWDEMERLWGYVFQKLH--ARPTKHPVLLTESPKNRAADRD 118

Query: 420 KMTQIMFETFNTP 458
           K+ QIMFETFN P
Sbjct: 119 KLLQIMFETFNVP 131


>UniRef50_Q4SGD5 Cluster: Chromosome 17 SCAF14597, whole genome
           shotgun sequence; n=1; Tetraodon nigroviridis|Rep:
           Chromosome 17 SCAF14597, whole genome shotgun sequence -
           Tetraodon nigroviridis (Green puffer)
          Length = 425

 Score = 58.8 bits (136), Expect = 1e-07
 Identities = 26/55 (47%), Positives = 36/55 (65%), Gaps = 1/55 (1%)
 Frame = +2

Query: 260 LTLKYPIEHGIVTNWDDMEKIWHHTFYNE-LRVAPEEHPVLLTEASLNPKGNREK 421
           + + YP+E+GIV NWDDM+ +W +TF  E L +      +LLTE  +NP  NREK
Sbjct: 52  IKVNYPMENGIVRNWDDMKHLWDYTFGPEKLNIDSRNCKILLTEPPMNPTKNREK 106



 Score = 43.2 bits (97), Expect = 0.005
 Identities = 16/31 (51%), Positives = 23/31 (74%)
 Frame = +3

Query: 90  LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRP 182
           +V DNG+G  K G+AG + P  +FP++VGRP
Sbjct: 9   VVCDNGTGFVKCGYAGSNFPEHIFPALVGRP 39


>UniRef50_A2DNQ0 Cluster: Actin family protein; n=1; Trichomonas
           vaginalis G3|Rep: Actin family protein - Trichomonas
           vaginalis G3
          Length = 358

 Score = 58.8 bits (136), Expect = 1e-07
 Identities = 21/53 (39%), Positives = 39/53 (73%)
 Frame = +2

Query: 263 TLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           T + PIE+ ++TN+D+M++IW   F  +L++ PE+HP L+ +++LN   NR++
Sbjct: 56  TFRSPIENRVITNFDNMKRIWQELFTEQLQIQPEQHPFLVADSALNSLENRQQ 108



 Score = 33.5 bits (73), Expect = 4.4
 Identities = 14/26 (53%), Positives = 17/26 (65%)
 Frame = +3

Query: 90  LVVDNGSGMCKAGFAGDDAPRAVFPS 167
           +V+D G  + KAGF GD  P  VFPS
Sbjct: 6   IVLDCGGSIIKAGFGGDSEPGIVFPS 31


>UniRef50_A2DBN6 Cluster: Actin family protein; n=1; Trichomonas
           vaginalis G3|Rep: Actin family protein - Trichomonas
           vaginalis G3
          Length = 373

 Score = 58.8 bits (136), Expect = 1e-07
 Identities = 27/59 (45%), Positives = 35/59 (59%)
 Frame = +2

Query: 245 EQKSILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           EQ   L LK PI   +++N D++E  W H F  EL +   EHPVL+TE+  N K  REK
Sbjct: 59  EQSKNLNLKCPISDRVISNIDEIEVFWQHIFSKELNINTSEHPVLMTESPQNTKIMREK 117



 Score = 54.8 bits (126), Expect = 2e-06
 Identities = 39/135 (28%), Positives = 61/135 (45%), Gaps = 6/135 (4%)
 Frame = +3

Query: 78  EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRH-QGVMVGMGQKDSYVGDEA--QS 248
           EV+ +V+D G+   +AGF GD  P+ + P+++GR +  Q     +  KD YVG E   QS
Sbjct: 2   EVSTIVIDTGAYSTRAGFGGDSDPQCILPTVIGRLKSPQDKAAAIATKDIYVGSEVFEQS 61

Query: 249 KRVXXXXXXXXXXXXXLTGMT--WRR-FGIIPSTMSCVSPPRNTQSCLLRLPSTPRATER 419
           K +             +  +   W+  F    +  +   P   T+S     P   +    
Sbjct: 62  KNLNLKCPISDRVISNIDEIEVFWQHIFSKELNINTSEHPVLMTES-----PQNTKIMRE 116

Query: 420 KMTQIMFETFNTPRH 464
           K+TQIM ETF  P +
Sbjct: 117 KVTQIMMETFKVPAY 131


>UniRef50_Q6X960 Cluster: HSD21; n=13; Theria|Rep: HSD21 - Homo
           sapiens (Human)
          Length = 416

 Score = 58.8 bits (136), Expect = 1e-07
 Identities = 25/54 (46%), Positives = 34/54 (62%)
 Frame = +2

Query: 260 LTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           LTL  P+  GIV +WD  E IW H   ++LRVA  +HP+L ++   +P  NREK
Sbjct: 108 LTLVQPLRSGIVVDWDAAELIWRHLLEHDLRVATHDHPLLSSDPPFSPATNREK 161



 Score = 39.5 bits (88), Expect = 0.066
 Identities = 17/56 (30%), Positives = 30/56 (53%)
 Frame = +3

Query: 78  EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 245
           +  A+V+D G+G CK GFAG  +P     +I+G    +    G     +++G+ A+
Sbjct: 48  KTGAVVIDMGTGTCKVGFAGQASPTYTVATILGCQPKKPATSGQSGLQTFIGEAAR 103


>UniRef50_A2YQV6 Cluster: Putative uncharacterized protein; n=1;
           Oryza sativa (indica cultivar-group)|Rep: Putative
           uncharacterized protein - Oryza sativa subsp. indica
           (Rice)
          Length = 581

 Score = 58.0 bits (134), Expect = 2e-07
 Identities = 24/58 (41%), Positives = 35/58 (60%)
 Frame = +2

Query: 245 EQKSILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNRE 418
           +   + T K+PI HG V +WD ME+ W    +N LR  PEEH  LLT++ ++   +RE
Sbjct: 380 KSSGLYTRKHPINHGQVDDWDTMERFWQQCIFNYLRCNPEEHYFLLTDSPVSTPESRE 437


>UniRef50_Q14BL3 Cluster: RIKEN cDNA 4921517D21 gene; n=7;
            Eutheria|Rep: RIKEN cDNA 4921517D21 gene - Mus musculus
            (Mouse)
          Length = 1207

 Score = 57.6 bits (133), Expect = 2e-07
 Identities = 21/48 (43%), Positives = 35/48 (72%)
 Frame = +2

Query: 278  IEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
            +  G+V++WD +E +W H FY +L+V PEE  VL+ ++ ++P+ NREK
Sbjct: 914  LNRGVVSDWDALEVLWQHLFYCKLKVQPEEMAVLVADSPISPRTNREK 961


>UniRef50_A3BPG0 Cluster: Putative uncharacterized protein; n=3;
           Oryza sativa|Rep: Putative uncharacterized protein -
           Oryza sativa subsp. japonica (Rice)
          Length = 467

 Score = 57.6 bits (133), Expect = 2e-07
 Identities = 23/49 (46%), Positives = 32/49 (65%)
 Frame = +2

Query: 275 PIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           P++ G VT+WD ++ IW+H F   L + PEEHP+L+ E S N    REK
Sbjct: 122 PMKDGTVTDWDIVDNIWNHAFRQRLLINPEEHPMLIAEPSTNTGQQREK 170



 Score = 52.0 bits (119), Expect = 1e-05
 Identities = 21/32 (65%), Positives = 28/32 (87%)
 Frame = +3

Query: 75  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSI 170
           +EV+A+V+D GS  CKAG+AGDD P+AVFPS+
Sbjct: 5   DEVSAIVIDVGSYSCKAGYAGDDTPKAVFPSL 36


>UniRef50_A0E1S8 Cluster: Chromosome undetermined scaffold_73, whole
           genome shotgun sequence; n=1; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_73,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 383

 Score = 57.6 bits (133), Expect = 2e-07
 Identities = 26/55 (47%), Positives = 36/55 (65%), Gaps = 1/55 (1%)
 Frame = +2

Query: 260 LTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPE-EHPVLLTEASLNPKGNREK 421
           L+LKYPI+ GI+ +WD +  I     +N+  +  E EHP+LLTE  +NP  NREK
Sbjct: 66  LSLKYPIQRGIINDWDGIIYINMILIWNQFGIMQESEHPILLTEVPINPNANREK 120



 Score = 54.8 bits (126), Expect = 2e-06
 Identities = 41/136 (30%), Positives = 60/136 (44%), Gaps = 2/136 (1%)
 Frame = +3

Query: 90  LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKR--VXX 263
           +V+DNGS   KAGF G  AP    P++VGRP+ +        +D Y G+EA +K   +  
Sbjct: 11  IVIDNGSYELKAGFQGHYAPSCRIPTVVGRPKLENSDEDF--EDQYFGEEAMAKANALSL 68

Query: 264 XXXXXXXXXXXLTGMTWRRFGIIPSTMSCVSPPRNTQSCLLRLPSTPRATERKMTQIMFE 443
                        G+ +    +I +    +    +    L  +P  P A   K  QI+FE
Sbjct: 69  KYPIQRGIINDWDGIIYINMILIWNQFGIMQESEHP-ILLTEVPINPNANREKTMQILFE 127

Query: 444 TFNTPRHVRLAFKPVL 491
           TF  P  + L  K VL
Sbjct: 128 TFQAPL-ISLVNKAVL 142


>UniRef50_Q8LKR2 Cluster: Actin-related protein 4; n=7; core
           eudicotyledons|Rep: Actin-related protein 4 -
           Arabidopsis thaliana (Mouse-ear cress)
          Length = 442

 Score = 57.2 bits (132), Expect = 3e-07
 Identities = 24/49 (48%), Positives = 33/49 (67%)
 Frame = +2

Query: 275 PIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           PI+ GIV++WD ++ IW H F + L + P EHP+LL E  LN +  REK
Sbjct: 95  PIKDGIVSDWDLVDNIWEHAFKSCLMIDPTEHPMLLAEPPLNTQQQREK 143



 Score = 56.8 bits (131), Expect = 4e-07
 Identities = 23/34 (67%), Positives = 31/34 (91%)
 Frame = +3

Query: 75  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVG 176
           +EV+A+VVD GS  CKAG+AG+DAP+AVFPS++G
Sbjct: 6   DEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSVIG 39


>UniRef50_Q4QF44 Cluster: Actin-related protein 3, putative; n=3;
           Leishmania|Rep: Actin-related protein 3, putative -
           Leishmania major
          Length = 405

 Score = 57.2 bits (132), Expect = 3e-07
 Identities = 25/48 (52%), Positives = 32/48 (66%)
 Frame = +2

Query: 275 PIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNRE 418
           P+EHG+V NWD ME+ W H F   L V P++  VLLTEA++ P   RE
Sbjct: 68  PLEHGLVVNWDVMEEYWCHLFNRYLCVEPQDVGVLLTEAAVTPYEQRE 115


>UniRef50_P61158 Cluster: Actin-related protein 3; n=107;
           Eukaryota|Rep: Actin-related protein 3 - Homo sapiens
           (Human)
          Length = 418

 Score = 57.2 bits (132), Expect = 3e-07
 Identities = 26/57 (45%), Positives = 32/57 (56%)
 Frame = +2

Query: 248 QKSILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNRE 418
           +K     K+PI HGIV +WD ME+      +  LR  PE+H  LLTE  LN   NRE
Sbjct: 68  EKPTYATKWPIRHGIVEDWDLMERFMEQVIFKYLRAEPEDHYFLLTEPPLNTPENRE 124



 Score = 40.3 bits (90), Expect = 0.038
 Identities = 24/63 (38%), Positives = 33/63 (52%), Gaps = 8/63 (12%)
 Frame = +3

Query: 87  ALVVDNGSGMCKAGFAGDDAPRAVFPSI--------VGRPRHQGVMVGMGQKDSYVGDEA 242
           A VVD G+G  K G+AG+  P+ + PS         VG    + VM G+   D ++GDEA
Sbjct: 7   ACVVDCGTGYTKLGYAGNTEPQFIIPSCIAIKESAKVGDQAQRRVMKGVDDLDFFIGDEA 66

Query: 243 QSK 251
             K
Sbjct: 67  IEK 69


>UniRef50_UPI00005A3B5D Cluster: PREDICTED: similar to Actin-5C; n=3;
            Laurasiatheria|Rep: PREDICTED: similar to Actin-5C -
            Canis familiaris
          Length = 1248

 Score = 56.8 bits (131), Expect = 4e-07
 Identities = 23/51 (45%), Positives = 35/51 (68%), Gaps = 1/51 (1%)
 Frame = +2

Query: 272  YPI-EHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
            YP+   G+V++WD +E +W H FY  L V PEE  VL+ ++ ++P+ NREK
Sbjct: 952  YPVLNRGVVSDWDALEVLWQHLFYCRLGVRPEELAVLVADSPISPRTNREK 1002



 Score = 33.9 bits (74), Expect = 3.3
 Identities = 30/128 (23%), Positives = 49/128 (38%)
 Frame = +3

Query: 75   EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKR 254
            +++AA+V+D G+G  K G A +D   +V PS V   +H         +  Y   E Q   
Sbjct: 897  QDMAAVVIDTGTGFTKCGLAREDHVLSVLPSRVQLLQHPA-----QDEPRYAVPENQEGS 951

Query: 255  VXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSCVSPPRNTQSCLLRLPSTPRATERKMTQI 434
                          L  + W+        +     P      +   P +PR    K+ +I
Sbjct: 952  YPVLNRGVVSDWDALE-VLWQHLFYCRLGVR----PEELAVLVADSPISPRTNREKVAEI 1006

Query: 435  MFETFNTP 458
            +FE F+ P
Sbjct: 1007 LFERFHVP 1014


>UniRef50_A2VD47 Cluster: Zgc:158823 protein; n=3; Eukaryota|Rep:
           Zgc:158823 protein - Danio rerio (Zebrafish)
           (Brachydanio rerio)
          Length = 334

 Score = 56.8 bits (131), Expect = 4e-07
 Identities = 24/50 (48%), Positives = 30/50 (60%)
 Frame = +2

Query: 269 KYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNRE 418
           K+PI HGI+ +WD MEK      +  LR  PE+H  L+TE  LN   NRE
Sbjct: 76  KWPIRHGIIEDWDFMEKFMEQVIFKYLRAEPEDHNFLMTEPPLNTPENRE 125



 Score = 34.7 bits (76), Expect = 1.9
 Identities = 19/61 (31%), Positives = 32/61 (52%), Gaps = 8/61 (13%)
 Frame = +3

Query: 93  VVDNGSGMCKAGFAGDDAPRAVFPSI--------VGRPRHQGVMVGMGQKDSYVGDEAQS 248
           V+D G+G  K G+AG+  P+ + P+         VG    + ++ G+   D ++GDEA  
Sbjct: 10  VIDCGTGYTKIGYAGNTEPQFIMPTCIAVRESASVGDQAQRRLVKGVDDLDFFIGDEAID 69

Query: 249 K 251
           K
Sbjct: 70  K 70


>UniRef50_P32392 Cluster: Actin-related protein 3; n=27;
           Eukaryota|Rep: Actin-related protein 3 - Drosophila
           melanogaster (Fruit fly)
          Length = 418

 Score = 56.8 bits (131), Expect = 4e-07
 Identities = 24/52 (46%), Positives = 32/52 (61%)
 Frame = +2

Query: 263 TLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNRE 418
           ++KYP+ HG+V +WD ME+      +  LR  PE+H  LLTE  LN   NRE
Sbjct: 73  SIKYPVRHGLVEDWDLMERFLEQCVFKYLRAEPEDHYFLLTEPPLNTPENRE 124



 Score = 36.7 bits (81), Expect = 0.47
 Identities = 21/60 (35%), Positives = 31/60 (51%), Gaps = 8/60 (13%)
 Frame = +3

Query: 87  ALVVDNGSGMCKAGFAGDDAPRAVFPSI--------VGRPRHQGVMVGMGQKDSYVGDEA 242
           A V+D G+G  K GFAG+  P+ + PS         VG    + +  G+   D ++GDEA
Sbjct: 7   ACVIDVGTGYSKLGFAGNKEPQFIIPSAIAIKESARVGDTNTRRITKGIEDLDFFIGDEA 66


>UniRef50_UPI0000F2DE11 Cluster: PREDICTED: similar to
           testis-specific actin-related protein 3; n=1;
           Monodelphis domestica|Rep: PREDICTED: similar to
           testis-specific actin-related protein 3 - Monodelphis
           domestica
          Length = 939

 Score = 56.4 bits (130), Expect = 5e-07
 Identities = 21/45 (46%), Positives = 35/45 (77%)
 Frame = +2

Query: 287 GIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           G+VT+WD +E +W+H FY++L V P+E  VL+ ++ ++P+ NREK
Sbjct: 167 GVVTDWDALEVLWNHIFYSKLCVEPQELAVLVADSPVSPRTNREK 211



 Score = 47.6 bits (108), Expect = 2e-04
 Identities = 36/128 (28%), Positives = 57/128 (44%)
 Frame = +3

Query: 75  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKR 254
           + +AA+V+D G+G  K G AG+D  RA+ P+ VGR  H   +   G K  Y   E +++ 
Sbjct: 106 KNLAAVVIDTGTGYSKCGLAGEDRTRAIVPTRVGR--H---LNSEGDKTPYYITE-EAEA 159

Query: 255 VXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSCVSPPRNTQSCLLRLPSTPRATERKMTQI 434
                            + W    I  S + CV P +     +   P +PR    K+ ++
Sbjct: 160 ACSTLIRGVVTDWDALEVLWNH--IFYSKL-CVEP-QELAVLVADSPVSPRTNREKVVEL 215

Query: 435 MFETFNTP 458
           +FE F  P
Sbjct: 216 LFENFGVP 223


>UniRef50_UPI0000E47BC7 Cluster: PREDICTED: similar to ubiquitin/actin
            fusion protein; n=1; Strongylocentrotus purpuratus|Rep:
            PREDICTED: similar to ubiquitin/actin fusion protein -
            Strongylocentrotus purpuratus
          Length = 1608

 Score = 54.8 bits (126), Expect = 2e-06
 Identities = 24/52 (46%), Positives = 33/52 (63%)
 Frame = +2

Query: 266  LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
            L+Y    G+V NW ++E IW H   +EL V  E+HP+LLTE +  PK  RE+
Sbjct: 1303 LRYLPIGGVVDNWAELEHIWDHVVSHELNVKWEDHPILLTELASAPKRQRER 1354



 Score = 43.6 bits (98), Expect = 0.004
 Identities = 21/54 (38%), Positives = 32/54 (59%)
 Frame = +3

Query: 90   LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 251
            +++DNGS M +AG A   AP    P++VGR + + +     +KD YVG+E   K
Sbjct: 1236 IILDNGSSMLRAGLADGVAPSVTMPTVVGRLK-KDIESYRNRKDVYVGNELTKK 1288


>UniRef50_UPI0000E80C06 Cluster: PREDICTED: hypothetical protein;
           n=1; Gallus gallus|Rep: PREDICTED: hypothetical protein
           - Gallus gallus
          Length = 65

 Score = 54.0 bits (124), Expect = 3e-06
 Identities = 29/64 (45%), Positives = 34/64 (53%)
 Frame = +1

Query: 76  KKLPRW**TMAPVCARPVSQEMMLLAPCSPRSWEGPAIRA*WSVWDRRTLM*EMRHRAKE 255
           +KL  W  TMA VCAR     MM    CS   W+ P I+  W VW RRT M EM+ RA+ 
Sbjct: 2   RKLLPWWWTMALVCARQALLGMMPPGLCSLPLWDAPGIKVSWWVWGRRTAMWEMKPRARG 61

Query: 256 YPDP 267
              P
Sbjct: 62  ESSP 65


>UniRef50_Q383R8 Cluster: Actin-like protein, putative; n=4;
           Trypanosoma|Rep: Actin-like protein, putative -
           Trypanosoma brucei
          Length = 394

 Score = 52.8 bits (121), Expect = 7e-06
 Identities = 35/133 (26%), Positives = 60/133 (45%), Gaps = 4/133 (3%)
 Frame = +3

Query: 75  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQ--KDSYVGDEAQS 248
           ++   +V D GS   + GFAG++APR +  ++VG PR +G++  + Q   D Y GD A +
Sbjct: 3   QQQPVVVFDMGSNKTRVGFAGEEAPRVISSTVVGVPRQRGLVGSLMQHYSDDYAGDAACA 62

Query: 249 KRVXXXXXXXXXXXXXLTGMTWRRF--GIIPSTMSCVSPPRNTQSCLLRLPSTPRATERK 422
           +                +      F   +  S +  V  P NT    +    T R    +
Sbjct: 63  QEGMLNLSYPVRNRRITSMPEVEHFLQDVFYSRLPLV--PSNTMMLWVESVRTSREDRER 120

Query: 423 MTQIMFETFNTPR 461
           + ++MFE+F  P+
Sbjct: 121 LCEMMFESFGLPQ 133



 Score = 34.7 bits (76), Expect = 1.9
 Identities = 15/58 (25%), Positives = 30/58 (51%)
 Frame = +2

Query: 248 QKSILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           Q+ +L L YP+ +  +T+  ++E      FY+ L + P    +L  E+    + +RE+
Sbjct: 63  QEGMLNLSYPVRNRRITSMPEVEHFLQDVFYSRLPLVPSNTMMLWVESVRTSREDRER 120


>UniRef50_A2ECQ8 Cluster: Actin family protein; n=1; Trichomonas
           vaginalis G3|Rep: Actin family protein - Trichomonas
           vaginalis G3
          Length = 371

 Score = 52.8 bits (121), Expect = 7e-06
 Identities = 23/58 (39%), Positives = 36/58 (62%)
 Frame = +3

Query: 78  EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 251
           ++  +V+DNG+   KAGFAG   P  + P++VG  +    MVG+  K  +VG+EA +K
Sbjct: 3   DMKTIVIDNGTFSVKAGFAGTKKPHFIIPTVVGTAKENADMVGIKNKAYFVGNEALAK 60



 Score = 38.7 bits (86), Expect = 0.12
 Identities = 17/58 (29%), Positives = 31/58 (53%)
 Frame = +2

Query: 248 QKSILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           ++++L L  PIE+G+V NW+   ++W   F N+     E+  +L  E     + N+ K
Sbjct: 60  KENLLNLVNPIENGVVQNWEFQTQLWDELFANQFHCPLEDVCILTGEKPACTQQNKAK 117


>UniRef50_UPI000049A548 Cluster: actin; n=1; Entamoeba histolytica
           HM-1:IMSS|Rep: actin - Entamoeba histolytica HM-1:IMSS
          Length = 365

 Score = 52.0 bits (119), Expect = 1e-05
 Identities = 23/54 (42%), Positives = 36/54 (66%)
 Frame = +2

Query: 260 LTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           L L+ PI+ GI+ +W+D+E IW   F  EL+V   +  V+LT+A+L P  ++EK
Sbjct: 55  LNLQQPIQRGIINDWNDIEDIWDFAF-EELQVESSDQVVMLTQAALTPPIHKEK 107



 Score = 43.6 bits (98), Expect = 0.004
 Identities = 30/120 (25%), Positives = 51/120 (42%)
 Frame = +3

Query: 90  LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRVXXXX 269
           +++DNGSG+ KAG + ++ P+ VFP +VG  +    +  +G    +  D    + +    
Sbjct: 6   IIIDNGSGLIKAGESSEELPKIVFPCVVGHSKETNKLENIGDFARFSKDLNLQQPIQRGI 65

Query: 270 XXXXXXXXXLTGMTWRRFGIIPSTMSCVSPPRNTQSCLLRLPSTPRATERKMTQIMFETF 449
                    +    +    +  S    +     TQ+ L     TP   + KM QIMFE F
Sbjct: 66  INDWNDIEDIWDFAFEELQVESSDQVVML----TQAAL-----TPPIHKEKMAQIMFEGF 116


>UniRef50_Q5C683 Cluster: SJCHGC08418 protein; n=1; Schistosoma
           japonicum|Rep: SJCHGC08418 protein - Schistosoma
           japonicum (Blood fluke)
          Length = 106

 Score = 52.0 bits (119), Expect = 1e-05
 Identities = 22/46 (47%), Positives = 31/46 (67%)
 Frame = +2

Query: 260 LTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASL 397
           L L  PI +GIVT+ D +  +W++ F  ELR +PE HPVL++E  L
Sbjct: 61  LILNCPIANGIVTDIDGLSLVWYYMFMKELRTSPENHPVLISEYPL 106



 Score = 47.2 bits (107), Expect = 3e-04
 Identities = 18/32 (56%), Positives = 25/32 (78%)
 Frame = +3

Query: 90  LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPR 185
           +VVDNG+G  KAG+AGD  PR + P ++GRP+
Sbjct: 9   IVVDNGAGHLKAGYAGDGGPRILVPMLIGRPK 40


>UniRef50_Q00UL2 Cluster: Alpha amylase 1; n=3; Ostreococcus|Rep:
           Alpha amylase 1 - Ostreococcus tauri
          Length = 913

 Score = 51.6 bits (118), Expect = 2e-05
 Identities = 25/33 (75%), Positives = 28/33 (84%)
 Frame = -1

Query: 169 IEGNTARGASSPAKPALHIPEPLSTTNAATSSS 71
           ++GNTA GASSPAKPAL IPEPLS T+A TS S
Sbjct: 1   MDGNTAFGASSPAKPALTIPEPLSHTSAETSPS 33


>UniRef50_Q6FRF2 Cluster: Similar to sp|P38696 Saccharomyces
           cerevisiae YHR129c ACT5; n=1; Candida glabrata|Rep:
           Similar to sp|P38696 Saccharomyces cerevisiae YHR129c
           ACT5 - Candida glabrata (Yeast) (Torulopsis glabrata)
          Length = 387

 Score = 51.6 bits (118), Expect = 2e-05
 Identities = 33/127 (25%), Positives = 57/127 (44%), Gaps = 4/127 (3%)
 Frame = +3

Query: 90  LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRVXXXX 269
           +++DNGS + KAGFAG   P  +  + +G P  +  MV +  K++Y+G+ A  +R     
Sbjct: 13  VILDNGSSVIKAGFAGSQQPDVLEYAWIGNPLAERSMVTVSNKETYIGNSAYERRATLHL 72

Query: 270 XXXXXXXXXLTGMTWRR----FGIIPSTMSCVSPPRNTQSCLLRLPSTPRATERKMTQIM 437
                       M+W R    +  +      +   +     L    ST +  E KM +++
Sbjct: 73  ESPYSTNAI---MSWDRLEDLWDYVLLNKLEIEQLQEHPVVLTNSMSTSKKEEEKMCEVL 129

Query: 438 FETFNTP 458
           FE F+ P
Sbjct: 130 FEKFSIP 136



 Score = 44.4 bits (100), Expect = 0.002
 Identities = 19/60 (31%), Positives = 33/60 (55%), Gaps = 1/60 (1%)
 Frame = +2

Query: 245 EQKSILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAP-EEHPVLLTEASLNPKGNREK 421
           E+++ L L+ P     + +WD +E +W +   N+L +   +EHPV+LT +    K   EK
Sbjct: 65  ERRATLHLESPYSTNAIMSWDRLEDLWDYVLLNKLEIEQLQEHPVVLTNSMSTSKKEEEK 124


>UniRef50_Q19R57 Cluster: Actin-like protein 1; n=2; Trypanosoma
           cruzi|Rep: Actin-like protein 1 - Trypanosoma cruzi
           strain CL Brener
          Length = 390

 Score = 50.8 bits (116), Expect = 3e-05
 Identities = 24/53 (45%), Positives = 32/53 (60%)
 Frame = +2

Query: 263 TLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           TL +PI HGIV +W  ME++ HHTF  E  +  EE  ++ TE    PK N E+
Sbjct: 68  TLHHPIRHGIVKDWPRMEQVIHHTFV-EFGMNSEETSIVCTEPLFTPKRNSEQ 119



 Score = 33.9 bits (74), Expect = 3.3
 Identities = 13/31 (41%), Positives = 20/31 (64%)
 Frame = +3

Query: 90  LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRP 182
           ++VD GS + KAG   +  P  +FP++VG P
Sbjct: 2   IIVDFGSSLVKAGTVTESLPSLIFPAVVGVP 32


>UniRef50_A2EUM6 Cluster: Actin family protein; n=1; Trichomonas
           vaginalis G3|Rep: Actin family protein - Trichomonas
           vaginalis G3
          Length = 360

 Score = 50.8 bits (116), Expect = 3e-05
 Identities = 25/53 (47%), Positives = 33/53 (62%)
 Frame = +3

Query: 90  LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQS 248
           LV+D GSG  KAGFAG+D+P  VFP++VG  RH   +      D  +G+ A S
Sbjct: 8   LVLDFGSGFVKAGFAGNDSPSLVFPTVVGNLRH-AKLGPSNSNDPLIGESALS 59


>UniRef50_A7S2B1 Cluster: Predicted protein; n=1; Nematostella
           vectensis|Rep: Predicted protein - Nematostella
           vectensis
          Length = 265

 Score = 50.4 bits (115), Expect = 4e-05
 Identities = 25/58 (43%), Positives = 37/58 (63%), Gaps = 3/58 (5%)
 Frame = +3

Query: 87  ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVG--MGQKD-SYVGDEAQSK 251
           A+V+DNG G+ K GFAGD  PR + P++VG P+   +++G  +  KD    GD A +K
Sbjct: 1   AIVLDNGCGISKIGFAGDRVPRIIQPAVVGNPQRFSMLIGDNVNVKDYKKYGDAAVAK 58



 Score = 49.2 bits (112), Expect = 8e-05
 Identities = 19/58 (32%), Positives = 32/58 (55%)
 Frame = +2

Query: 248 QKSILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           +  ++ L YP+    +  W D+  +W +  Y+EL +   EHP ++TE + N   NREK
Sbjct: 58  KSGVMHLSYPMHADKLETWTDVVDLWEYLLYDELDIGEGEHPFIVTEIAKNHPKNREK 115


>UniRef50_UPI0000EBF019 Cluster: PREDICTED: similar to ribosomal
           protein L10; n=1; Bos taurus|Rep: PREDICTED: similar to
           ribosomal protein L10 - Bos taurus
          Length = 289

 Score = 49.6 bits (113), Expect = 6e-05
 Identities = 26/54 (48%), Positives = 33/54 (61%)
 Frame = +3

Query: 90  LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 251
           LVVD G   CK GF  D+    V P+    P+HQ  MVG+GQKDSY+G + Q +
Sbjct: 4   LVVDCGFDTCKTGFTEDNTLSCV-PTHRLVPQHQDCMVGVGQKDSYMGGKIQGR 56



 Score = 35.5 bits (78), Expect = 1.1
 Identities = 22/56 (39%), Positives = 31/56 (55%), Gaps = 6/56 (10%)
 Frame = +2

Query: 254 SILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPV------LLTEASLNP 403
           S+ T +YP+E GI+T+ DD+ KIW     N+L    +  P+      L TE SL P
Sbjct: 58  SVQTPEYPMEQGIITHPDDVGKIWITIAINQLHGMFKLSPLNCFSDFLCTEGSLLP 113


>UniRef50_Q4DMP2 Cluster: Actin-related protein 2, putative; n=4;
           Trypanosoma|Rep: Actin-related protein 2, putative -
           Trypanosoma cruzi
          Length = 403

 Score = 49.6 bits (113), Expect = 6e-05
 Identities = 20/49 (40%), Positives = 32/49 (65%)
 Frame = +2

Query: 251 KSILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASL 397
           + +L + YPI +GI+ N D+M  +W +TF   L++ P EH +LL+E  L
Sbjct: 77  RHLLDMTYPIRNGIIQNMDEMCHLWDYTFGEMLQINPSEHRLLLSEVPL 125



 Score = 41.5 bits (93), Expect = 0.016
 Identities = 18/35 (51%), Positives = 24/35 (68%)
 Frame = +3

Query: 78  EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRP 182
           E   +V+DNGSG  K G+AG + P AVF + +GRP
Sbjct: 4   EKRPVVLDNGSGFIKCGYAGANFPTAVFQTALGRP 38


>UniRef50_A0D9D5 Cluster: Chromosome undetermined scaffold_42, whole
           genome shotgun sequence; n=1; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_42,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 94

 Score = 48.8 bits (111), Expect = 1e-04
 Identities = 25/57 (43%), Positives = 34/57 (59%), Gaps = 2/57 (3%)
 Frame = +3

Query: 90  LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRP--RHQGVMVGMGQKDSYVGDEAQSKR 254
           ++ D+G+G  K GFAGD+ P   FP++VGRP  R    +     KD  +GDEAQ  R
Sbjct: 5   IIEDSGTGYLKIGFAGDNFPSHSFPAMVGRPTLRADEQLDDANLKDIMIGDEAQPYR 61


>UniRef50_Q9N4N4 Cluster: Putative uncharacterized protein; n=2;
           Caenorhabditis|Rep: Putative uncharacterized protein -
           Caenorhabditis elegans
          Length = 436

 Score = 48.4 bits (110), Expect = 1e-04
 Identities = 20/48 (41%), Positives = 31/48 (64%)
 Frame = +2

Query: 278 IEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           ++ G++ +W+  EKI  H++ N L   P EHPVL +E+S N +  REK
Sbjct: 94  MKEGLIEDWELFEKIVEHSYENILYSNPSEHPVLFSESSWNDRARREK 141



 Score = 33.5 bits (73), Expect = 4.4
 Identities = 14/33 (42%), Positives = 21/33 (63%)
 Frame = +3

Query: 75  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIV 173
           +EV+ LV D GS   + GFAG++ P+   PS +
Sbjct: 9   DEVSGLVFDAGSQSFRVGFAGEEYPKGDIPSYI 41


>UniRef50_Q8IIQ4 Cluster: Actin, putative; n=7; Apicomplexa|Rep:
           Actin, putative - Plasmodium falciparum (isolate 3D7)
          Length = 392

 Score = 48.4 bits (110), Expect = 1e-04
 Identities = 39/128 (30%), Positives = 55/128 (42%), Gaps = 2/128 (1%)
 Frame = +3

Query: 78  EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRV 257
           E   +V+DNGSG  KAG    + P  VFP+IVG  ++         K  Y GDEA     
Sbjct: 2   ENKTIVIDNGSGYIKAGINSSEEPTIVFPTIVGIEKNDET------KRIYTGDEAFFHES 55

Query: 258 XXXXXXXXXXXXXLTGMTW-RRFGIIPSTMSCVSPPRNTQSCLLRLPSTPRATER-KMTQ 431
                             W +   +   T++CV P ++ +  LL  P     + R KM +
Sbjct: 56  NLNIYRPIDHGHI---SDWDKAQKVWDYTLNCVDPSKSIKDILLTEPPLCSISHRKKMGE 112

Query: 432 IMFETFNT 455
           I FE F+T
Sbjct: 113 IFFEYFDT 120



 Score = 38.7 bits (86), Expect = 0.12
 Identities = 19/57 (33%), Positives = 33/57 (57%)
 Frame = +2

Query: 251 KSILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           +S L +  PI+HG +++WD  +K+W +T  N +  +     +LLTE  L    +R+K
Sbjct: 54  ESNLNIYRPIDHGHISDWDKAQKVWDYTL-NCVDPSKSIKDILLTEPPLCSISHRKK 109


>UniRef50_UPI0000F2D272 Cluster: PREDICTED: similar to actin; n=1;
           Monodelphis domestica|Rep: PREDICTED: similar to actin -
           Monodelphis domestica
          Length = 790

 Score = 48.0 bits (109), Expect = 2e-04
 Identities = 21/51 (41%), Positives = 33/51 (64%)
 Frame = +2

Query: 269 KYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           ++ I+ G V NWD ME IW+++F + L +  + HPVL+TE   N +  R+K
Sbjct: 141 QFAIDRGRVLNWDAMEDIWYYSF-DYLGIKTKNHPVLITEFPRNDENYRQK 190



 Score = 42.7 bits (96), Expect = 0.007
 Identities = 18/47 (38%), Positives = 27/47 (57%)
 Frame = +2

Query: 260 LTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLN 400
           L  ++ I  G +TNW+ ME IW + F  EL     +HP+L+T   +N
Sbjct: 489 LRTEFVINRGTITNWEAMESIWRYIF-GELNSGSMDHPLLITGLPMN 534



 Score = 39.1 bits (87), Expect = 0.088
 Identities = 17/33 (51%), Positives = 22/33 (66%)
 Frame = +3

Query: 78  EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVG 176
           E + LVVD GS  CKAG+ G+  P  + PS+VG
Sbjct: 423 ERSCLVVDIGSACCKAGWCGEKFPPIIVPSVVG 455



 Score = 35.9 bits (79), Expect = 0.82
 Identities = 15/33 (45%), Positives = 22/33 (66%)
 Frame = +3

Query: 78  EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVG 176
           E +++V+D GS  CKAG A ++ P    PS+VG
Sbjct: 68  ESSSVVIDIGSAWCKAGLAMENYPTLAVPSVVG 100


>UniRef50_Q9P7X7 Cluster: Actin-related protein 4; n=1;
           Schizosaccharomyces pombe|Rep: Actin-related protein 4 -
           Schizosaccharomyces pombe (Fission yeast)
          Length = 433

 Score = 48.0 bits (109), Expect = 2e-04
 Identities = 21/54 (38%), Positives = 30/54 (55%)
 Frame = +2

Query: 260 LTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           + +K  I +G V NWD    +W +    +L+  P EHP+L+TE   NP  NR K
Sbjct: 63  MEIKNAIRNGWVENWDVTVDLWRYGLEQQLKTNPLEHPILITEPFDNPPENRVK 116



 Score = 40.3 bits (90), Expect = 0.038
 Identities = 16/34 (47%), Positives = 24/34 (70%)
 Frame = +3

Query: 75  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVG 176
           +EV+A+V+D GS   + GF+G+D P+ V PS  G
Sbjct: 9   DEVSAIVIDPGSKWTRIGFSGEDIPKCVLPSYCG 42


>UniRef50_UPI0000EC9F4D Cluster: HSD21.; n=2; Gallus gallus|Rep:
           HSD21. - Gallus gallus
          Length = 373

 Score = 46.0 bits (104), Expect = 8e-04
 Identities = 18/47 (38%), Positives = 30/47 (63%)
 Frame = +2

Query: 278 IEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNRE 418
           + +G + NW+  E + ++   +ELRV PE+H +LLTE   +P  +RE
Sbjct: 73  MHNGFIINWEAAENLCYYLLKHELRVNPEDHALLLTEPLFSPTSSRE 119


>UniRef50_Q6BG23 Cluster: Actin, putative; n=1; Paramecium
           tetraurelia|Rep: Actin, putative - Paramecium
           tetraurelia
          Length = 328

 Score = 46.0 bits (104), Expect = 8e-04
 Identities = 18/52 (34%), Positives = 29/52 (55%)
 Frame = +2

Query: 266 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           +KYPI +  + ++D ME +WH  F+  L   PE+  +L+T      K  +EK
Sbjct: 21  IKYPILNSKIVDFDTMETVWHKAFFEYLMTNPEDSSILITSQLNTSKNEKEK 72


>UniRef50_Q17GZ9 Cluster: Actin-related protein 5; n=4;
           Endopterygota|Rep: Actin-related protein 5 - Aedes
           aegypti (Yellowfever mosquito)
          Length = 655

 Score = 46.0 bits (104), Expect = 8e-04
 Identities = 18/34 (52%), Positives = 26/34 (76%)
 Frame = +3

Query: 84  AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPR 185
           AA+V+DNGS  C+AG+AG D P  VF +++ +PR
Sbjct: 28  AAIVIDNGSYHCRAGWAGKDVPSLVFKNVLAKPR 61


>UniRef50_Q75JT2 Cluster: Similar to Drosophila melanogaster (Fruit
           fly). RE12057p; n=4; Dictyostelium discoideum|Rep:
           Similar to Drosophila melanogaster (Fruit fly). RE12057p
           - Dictyostelium discoideum (Slime mold)
          Length = 414

 Score = 45.6 bits (103), Expect = 0.001
 Identities = 18/36 (50%), Positives = 25/36 (69%)
 Frame = +2

Query: 314 EKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           +K W+H F ++L V+ ++HPV LTE   NPK N EK
Sbjct: 235 KKFWNHAFNDQLCVSSDQHPVFLTEPPFNPKVNTEK 270


>UniRef50_O96019 Cluster: Actin-like protein 6A; n=63;
           Eumetazoa|Rep: Actin-like protein 6A - Homo sapiens
           (Human)
          Length = 429

 Score = 45.6 bits (103), Expect = 0.001
 Identities = 18/49 (36%), Positives = 30/49 (61%)
 Frame = +2

Query: 275 PIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           P+++G+V +WD  + I  HT+   ++     HPVL++EA  N +  REK
Sbjct: 87  PLKNGMVEDWDSFQAILDHTYKMHVKSEASLHPVLMSEAPWNTRAKREK 135



 Score = 43.6 bits (98), Expect = 0.004
 Identities = 41/139 (29%), Positives = 58/139 (41%), Gaps = 11/139 (7%)
 Frame = +3

Query: 75  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGR--PRHQG--VMVGMGQKDSYVGD-- 236
           +EV ALV D GS   +AG+AG+D P+  FP+ +G    R  G  +M   G K    G   
Sbjct: 9   DEVGALVFDIGSYTVRAGYAGEDCPKVDFPTAIGMVVERDDGSTLMEIDGDKGKQGGPTY 68

Query: 237 --EAQSKRVXXXXXXXXXXXXXLTGMTWRRF-GIIPSTMSC-VSPPRNTQSCLL-RLPST 401
             +  + RV                  W  F  I+  T    V    +    L+   P  
Sbjct: 69  YIDTNALRVPRENMEAISPLKNGMVEDWDSFQAILDHTYKMHVKSEASLHPVLMSEAPWN 128

Query: 402 PRATERKMTQIMFETFNTP 458
            RA   K+T++MFE +N P
Sbjct: 129 TRAKREKLTELMFEHYNIP 147


>UniRef50_Q5CKL2 Cluster: BRG1/brm-associated factor 53A; n=2;
           Cryptosporidium|Rep: BRG1/brm-associated factor 53A -
           Cryptosporidium hominis
          Length = 423

 Score = 45.2 bits (102), Expect = 0.001
 Identities = 18/34 (52%), Positives = 26/34 (76%)
 Frame = +3

Query: 75  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVG 176
           ++V A++VD GS M K G+ G+D PR V+PS+VG
Sbjct: 11  DDVGAIIVDVGSYMTKIGYGGEDCPRQVWPSVVG 44


>UniRef50_A4RW28 Cluster: Predicted protein; n=2; Ostreococcus|Rep:
           Predicted protein - Ostreococcus lucimarinus CCE9901
          Length = 425

 Score = 44.8 bits (101), Expect = 0.002
 Identities = 23/64 (35%), Positives = 32/64 (50%)
 Frame = +2

Query: 281 EHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREKDDPDHVRNI*HAP 460
           E+G++ +W+ +E IW H     L +  +EHPVLL+E   N    R K          HAP
Sbjct: 80  ENGMLEDWEAVEAIWEHALKKRLALQTDEHPVLLSEPVHNSDAVRAKMVELMFEK--HAP 137

Query: 461 PCTF 472
           P  F
Sbjct: 138 PALF 141



 Score = 44.4 bits (100), Expect = 0.002
 Identities = 19/34 (55%), Positives = 26/34 (76%)
 Frame = +3

Query: 75  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVG 176
           +EV+A+V+D G+   KAG+AG D P+ VFPS VG
Sbjct: 5   DEVSAVVIDLGTHSVKAGYAGQDTPQHVFPSAVG 38


>UniRef50_Q5CSX9 Cluster: Actin; n=2; Cryptosporidium|Rep: Actin -
           Cryptosporidium parvum Iowa II
          Length = 405

 Score = 44.8 bits (101), Expect = 0.002
 Identities = 33/125 (26%), Positives = 55/125 (44%), Gaps = 3/125 (2%)
 Frame = +3

Query: 90  LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRVXXXX 269
           +V+D GS   KAG   D +P  +FPS+VG+ R + V         +VG+EA ++R     
Sbjct: 22  IVIDCGSAYMKAGTDSDKSPTCIFPSMVGQYRSRYVPEDEDNNPIFVGEEAIAQRKKLSL 81

Query: 270 XXXXXXXXXLTGMTWRRFGIIPSTM---SCVSPPRNTQSCLLRLPSTPRATERKMTQIMF 440
                         W +F  + + +        P ++   + + P      E K+T++MF
Sbjct: 82  TFPIDHGHI---DDWTKFEELLNYLFYRGLDIDPIDSSVIITKPPLCSNRHEEKITELMF 138

Query: 441 ETFNT 455
           E F T
Sbjct: 139 EMFQT 143



 Score = 43.6 bits (98), Expect = 0.004
 Identities = 18/58 (31%), Positives = 34/58 (58%)
 Frame = +2

Query: 248 QKSILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           Q+  L+L +PI+HG + +W   E++ ++ FY  L + P +  V++T+  L    + EK
Sbjct: 75  QRKKLSLTFPIDHGHIDDWTKFEELLNYLFYRGLDIDPIDSSVIITKPPLCSNRHEEK 132


>UniRef50_Q9LHH0 Cluster: Actin-like protein; n=11;
           Magnoliophyta|Rep: Actin-like protein - Arabidopsis
           thaliana (Mouse-ear cress)
          Length = 724

 Score = 44.0 bits (99), Expect = 0.003
 Identities = 21/49 (42%), Positives = 31/49 (63%)
 Frame = +3

Query: 90  LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGD 236
           +V+DNG+   + G+AG+  PR VF +IV RPRH+      G+  + VGD
Sbjct: 22  IVIDNGASYFRIGWAGETEPRVVFRNIVQRPRHKAT----GETVTIVGD 66


>UniRef50_Q5C3R3 Cluster: SJCHGC08022 protein; n=1; Schistosoma
           japonicum|Rep: SJCHGC08022 protein - Schistosoma
           japonicum (Blood fluke)
          Length = 209

 Score = 44.0 bits (99), Expect = 0.003
 Identities = 19/45 (42%), Positives = 31/45 (68%), Gaps = 1/45 (2%)
 Frame = +3

Query: 90  LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPR-HQGVMVGMGQKD 221
           +V+DNG+  C+AG++  + P   FP++V RPR  +GV+VG   +D
Sbjct: 39  IVIDNGNFECRAGYSNFEKPHMTFPNVVYRPRMSKGVLVGNDIQD 83


>UniRef50_A4S826 Cluster: Predicted protein; n=1; Ostreococcus
           lucimarinus CCE9901|Rep: Predicted protein -
           Ostreococcus lucimarinus CCE9901
          Length = 346

 Score = 43.6 bits (98), Expect = 0.004
 Identities = 21/27 (77%), Positives = 23/27 (85%), Gaps = 1/27 (3%)
 Frame = +3

Query: 66  MCDE-EVAALVVDNGSGMCKAGFAGDD 143
           M DE E++ALV DNGSGM KAGFAGDD
Sbjct: 1   MADEGELSALVCDNGSGMVKAGFAGDD 27


>UniRef50_Q22WQ4 Cluster: Actin family protein; n=1; Tetrahymena
           thermophila SB210|Rep: Actin family protein -
           Tetrahymena thermophila SB210
          Length = 444

 Score = 43.2 bits (97), Expect = 0.005
 Identities = 19/37 (51%), Positives = 26/37 (70%)
 Frame = +3

Query: 66  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVG 176
           M  E++ A+VVD GS   +AG++G+D PR V PS VG
Sbjct: 1   MFTEDITAIVVDPGSLSIRAGYSGEDTPRLVMPSQVG 37



 Score = 41.9 bits (94), Expect = 0.012
 Identities = 18/46 (39%), Positives = 31/46 (67%)
 Frame = +2

Query: 284 HGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           +G V +WD  EK+    + N++RV P E+ +L++E+SL+ +  REK
Sbjct: 101 NGEVKDWDAFEKLLLDVYENQIRVQPSEYCLLISESSLHNQRQREK 146


>UniRef50_Q5KLG9 Cluster: 53 kDa brg1-associated factor b
           (Actin-related protein baf53b), putative; n=1;
           Filobasidiella neoformans|Rep: 53 kDa brg1-associated
           factor b (Actin-related protein baf53b), putative -
           Cryptococcus neoformans (Filobasidiella neoformans)
          Length = 476

 Score = 42.7 bits (96), Expect = 0.007
 Identities = 19/34 (55%), Positives = 25/34 (73%)
 Frame = +3

Query: 75  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVG 176
           +EV+ALV+D GS   +AG+AG+D PR V PS  G
Sbjct: 6   DEVSALVLDFGSYTTRAGYAGEDCPRVVCPSFYG 39



 Score = 41.1 bits (92), Expect = 0.022
 Identities = 25/84 (29%), Positives = 41/84 (48%), Gaps = 1/84 (1%)
 Frame = +2

Query: 167 DRGKAPPSGRDGRYGTEGLLCRR*GTEQKSILTLKYPIEHGIVTNWDDMEKIWHHTFYNE 346
           ++ K   SGR    G +G+   R G E  + +        G+V + +    + HH  +  
Sbjct: 79  EQSKKKGSGRKYYVGEDGVSVWRPGMEVGNFML------DGVVNDPEPASALLHHILHER 132

Query: 347 LRVAPEEHPVLLTEASLN-PKGNR 415
           L V PEEHP+++TE + N PK  +
Sbjct: 133 LGVNPEEHPIMITEPAWNTPKARQ 156


>UniRef50_Q9H568 Cluster: Actin-like protein 8; n=10; Eutheria|Rep:
           Actin-like protein 8 - Homo sapiens (Human)
          Length = 366

 Score = 42.7 bits (96), Expect = 0.007
 Identities = 19/53 (35%), Positives = 28/53 (52%)
 Frame = +2

Query: 263 TLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           T  YPIE G + NW+ ++ +W     N  R   E  PV++TE  L    +R+K
Sbjct: 62  TFSYPIERGRILNWEGVQYLWSFVLENHRR-EQEVPPVIITETPLREPADRKK 113



 Score = 36.7 bits (81), Expect = 0.47
 Identities = 15/28 (53%), Positives = 22/28 (78%)
 Frame = +3

Query: 90  LVVDNGSGMCKAGFAGDDAPRAVFPSIV 173
           +++D+GSG  KAG AG + P+ VFP+IV
Sbjct: 6   VIIDHGSGFLKAGTAGWNEPQMVFPNIV 33


>UniRef50_Q9SRK2 Cluster: Putative actin; n=1; Arabidopsis
           thaliana|Rep: Putative actin - Arabidopsis thaliana
           (Mouse-ear cress)
          Length = 378

 Score = 42.3 bits (95), Expect = 0.009
 Identities = 21/55 (38%), Positives = 31/55 (56%), Gaps = 1/55 (1%)
 Frame = +2

Query: 266 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLN-PKGNREKDD 427
           ++ PI+ G + N D   +IW H F + L +AP    +LLTEA L+ P   R  D+
Sbjct: 61  VRRPIDRGYLINSDLQREIWSHLFTSLLHIAPSSSSLLLTEAPLSIPSVQRTTDE 115



 Score = 32.7 bits (71), Expect = 7.6
 Identities = 13/31 (41%), Positives = 20/31 (64%)
 Frame = +3

Query: 90  LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRP 182
           +V+DNG G+ KAG  G+  P  V P+ + +P
Sbjct: 5   VVLDNGGGLIKAGQGGERDPTTVIPNCLYKP 35


>UniRef50_Q8LKR0 Cluster: Actin-related protein 6; n=26;
           Magnoliophyta|Rep: Actin-related protein 6 - Arabidopsis
           thaliana (Mouse-ear cress)
          Length = 422

 Score = 42.3 bits (95), Expect = 0.009
 Identities = 21/55 (38%), Positives = 31/55 (56%), Gaps = 1/55 (1%)
 Frame = +2

Query: 266 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLN-PKGNREKDD 427
           ++ PI+ G + N D   +IW H F + L +AP    +LLTEA L+ P   R  D+
Sbjct: 62  VRRPIDRGYLINSDLQREIWSHLFTSLLHIAPSSSSLLLTEAPLSIPSVQRTTDE 116


>UniRef50_Q54E71 Cluster: Putative uncharacterized protein; n=1;
           Dictyostelium discoideum AX4|Rep: Putative
           uncharacterized protein - Dictyostelium discoideum AX4
          Length = 684

 Score = 42.3 bits (95), Expect = 0.009
 Identities = 15/30 (50%), Positives = 24/30 (80%)
 Frame = +3

Query: 90  LVVDNGSGMCKAGFAGDDAPRAVFPSIVGR 179
           +++DNGS  C+AGFA D +P+ +F S+VG+
Sbjct: 33  IIIDNGSYQCRAGFANDISPKLIFRSLVGK 62


>UniRef50_A2DEE0 Cluster: Actin family protein; n=1; Trichomonas
           vaginalis G3|Rep: Actin family protein - Trichomonas
           vaginalis G3
          Length = 378

 Score = 42.3 bits (95), Expect = 0.009
 Identities = 16/51 (31%), Positives = 32/51 (62%)
 Frame = +2

Query: 263 TLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNR 415
           +L  P ++G +TN DD+E+++H+ F  E+ + PE+  V+++     P+  R
Sbjct: 73  SLYNPFKNGYITNPDDIERLFHYIFEKEIHINPEKKSVIISTPLNGPQSQR 123


>UniRef50_UPI0000498FDF Cluster: actin; n=1; Entamoeba histolytica
           HM-1:IMSS|Rep: actin - Entamoeba histolytica HM-1:IMSS
          Length = 763

 Score = 41.9 bits (94), Expect = 0.012
 Identities = 22/54 (40%), Positives = 31/54 (57%)
 Frame = +3

Query: 93  VVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKR 254
           ++D GS   K+GF     P  V P++VG+  HQ    G  +++ YVGDEA  KR
Sbjct: 425 IIDIGSCSIKSGFESVGTPSIVTPTVVGKNLHQ--TSGFVEQNLYVGDEAIDKR 476


>UniRef50_Q7M3Y5 Cluster: Actin; n=1; Aplysia californica|Rep: Actin
           - Aplysia californica (California sea hare)
          Length = 92

 Score = 41.5 bits (93), Expect = 0.016
 Identities = 19/20 (95%), Positives = 19/20 (95%)
 Frame = +3

Query: 81  VAALVVDNGSGMCKAGFAGD 140
           VAALVVDNGSGM KAGFAGD
Sbjct: 1   VAALVVDNGSGMXKAGFAGD 20



 Score = 37.9 bits (84), Expect = 0.20
 Identities = 17/21 (80%), Positives = 18/21 (85%)
 Frame = +2

Query: 335 FYNELRVAPEEHPVLLTEASL 397
           F  +LRVAPEEHPVLLTEA L
Sbjct: 17  FAGDLRVAPEEHPVLLTEAPL 37


>UniRef50_Q9Y7X8 Cluster: Actin-like protein Arp5; n=1;
           Schizosaccharomyces pombe|Rep: Actin-like protein Arp5 -
           Schizosaccharomyces pombe (Fission yeast)
          Length = 721

 Score = 41.5 bits (93), Expect = 0.016
 Identities = 17/43 (39%), Positives = 27/43 (62%)
 Frame = +2

Query: 275 PIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNP 403
           P E  +++NWD ME++  +TF  +L +   EHP+ +TE   NP
Sbjct: 86  PFERNVISNWDLMEQVLDYTFL-KLGIDRMEHPICMTEPLANP 127



 Score = 35.9 bits (79), Expect = 0.82
 Identities = 15/32 (46%), Positives = 22/32 (68%)
 Frame = +3

Query: 90  LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPR 185
           LV+DNGS   +AG+ G+  P+ VF ++V R R
Sbjct: 27  LVIDNGSWQLRAGWGGEKDPKLVFDNLVSRYR 58


>UniRef50_A6R1X8 Cluster: Putative uncharacterized protein; n=1;
           Ajellomyces capsulatus NAm1|Rep: Putative
           uncharacterized protein - Ajellomyces capsulatus NAm1
          Length = 444

 Score = 41.1 bits (92), Expect = 0.022
 Identities = 15/35 (42%), Positives = 26/35 (74%)
 Frame = +3

Query: 75  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGR 179
           +EV+A+++D G    +AGFAG+D P++V P+  G+
Sbjct: 15  DEVSAIILDPGYSTVRAGFAGEDTPKSVIPTCYGK 49



 Score = 30.7 bits (66), Expect(2) = 2.9
 Identities = 13/40 (32%), Positives = 23/40 (57%), Gaps = 1/40 (2%)
 Frame = +2

Query: 260 LTLKYPI-EHGIVTNWDDMEKIWHHTFYNELRVAPEEHPV 376
           L++  P+   GIV +WD  EK+W ++F + L      +P+
Sbjct: 72  LSIHNPMGREGIVEDWDAAEKVWEYSFTSRLTGPKSGNPL 111



 Score = 22.2 bits (45), Expect(2) = 2.9
 Identities = 9/19 (47%), Positives = 12/19 (63%)
 Frame = +2

Query: 365 EHPVLLTEASLNPKGNREK 421
           + P+L+TE   NP   REK
Sbjct: 139 DSPLLMTECGWNPVKAREK 157


>UniRef50_Q6C061 Cluster: Actin-related protein 4; n=1; Yarrowia
           lipolytica|Rep: Actin-related protein 4 - Yarrowia
           lipolytica (Candida lipolytica)
          Length = 432

 Score = 41.1 bits (92), Expect = 0.022
 Identities = 17/50 (34%), Positives = 29/50 (58%)
 Frame = +2

Query: 272 YPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           +P+  GIV +WD ++ IW ++    L    + HP++LTE   N + N+ K
Sbjct: 87  HPLTDGIVADWDAVQNIWEYSL-ARLNADTKTHPLMLTEPCWNTQANKLK 135



 Score = 37.1 bits (82), Expect = 0.35
 Identities = 15/34 (44%), Positives = 22/34 (64%)
 Frame = +3

Query: 75  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVG 176
           +EVA LV+D GS   + G+AG+D P+ V  +  G
Sbjct: 14  DEVATLVIDTGSSYTRVGYAGEDTPKLVVSTECG 47


>UniRef50_Q4P2E8 Cluster: Actin-related protein 4; n=1; Ustilago
           maydis|Rep: Actin-related protein 4 - Ustilago maydis
           (Smut fungus)
          Length = 534

 Score = 41.1 bits (92), Expect = 0.022
 Identities = 17/34 (50%), Positives = 23/34 (67%)
 Frame = +3

Query: 75  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVG 176
           +E+ ALV+D G    + G+AG+DAPR V PS  G
Sbjct: 8   DEINALVIDAGHSSSRVGWAGEDAPRVVLPSYYG 41


>UniRef50_UPI0000499930 Cluster: actin; n=1; Entamoeba histolytica
           HM-1:IMSS|Rep: actin - Entamoeba histolytica HM-1:IMSS
          Length = 372

 Score = 40.7 bits (91), Expect = 0.029
 Identities = 37/136 (27%), Positives = 54/136 (39%), Gaps = 2/136 (1%)
 Frame = +3

Query: 90  LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGD-EAQSKRVXXX 266
           +V+D GS  C+ G AG+  P  +FPS VG PR +  +    + D YVG    + KR    
Sbjct: 5   IVLDFGSQTCRVGNAGESMPTNIFPSYVGIPREKSQL----KPDFYVGKILKEQKREFQI 60

Query: 267 XXXXXXXXXXLTGMTWRRF-GIIPSTMSCVSPPRNTQSCLLRLPSTPRATERKMTQIMFE 443
                        M    F   +        P   T+  L      P+    K  Q++FE
Sbjct: 61  KSPIKNGTIEDISMASALFKNALDECQGYGKPILFTEPAL-----NPKQIREKTIQLLFE 115

Query: 444 TFNTPRHVRLAFKPVL 491
            F  P  V  + +P+L
Sbjct: 116 RFKVP-SVYFSIQPIL 130


>UniRef50_Q8IS27 Cluster: Actin-related protein 2; n=5;
           Oligohymenophorea|Rep: Actin-related protein 2 -
           Tetrahymena thermophila
          Length = 393

 Score = 40.3 bits (90), Expect = 0.038
 Identities = 32/128 (25%), Positives = 56/128 (43%), Gaps = 4/128 (3%)
 Frame = +3

Query: 90  LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRP--RHQGVMVGMGQKDSYVGDEAQSKRVXX 263
           +V D+G+G  K G+AGD+ P+   P+++GRP  R    +  +  K+  +G EA   +   
Sbjct: 7   IVCDSGTGYIKIGYAGDNFPKYSIPAMIGRPMLRFNQKIDDVELKEIMIGGEAAPYQAML 66

Query: 264 XXXXXXXXXXXLTGMTWRRFGII-PSTMSCVSPPRNTQSCLLRLPSTPRATERKMT-QIM 437
                       T   W+   ++   +   +       + L+  P    A  RK T +++
Sbjct: 67  ELTKPVEEG---TVKNWQDMELLWDYSFKKLGAETKGNTVLMTEPVLNPAQNRKKTAEVL 123

Query: 438 FETFNTPR 461
           FE FN  R
Sbjct: 124 FEQFNFGR 131


>UniRef50_Q9VEC3 Cluster: Actin-related protein 5; n=1; Drosophila
           melanogaster|Rep: Actin-related protein 5 - Drosophila
           melanogaster (Fruit fly)
          Length = 648

 Score = 40.3 bits (90), Expect = 0.038
 Identities = 19/54 (35%), Positives = 31/54 (57%), Gaps = 2/54 (3%)
 Frame = +2

Query: 266 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPE--EHPVLLTEASLNPKGNREK 421
           LK P E  ++TNW+  E+I+ + F        +  +HP++LTEA  NP   R++
Sbjct: 79  LKSPFERNVITNWNHQEQIFDYIFTKMGFDGQDKIDHPIILTEALANPNFCRQQ 132


>UniRef50_Q54KZ7 Cluster: Putative uncharacterized protein; n=1;
           Dictyostelium discoideum AX4|Rep: Putative
           uncharacterized protein - Dictyostelium discoideum AX4
          Length = 490

 Score = 39.9 bits (89), Expect = 0.050
 Identities = 15/40 (37%), Positives = 29/40 (72%), Gaps = 1/40 (2%)
 Frame = +2

Query: 275 PIEHGIVTNWDDMEKIWHHTF-YNELRVAPEEHPVLLTEA 391
           P+E G +TNW   ++IW + F  +++++ P+++ +LLTEA
Sbjct: 87  PMEKGYITNWGLEKEIWDYAFKRDDMKIKPQDYNLLLTEA 126


>UniRef50_Q4N7N1 Cluster: Actin, putative; n=2; Theileria|Rep:
           Actin, putative - Theileria parva
          Length = 383

 Score = 39.9 bits (89), Expect = 0.050
 Identities = 20/54 (37%), Positives = 32/54 (59%)
 Frame = +2

Query: 260 LTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           ++L + I+HG ++++D ME +W + F   L V  +  PVLLTEA      +R K
Sbjct: 62  MSLDHLIDHGHISDFDKMEGLWQYCF-TRLEVHSDCRPVLLTEAPFTSPKHRIK 114



 Score = 35.5 bits (78), Expect = 1.1
 Identities = 17/40 (42%), Positives = 24/40 (60%)
 Frame = +3

Query: 66  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPR 185
           M DE+   +V+DNGS   K G +G  +P  +  S+VG PR
Sbjct: 1   MADEQ--CVVIDNGSFSLKIGLSGSYSPSFIVHSVVGNPR 38


>UniRef50_Q12406 Cluster: Actin-related protein 7; n=2;
           Saccharomyces cerevisiae|Rep: Actin-related protein 7 -
           Saccharomyces cerevisiae (Baker's yeast)
          Length = 477

 Score = 39.9 bits (89), Expect = 0.050
 Identities = 15/40 (37%), Positives = 26/40 (65%)
 Frame = +2

Query: 287 GIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPK 406
           G+  NWD +E  W + +  +L+V+PEE P+++T  + N K
Sbjct: 75  GLPYNWDALEMQWRYLYDTQLKVSPEELPLVITMPATNGK 114


>UniRef50_Q6C0A9 Cluster: Yarrowia lipolytica chromosome F of strain
           CLIB122 of Yarrowia lipolytica; n=1; Yarrowia
           lipolytica|Rep: Yarrowia lipolytica chromosome F of
           strain CLIB122 of Yarrowia lipolytica - Yarrowia
           lipolytica (Candida lipolytica)
          Length = 427

 Score = 39.5 bits (88), Expect = 0.066
 Identities = 15/50 (30%), Positives = 28/50 (56%), Gaps = 1/50 (2%)
 Frame = +2

Query: 275 PIEHGIVTNWDDMEKIWHHTFYNELRVAP-EEHPVLLTEASLNPKGNREK 421
           P++ G + +WD + K+W +    +L+V    E+P+++TE   N    R K
Sbjct: 81  PVQDGCIQDWDGVAKLWEYAIKEKLKVDDLSEYPLVITEQMWNSSARRAK 130



 Score = 38.3 bits (85), Expect = 0.15
 Identities = 14/35 (40%), Positives = 24/35 (68%)
 Frame = +3

Query: 75  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGR 179
           +EV ++V++ GS   + GF+GDD P+ V P+  G+
Sbjct: 18  DEVTSIVIECGSSYTRVGFSGDDLPKVVIPTKYGK 52


>UniRef50_Q0H7S7 Cluster: Actin; n=29; Sordariomycetes|Rep: Actin -
           Phaeoacremonium sphinctrophorum
          Length = 39

 Score = 39.5 bits (88), Expect = 0.066
 Identities = 16/19 (84%), Positives = 18/19 (94%)
 Frame = +3

Query: 114 MCKAGFAGDDAPRAVFPSI 170
           MCKAGFAGDDAPRAVF ++
Sbjct: 1   MCKAGFAGDDAPRAVFRNL 19


>UniRef50_Q7M3Y6 Cluster: Actin homolog fat, testicular; n=3;
           Deuterostomia|Rep: Actin homolog fat, testicular -
           Pisaster ochraceus (Sea star)
          Length = 155

 Score = 39.1 bits (87), Expect = 0.088
 Identities = 16/22 (72%), Positives = 17/22 (77%)
 Frame = +3

Query: 393 PSTPRATERKMTQIMFETFNTP 458
           P  P+A   KMTQIMFETFNTP
Sbjct: 2   PLNPKANREKMTQIMFETFNTP 23


>UniRef50_Q6FMT7 Cluster: Similar to sp|Q12406 Saccharomyces
           cerevisiae YPR034w ARP7 Actin-like protein; n=1; Candida
           glabrata|Rep: Similar to sp|Q12406 Saccharomyces
           cerevisiae YPR034w ARP7 Actin-like protein - Candida
           glabrata (Yeast) (Torulopsis glabrata)
          Length = 529

 Score = 38.7 bits (86), Expect = 0.12
 Identities = 17/46 (36%), Positives = 29/46 (63%)
 Frame = +2

Query: 281 EHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNRE 418
           +HGI  NW  +E+++ + +  EL+V P E P+++T  S+    NRE
Sbjct: 87  DHGIPYNWKALERLYRYIYEKELKVDPSELPLVITLPSMT---NRE 129


>UniRef50_Q4WA13 Cluster: Chromatin remodeling complex subunit
           (Arp5), putative; n=14; Pezizomycotina|Rep: Chromatin
           remodeling complex subunit (Arp5), putative -
           Aspergillus fumigatus (Sartorya fumigata)
          Length = 757

 Score = 38.7 bits (86), Expect = 0.12
 Identities = 16/41 (39%), Positives = 28/41 (68%)
 Frame = +3

Query: 84  AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVG 206
           +A+V+DNGS + KAG++ D +PR + P ++ R R + +  G
Sbjct: 59  SAIVIDNGSSLLKAGWSFDVSPRFILPPVMSRYRDRKLNKG 99


>UniRef50_Q09849 Cluster: Uncharacterized protein C23D3.09; n=1;
           Schizosaccharomyces pombe|Rep: Uncharacterized protein
           C23D3.09 - Schizosaccharomyces pombe (Fission yeast)
          Length = 430

 Score = 38.7 bits (86), Expect = 0.12
 Identities = 20/57 (35%), Positives = 33/57 (57%)
 Frame = +3

Query: 75  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 245
           EE+ +LV+D GS   + G+AG+++P  + PS      + GV   +  ++ YV DE Q
Sbjct: 8   EEIPSLVIDPGSCWTRFGYAGEESPMTILPS------YYGVRSDVTGRNKYVVDELQ 58



 Score = 37.1 bits (82), Expect = 0.35
 Identities = 14/46 (30%), Positives = 27/46 (58%)
 Frame = +2

Query: 284 HGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           +GI+ +W+     W      +L+V P E+ +++TE S NP+  R++
Sbjct: 74  NGIIQDWESTLYTWERGLKEKLQVNPTEYAMMITEPSWNPQSVRQQ 119


>UniRef50_Q9NZ32 Cluster: Actin-related protein 10; n=40;
           Eumetazoa|Rep: Actin-related protein 10 - Homo sapiens
           (Human)
          Length = 417

 Score = 38.7 bits (86), Expect = 0.12
 Identities = 15/34 (44%), Positives = 21/34 (61%)
 Frame = +3

Query: 78  EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGR 179
           E  A+V+D G    K GFAG+  PR + PS++ R
Sbjct: 12  EKTAVVIDLGEAFTKCGFAGETGPRCIIPSVIKR 45


>UniRef50_Q18PR4 Cluster: Actin-related protein; n=1; Porphyra
           yezoensis|Rep: Actin-related protein - Porphyra
           yezoensis
          Length = 573

 Score = 38.3 bits (85), Expect = 0.15
 Identities = 16/35 (45%), Positives = 23/35 (65%)
 Frame = +3

Query: 72  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVG 176
           D  V ++V D GS  CK GFAG+D P +++ S +G
Sbjct: 5   DGTVPSVVFDFGSHTCKVGFAGEDLPHSLYSSNIG 39


>UniRef50_Q4P303 Cluster: Putative uncharacterized protein; n=1;
           Ustilago maydis|Rep: Putative uncharacterized protein -
           Ustilago maydis (Smut fungus)
          Length = 1173

 Score = 38.3 bits (85), Expect = 0.15
 Identities = 17/52 (32%), Positives = 30/52 (57%), Gaps = 1/52 (1%)
 Frame = +2

Query: 263 TLKYPIEHGIVTNWDDMEKIWHHTFYN-ELRVAPEEHPVLLTEASLNPKGNR 415
           +++ P +  +VT+WD ME +  +TF N  +     +HP+ +TE   NP  +R
Sbjct: 488 SIRSPFDTDVVTSWDAMEIVLDYTFSNLGIDTDRVQHPICMTETLCNPAYSR 539


>UniRef50_P80428 Cluster: Actin-related protein 4; n=4;
           Saccharomycetales|Rep: Actin-related protein 4 -
           Saccharomyces cerevisiae (Baker's yeast)
          Length = 489

 Score = 38.3 bits (85), Expect = 0.15
 Identities = 14/35 (40%), Positives = 25/35 (71%)
 Frame = +3

Query: 75  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGR 179
           +EV+A+V+D GS     G++G D P+++ PS+ G+
Sbjct: 12  DEVSAVVIDPGSYTTNIGYSGSDFPQSILPSVYGK 46



 Score = 38.3 bits (85), Expect = 0.15
 Identities = 21/53 (39%), Positives = 28/53 (52%), Gaps = 1/53 (1%)
 Frame = +2

Query: 266 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEH-PVLLTEASLNPKGNREK 421
           LK  IE+G+V +WD  ++ W     NEL +      P LLTE   N   NR+K
Sbjct: 71  LKPIIENGLVIDWDTAQEQWQWALQNELYLNSNSGIPALLTEPVWNSTENRKK 123


>UniRef50_Q6BIA3 Cluster: CA5059|IPF3691 Candida albicans IPF3691;
           n=5; Saccharomycetales|Rep: CA5059|IPF3691 Candida
           albicans IPF3691 - Debaryomyces hansenii (Yeast)
           (Torulaspora hansenii)
          Length = 450

 Score = 37.9 bits (84), Expect = 0.20
 Identities = 22/45 (48%), Positives = 25/45 (55%)
 Frame = +3

Query: 87  ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKD 221
           A+V+DNGS   KAGFA DD P  VF S      +  V VG  Q D
Sbjct: 7   AVVIDNGSHTTKAGFALDDLPSLVFNSNYVVDSNSKVQVGDKQVD 51


>UniRef50_Q293V2 Cluster: Actin-related protein 5; n=2; Drosophila
           pseudoobscura|Rep: Actin-related protein 5 - Drosophila
           pseudoobscura (Fruit fly)
          Length = 651

 Score = 37.9 bits (84), Expect = 0.20
 Identities = 20/54 (37%), Positives = 32/54 (59%), Gaps = 3/54 (5%)
 Frame = +2

Query: 266 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEE---HPVLLTEASLNPKGNRE 418
           LK P E  I+TNW+  E+I+ + F  ++    E+   +P++LTEA  NP   R+
Sbjct: 82  LKSPFERNIITNWNHQEQIFDYIF-TKMGFEGEQSIANPIVLTEALANPNFCRQ 134


>UniRef50_Q4Q187 Cluster: Actin-like protein, putative; n=3;
           Leishmania|Rep: Actin-like protein, putative -
           Leishmania major
          Length = 407

 Score = 37.5 bits (83), Expect = 0.27
 Identities = 17/55 (30%), Positives = 30/55 (54%)
 Frame = +2

Query: 257 ILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           +L+L YP+  G V ++D +EK+  +    E RV P+  P L    +   + +RE+
Sbjct: 69  LLSLTYPVRAGHVCDYDALEKLLFYALVEEARVTPDTSPFLFLVPADQTRLDRER 123



 Score = 34.3 bits (75), Expect = 2.5
 Identities = 14/34 (41%), Positives = 23/34 (67%)
 Frame = +3

Query: 81  VAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRP 182
           + ++VVD G+   + GF+G++APR +  S VG P
Sbjct: 8   IQSVVVDVGTRNTRVGFSGEEAPRTMLRSCVGLP 41


>UniRef50_A3FQE6 Cluster: Putative uncharacterized protein; n=2;
           Cryptosporidium|Rep: Putative uncharacterized protein -
           Cryptosporidium parvum Iowa II
          Length = 396

 Score = 37.5 bits (83), Expect = 0.27
 Identities = 13/36 (36%), Positives = 25/36 (69%)
 Frame = +3

Query: 84  AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQ 191
           +++++D G+   +AG+ GDD PR+V P+ +G P  +
Sbjct: 15  SSIILDIGTQSIRAGYGGDDLPRSVVPTCIGIPNKE 50


>UniRef50_Q0V0G6 Cluster: Putative uncharacterized protein; n=1;
           Phaeosphaeria nodorum|Rep: Putative uncharacterized
           protein - Phaeosphaeria nodorum (Septoria nodorum)
          Length = 443

 Score = 37.5 bits (83), Expect = 0.27
 Identities = 19/54 (35%), Positives = 26/54 (48%), Gaps = 5/54 (9%)
 Frame = +2

Query: 260 LTLKYPIEHGIVTNWDDMEKIWHHTFYNE-----LRVAPEEHPVLLTEASLNPK 406
           L  + P+E G + NW+  + IW H F         R  P+E  +LLTE    PK
Sbjct: 75  LAFRRPVEKGFIVNWEAEKAIWEHEFMEAAVVEGFRCDPKETNLLLTEKPNCPK 128


>UniRef50_Q7SHR0 Cluster: Actin-related protein 4; n=16;
           Pezizomycotina|Rep: Actin-related protein 4 - Neurospora
           crassa
          Length = 469

 Score = 37.5 bits (83), Expect = 0.27
 Identities = 16/34 (47%), Positives = 24/34 (70%)
 Frame = +3

Query: 75  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVG 176
           +EV+ALV+D G    +AG+AG++ P+ V PS  G
Sbjct: 20  DEVSALVLDPGYCNTRAGYAGEEMPKQVLPSFYG 53


>UniRef50_Q2H0E9 Cluster: Putative uncharacterized protein; n=1;
           Chaetomium globosum|Rep: Putative uncharacterized
           protein - Chaetomium globosum (Soil fungus)
          Length = 656

 Score = 37.1 bits (82), Expect = 0.35
 Identities = 19/56 (33%), Positives = 28/56 (50%), Gaps = 2/56 (3%)
 Frame = +3

Query: 84  AALVVDNGSGMCKAGFAGDDAPRAVFPSIVG--RPRHQGVMVGMGQKDSYVGDEAQ 245
           A +V+DNGS   +AG++ +D PR   P I+   R R  G       +D Y    A+
Sbjct: 54  AVIVIDNGSSTVRAGWSFEDKPRLAIPPIMSKYRDRKAGKTFSFAGQDCYADTTAR 109


>UniRef50_A7TST0 Cluster: Putative uncharacterized protein; n=1;
           Vanderwaltozyma polyspora DSM 70294|Rep: Putative
           uncharacterized protein - Vanderwaltozyma polyspora DSM
           70294
          Length = 501

 Score = 37.1 bits (82), Expect = 0.35
 Identities = 14/34 (41%), Positives = 23/34 (67%)
 Frame = +3

Query: 75  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVG 176
           +E++A+V+D GS     G++G D P+A+ PS  G
Sbjct: 12  DEISAVVIDPGSFTTNIGYSGTDCPQAILPSYYG 45


>UniRef50_A7TM96 Cluster: Putative uncharacterized protein; n=1;
           Vanderwaltozyma polyspora DSM 70294|Rep: Putative
           uncharacterized protein - Vanderwaltozyma polyspora DSM
           70294
          Length = 488

 Score = 37.1 bits (82), Expect = 0.35
 Identities = 14/33 (42%), Positives = 21/33 (63%)
 Frame = +2

Query: 287 GIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLT 385
           G+  NW+ +EK W + F  +L+  P E PVL+T
Sbjct: 73  GVPYNWEALEKQWEYIFEKQLKCDPTELPVLIT 105


>UniRef50_Q4UGT7 Cluster: Actin-related protein, putative; n=2;
           Theileria|Rep: Actin-related protein, putative -
           Theileria annulata
          Length = 575

 Score = 36.7 bits (81), Expect = 0.47
 Identities = 15/32 (46%), Positives = 22/32 (68%)
 Frame = +3

Query: 90  LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPR 185
           +V++NGSG  K G AG+  P  V P+ VG+P+
Sbjct: 12  VVLENGSGYVKIGMAGNKKPPHVIPNCVGQPK 43


>UniRef50_A6RD01 Cluster: Putative uncharacterized protein; n=1;
           Ajellomyces capsulatus NAm1|Rep: Putative
           uncharacterized protein - Ajellomyces capsulatus NAm1
          Length = 762

 Score = 36.7 bits (81), Expect = 0.47
 Identities = 14/34 (41%), Positives = 25/34 (73%)
 Frame = +3

Query: 84  AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPR 185
           +A+V+DNGS + KAG++ D +PR + P ++ + R
Sbjct: 111 SAIVIDNGSYLVKAGWSFDKSPRFIIPPVMAKYR 144


>UniRef50_UPI0000498A93 Cluster: actin; n=1; Entamoeba histolytica
           HM-1:IMSS|Rep: actin - Entamoeba histolytica HM-1:IMSS
          Length = 360

 Score = 36.3 bits (80), Expect = 0.62
 Identities = 15/50 (30%), Positives = 28/50 (56%)
 Frame = +2

Query: 272 YPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           YPI  G++++ DD+E I    F   + V     P+++TE +L P   +++
Sbjct: 57  YPINRGMISDCDDIEGILRFVFDENMGVDASTRPIIVTEEALCPNLRKQE 106


>UniRef50_A1C924 Cluster: Actin family protein; n=4;
           Eurotiomycetidae|Rep: Actin family protein - Aspergillus
           clavatus
          Length = 436

 Score = 36.3 bits (80), Expect = 0.62
 Identities = 17/52 (32%), Positives = 31/52 (59%), Gaps = 8/52 (15%)
 Frame = +2

Query: 260 LTLKYPIEHGIVTNWDDMEKIWHHTFYNE-------LRVA-PEEHPVLLTEA 391
           +  + P+E G + NW+  ++IW  +F++E       LR+  PE+  ++LTEA
Sbjct: 86  MAFRRPVEKGYIVNWEAQKEIWETSFFDEKTVRSKDLRIENPEDTTLVLTEA 137


>UniRef50_Q7S6X6 Cluster: Actin-like protein arp-6; n=5;
           Pezizomycotina|Rep: Actin-like protein arp-6 -
           Neurospora crassa
          Length = 446

 Score = 36.3 bits (80), Expect = 0.62
 Identities = 19/43 (44%), Positives = 26/43 (60%), Gaps = 4/43 (9%)
 Frame = +3

Query: 90  LVVDNGSGMCKAGFAGDD----APRAVFPSIVGRPRHQGVMVG 206
           LV+DNG+   KAGF  DD     PR + P+ + R RH+ + VG
Sbjct: 22  LVLDNGADTIKAGFVSDDKSDGKPR-IIPNCLARDRHRKIYVG 63



 Score = 34.7 bits (76), Expect = 1.9
 Identities = 14/48 (29%), Positives = 27/48 (56%), Gaps = 3/48 (6%)
 Frame = +2

Query: 254 SILTLKYPIEHGIVTNWDDMEKIWHHTFYNE---LRVAPEEHPVLLTE 388
           S L  + P+E G + NW+  ++IW   F+++    +  P +  ++LTE
Sbjct: 73  SELAFRRPVEKGFIVNWEAQKEIWDREFFDDKAAQKCDPSDTRLILTE 120


>UniRef50_Q6CSB9 Cluster: Actin-related protein 4; n=1;
           Kluyveromyces lactis|Rep: Actin-related protein 4 -
           Kluyveromyces lactis (Yeast) (Candida sphaerica)
          Length = 520

 Score = 36.3 bits (80), Expect = 0.62
 Identities = 14/40 (35%), Positives = 24/40 (60%)
 Frame = +3

Query: 75  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQG 194
           +E+ A+V+D GS +   G++G D P+++ PS  G     G
Sbjct: 12  DEINAIVIDPGSFVTNIGYSGTDCPQSIMPSSYGNVETDG 51



 Score = 34.7 bits (76), Expect = 1.9
 Identities = 25/90 (27%), Positives = 41/90 (45%), Gaps = 2/90 (2%)
 Frame = +2

Query: 158 VPLDRGKAPPSGRDGR-YGTEGLLCRR*GTEQKSILTLKYPIEHGIVTNWDDMEKIWHHT 334
           +P   G     G   R +  + LL  R G E K I      +E+  + +WD  ++ W + 
Sbjct: 40  MPSSYGNVETDGDTKRIFNEQPLLFPRAGMEIKPI------VENSTIVDWDRAQEQWEYA 93

Query: 335 FYNELRVAPEE-HPVLLTEASLNPKGNREK 421
              +L+    +  PVLLTE   N + +R+K
Sbjct: 94  LNTDLKFESNKGTPVLLTEPIWNSEASRKK 123


>UniRef50_Q19R56 Cluster: Actin-like protein 3; n=4; Trypanosoma
           cruzi|Rep: Actin-like protein 3 - Trypanosoma cruzi
           strain CL Brener
          Length = 426

 Score = 35.9 bits (79), Expect = 0.82
 Identities = 12/21 (57%), Positives = 17/21 (80%)
 Frame = +2

Query: 245 EQKSILTLKYPIEHGIVTNWD 307
           E++ +L L YPI+HGI+ NWD
Sbjct: 57  ERRGLLHLTYPIQHGIIVNWD 77


>UniRef50_Q6C982 Cluster: Actin-like protein ARP6; n=1; Yarrowia
           lipolytica|Rep: Actin-like protein ARP6 - Yarrowia
           lipolytica (Candida lipolytica)
          Length = 387

 Score = 35.9 bits (79), Expect = 0.82
 Identities = 16/46 (34%), Positives = 23/46 (50%)
 Frame = +2

Query: 260 LTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASL 397
           L  K P E G + NWD  + +W + FYN       +  +LLT+  L
Sbjct: 47  LVFKRPSEKGQLINWDIQKAVWDNLFYNPQTGVDTDSSLLLTQYPL 92


>UniRef50_Q6BXN0 Cluster: Actin-related protein 4; n=7;
           Saccharomycetales|Rep: Actin-related protein 4 -
           Debaryomyces hansenii (Yeast) (Torulaspora hansenii)
          Length = 492

 Score = 35.9 bits (79), Expect = 0.82
 Identities = 15/49 (30%), Positives = 28/49 (57%)
 Frame = +3

Query: 75  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKD 221
           +E+ A+V+D+ S   + G+AGDD P+ + PS    P    + +   +K+
Sbjct: 14  DEINAIVLDSSSFHTRIGYAGDDFPKIITPSSYASPNEDAMELDNKKKN 62


>UniRef50_A3PQT7 Cluster: Binding-protein-dependent transport
           systems inner membrane component; n=4;
           Proteobacteria|Rep: Binding-protein-dependent transport
           systems inner membrane component - Rhodobacter
           sphaeroides (strain ATCC 17029 / ATH 2.4.9)
          Length = 377

 Score = 35.5 bits (78), Expect = 1.1
 Identities = 29/91 (31%), Positives = 41/91 (45%), Gaps = 3/91 (3%)
 Frame = +3

Query: 372 QSCLLRLPSTPRATERKMTQIMFETFNTPRHVRLAFKPVLLAVRLP---SVPPGIRAGTS 542
           Q+ +L  PST  A   ++  +  +      H+  + K  LLA  L     VP G   G S
Sbjct: 142 QASILPAPSTILARAVELLGLTGDRAVLFGHIGASLKRALLAFALAVAVGVPLGFLLGLS 201

Query: 543 REPVFFHNPCPILPKGIPHFSPTPISLAVFG 635
           RE   + +P   L   +P  + TPI L VFG
Sbjct: 202 REAQLWMSPILSLMLPLPAVAWTPILLVVFG 232


>UniRef50_A7AQU0 Cluster: Actin-related, putative; n=1; Babesia
           bovis|Rep: Actin-related, putative - Babesia bovis
          Length = 508

 Score = 35.1 bits (77), Expect = 1.4
 Identities = 16/49 (32%), Positives = 24/49 (48%)
 Frame = +3

Query: 93  VVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDE 239
           VVDNGSG+ K   A    P  V P+ +G P+ +     +    +  GD+
Sbjct: 13  VVDNGSGLLKFSLASSVKPPFVLPNCIGHPKRKFTSQNLADGSASGGDD 61


>UniRef50_Q5AXH1 Cluster: Actin-like protein arp6; n=5;
           Trichocomaceae|Rep: Actin-like protein arp6 - Emericella
           nidulans (Aspergillus nidulans)
          Length = 479

 Score = 35.1 bits (77), Expect = 1.4
 Identities = 16/52 (30%), Positives = 30/52 (57%), Gaps = 8/52 (15%)
 Frame = +2

Query: 260 LTLKYPIEHGIVTNWDDMEKIWHHTFYN-------ELRVA-PEEHPVLLTEA 391
           +  + P+E G   NW+  ++IW ++F++       EL +A PE+  ++ TEA
Sbjct: 86  MLFRRPVEKGYTVNWEAQKEIWENSFFDERTVRSKELHIADPEDVTIIFTEA 137


>UniRef50_UPI0000E4A464 Cluster: PREDICTED: similar to thyroid
           hormone receptor-associated protein complex component
           TRAP230; n=5; Strongylocentrotus purpuratus|Rep:
           PREDICTED: similar to thyroid hormone
           receptor-associated protein complex component TRAP230 -
           Strongylocentrotus purpuratus
          Length = 990

 Score = 34.7 bits (76), Expect = 1.9
 Identities = 30/96 (31%), Positives = 45/96 (46%), Gaps = 4/96 (4%)
 Frame = +3

Query: 354 SPPRNTQSCLLRLPSTPRATERKMTQIMFETFNTPRH--VRLAFKPVLLAV--RLPSVPP 521
           SP  NT S +   P+TP  ++  +  I+ E  + P+H  + L    VL A+  R PS   
Sbjct: 258 SPHLNTSSNVQLPPNTPPHSQHALASILAEFRSCPQHHSIILGLSCVLQAITLRCPSALV 317

Query: 522 GIRAGTSREPVFFHNPCPILPKGIPHFSPTPISLAV 629
            I  G S+      +P  ILP   P   P P S+++
Sbjct: 318 WINLGESKNYSVPGSPLDILPCP-PSLLPLPGSVSM 352


>UniRef50_A6CGF0 Cluster: Cation efflux system protein,
           AcrB/AcrD/AcrF family protein; n=2; Bacteria|Rep: Cation
           efflux system protein, AcrB/AcrD/AcrF family protein -
           Planctomyces maris DSM 8797
          Length = 1146

 Score = 34.7 bits (76), Expect = 1.9
 Identities = 20/53 (37%), Positives = 25/53 (47%)
 Frame = +2

Query: 158 VPLDRGKAPPSGRDGRYGTEGLLCRR*GTEQKSILTLKYPIEHGIVTNWDDME 316
           V + R K P  G     G  GLL  R   E K ILTL  P+E   ++ W  +E
Sbjct: 140 VGIHRRKGPQGGTLIPVGQTGLLAERTEREGKPILTLWNPVERNDLSRWQKVE 192


>UniRef50_Q8I450 Cluster: Actin-related protein, putative; n=5;
           Plasmodium|Rep: Actin-related protein, putative -
           Plasmodium falciparum (isolate 3D7)
          Length = 565

 Score = 34.7 bits (76), Expect = 1.9
 Identities = 15/35 (42%), Positives = 22/35 (62%)
 Frame = +3

Query: 78  EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRP 182
           ++ ++V+D G    K G+AGD+ P  VF S VG P
Sbjct: 6   DILSIVIDLGFENTKVGYAGDENPTNVFSSNVGMP 40


>UniRef50_Q7QA11 Cluster: ENSANGP00000003921; n=1; Anopheles gambiae
           str. PEST|Rep: ENSANGP00000003921 - Anopheles gambiae
           str. PEST
          Length = 390

 Score = 34.7 bits (76), Expect = 1.9
 Identities = 14/32 (43%), Positives = 22/32 (68%)
 Frame = +3

Query: 90  LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPR 185
           +V+DNGS  C+AG+   + P  VF +I+ +PR
Sbjct: 5   IVIDNGSFNCRAGWMLKEKPALVFRNILAKPR 36


>UniRef50_Q6GDP8 Cluster: Ferrous iron transport protein B; n=42;
           Bacillales|Rep: Ferrous iron transport protein B -
           Staphylococcus aureus (strain MRSA252)
          Length = 664

 Score = 34.7 bits (76), Expect = 1.9
 Identities = 21/64 (32%), Positives = 34/64 (53%)
 Frame = -1

Query: 436 MIWVIFLSVALGVEGSLSKQDWVFLGGDTQLIVEGMMPNLLHVIPVSDDSVFDGVFEGQD 257
           ++W+IF +    +   LS Q   F+GG     V+ +M N L VIP   D + DG+  G  
Sbjct: 289 IMWLIFQTTFTWIGTPLSDQLDAFIGGTFTDSVKTIM-NYLGVIPFLQDLITDGIIAGVG 347

Query: 256 TLLL 245
           ++L+
Sbjct: 348 SVLV 351


>UniRef50_Q7RR61 Cluster: Actin-like 6; n=3; Plasmodium
           (Vinckeia)|Rep: Actin-like 6 - Plasmodium yoelii yoelii
          Length = 538

 Score = 34.3 bits (75), Expect = 2.5
 Identities = 14/35 (40%), Positives = 24/35 (68%)
 Frame = +3

Query: 78  EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRP 182
           +V+++V+D G    K G++GD+ P+ +F S VG P
Sbjct: 6   DVSSIVIDLGFENIKLGYSGDENPKNIFSSNVGVP 40


>UniRef50_Q7Q440 Cluster: ENSANGP00000021850; n=1; Anopheles gambiae
            str. PEST|Rep: ENSANGP00000021850 - Anopheles gambiae
            str. PEST
          Length = 1289

 Score = 34.3 bits (75), Expect = 2.5
 Identities = 17/61 (27%), Positives = 30/61 (49%), Gaps = 4/61 (6%)
 Frame = +2

Query: 239  GTEQKSILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVA----PEEHPVLLTEASLNPK 406
            GT+QK  +T       G+  +W      W  +  + + VA    PE+  VL+++  +NP+
Sbjct: 1044 GTDQKPFITKDIVSPEGVAVDWISRRLYWTDSAKDTIEVASLDNPEQRTVLISKFLVNPR 1103

Query: 407  G 409
            G
Sbjct: 1104 G 1104


>UniRef50_Q09443 Cluster: Actin-like protein C08B11.6; n=2;
           Caenorhabditis|Rep: Actin-like protein C08B11.6 -
           Caenorhabditis elegans
          Length = 418

 Score = 34.3 bits (75), Expect = 2.5
 Identities = 12/21 (57%), Positives = 14/21 (66%)
 Frame = +2

Query: 275 PIEHGIVTNWDDMEKIWHHTF 337
           PIE G V NWD  ++IW  TF
Sbjct: 62  PIERGYVVNWDTQQQIWEKTF 82


>UniRef50_UPI0000E46266 Cluster: PREDICTED: similar to actin; n=1;
           Strongylocentrotus purpuratus|Rep: PREDICTED: similar to
           actin - Strongylocentrotus purpuratus
          Length = 341

 Score = 33.9 bits (74), Expect = 3.3
 Identities = 13/43 (30%), Positives = 24/43 (55%)
 Frame = +2

Query: 293 VTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           VT+WD  E+I  H  + + ++   +HP++L E     +  R+K
Sbjct: 61  VTDWDSFEQIIQHAIWTKSKIKSSDHPLVLIEKPGLERSCRQK 103


>UniRef50_Q2J6P3 Cluster: Putative uncharacterized protein; n=2;
           Frankia|Rep: Putative uncharacterized protein - Frankia
           sp. (strain CcI3)
          Length = 216

 Score = 33.9 bits (74), Expect = 3.3
 Identities = 20/47 (42%), Positives = 26/47 (55%)
 Frame = -1

Query: 541 EVPARIPGGTDGRRTARSTGLNAKRTWRGVLNVSNMIWVIFLSVALG 401
           EVPAR+     G R+ARS GL   R +R VL     +  + L VA+G
Sbjct: 10  EVPARV--NAVGDRSARSAGLAGVREYRSVLVPVAFVVAVLLGVAIG 54


>UniRef50_Q9LZY1 Cluster: Actin-like protein; n=4; core
           eudicotyledons|Rep: Actin-like protein - Arabidopsis
           thaliana (Mouse-ear cress)
          Length = 368

 Score = 33.9 bits (74), Expect = 3.3
 Identities = 17/50 (34%), Positives = 25/50 (50%), Gaps = 1/50 (2%)
 Frame = +2

Query: 275 PIEHGIVTNWDDMEKIWHHTFYNELR-VAPEEHPVLLTEASLNPKGNREK 421
           PIE G++ +WD ME +  +  Y  L      E  +L T+    PK  RE+
Sbjct: 57  PIERGLIRDWDAMEDLLRYVVYTGLGWEEGNEGNILFTDPLCTPKAIREQ 106


>UniRef50_Q75BT7 Cluster: ACR184Cp; n=1; Eremothecium gossypii|Rep:
           ACR184Cp - Ashbya gossypii (Yeast) (Eremothecium
           gossypii)
          Length = 401

 Score = 33.9 bits (74), Expect = 3.3
 Identities = 13/33 (39%), Positives = 21/33 (63%)
 Frame = +2

Query: 287 GIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLT 385
           G+ T+W+ +E+     +  +LRV PEE PV +T
Sbjct: 65  GVPTDWEMLERFCRWIYATQLRVGPEELPVCIT 97


>UniRef50_UPI0000F2D271 Cluster: PREDICTED: similar to actin-like 8;
           n=1; Monodelphis domestica|Rep: PREDICTED: similar to
           actin-like 8 - Monodelphis domestica
          Length = 370

 Score = 33.5 bits (73), Expect = 4.4
 Identities = 15/42 (35%), Positives = 24/42 (57%)
 Frame = +2

Query: 260 LTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLT 385
           L  ++PI  G V NW+ ME +  + F   L +  E+H +L+T
Sbjct: 63  LPTEFPIVRGQVKNWEAMETVLTYAF-ESLGIKTEDHAILVT 103


>UniRef50_UPI0000E477BD Cluster: PREDICTED: similar to
           uncharacterized hypothalamus protein HARP11; n=1;
           Strongylocentrotus purpuratus|Rep: PREDICTED: similar to
           uncharacterized hypothalamus protein HARP11 -
           Strongylocentrotus purpuratus
          Length = 481

 Score = 33.5 bits (73), Expect = 4.4
 Identities = 15/30 (50%), Positives = 18/30 (60%)
 Frame = +3

Query: 78  EVAALVVDNGSGMCKAGFAGDDAPRAVFPS 167
           E  A V D G+   K GFAG+ +PRA  PS
Sbjct: 12  EKTAAVFDIGAAYTKVGFAGETSPRATIPS 41


>UniRef50_Q95XG3 Cluster: Putative uncharacterized protein; n=5;
           Caenorhabditis|Rep: Putative uncharacterized protein -
           Caenorhabditis elegans
          Length = 488

 Score = 33.5 bits (73), Expect = 4.4
 Identities = 22/74 (29%), Positives = 35/74 (47%), Gaps = 3/74 (4%)
 Frame = +3

Query: 354 SPPRNTQSCLLRLPSTPRATERKMTQIMFETFNTPRHVRL---AFKPVLLAVRLPSVPPG 524
           +P    + CL+ L    + T +++   +   FN P+H+R     FKP  + V L    P 
Sbjct: 163 TPECEAEDCLIELMFIKKWTCKQLDYNICTEFNQPQHLRRLVHMFKPTDITVSL-HFGPY 221

Query: 525 IRAGTSREPVFFHN 566
           I + T+ EP   HN
Sbjct: 222 IPSATAHEPNSMHN 235


>UniRef50_A5KAY0 Cluster: Actin-related protein, putative; n=1;
           Plasmodium vivax|Rep: Actin-related protein, putative -
           Plasmodium vivax
          Length = 600

 Score = 33.5 bits (73), Expect = 4.4
 Identities = 15/35 (42%), Positives = 22/35 (62%)
 Frame = +3

Query: 78  EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRP 182
           ++ ++VVD G    K G+AGD+ P  +F S VG P
Sbjct: 6   DILSIVVDLGFENTKIGYAGDENPTNIFSSNVGVP 40


>UniRef50_A7EFN6 Cluster: Putative uncharacterized protein; n=1;
            Sclerotinia sclerotiorum 1980|Rep: Putative
            uncharacterized protein - Sclerotinia sclerotiorum 1980
          Length = 1510

 Score = 33.5 bits (73), Expect = 4.4
 Identities = 17/45 (37%), Positives = 26/45 (57%), Gaps = 2/45 (4%)
 Frame = -3

Query: 161  EHGARSIISCETGLAHTGAIVYYQRG--NFFVAHLELVKLVRCRC 33
            EH A++I SC T + H GA V Y +G  +  +A+L+  K +   C
Sbjct: 1250 EHSAQAIFSCATVVIHNGADVSYLKGYSSLRIANLQSTKELAALC 1294


>UniRef50_Q5KAQ4 Cluster: Actin-like protein ARP6; n=1;
           Filobasidiella neoformans|Rep: Actin-like protein ARP6 -
           Cryptococcus neoformans (Filobasidiella neoformans)
          Length = 490

 Score = 33.5 bits (73), Expect = 4.4
 Identities = 16/48 (33%), Positives = 24/48 (50%), Gaps = 1/48 (2%)
 Frame = +2

Query: 260 LTLKYPIEHGIVTNWDDMEKIWHHTFY-NELRVAPEEHPVLLTEASLN 400
           +  + P E G++ NWD    IW   F  + L + P E  +L+TE   N
Sbjct: 58  IVYRRPFEKGMLVNWDAERIIWDRLFSPSVLNINPTETSLLVTEPYFN 105


>UniRef50_UPI0000E4A0BF Cluster: PREDICTED: similar to Actin-related
           protein 5; n=2; Strongylocentrotus purpuratus|Rep:
           PREDICTED: similar to Actin-related protein 5 -
           Strongylocentrotus purpuratus
          Length = 602

 Score = 33.1 bits (72), Expect = 5.8
 Identities = 12/32 (37%), Positives = 20/32 (62%)
 Frame = +3

Query: 90  LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPR 185
           +++DNGS   + G+A +  PR  F +I+ R R
Sbjct: 93  IIIDNGSCFSRVGWASEGTPRLTFRNIIARQR 124



 Score = 32.7 bits (71), Expect = 7.6
 Identities = 17/49 (34%), Positives = 27/49 (55%), Gaps = 3/49 (6%)
 Frame = +2

Query: 266 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPE---EHPVLLTEASLNP 403
           LK   +  +VT++D  E+I  H F   L +  E   +HP+++TE   NP
Sbjct: 147 LKTQFDRDVVTHYDAQEQILDHAF-QRLGIDSEGAVKHPIVMTETPCNP 194


>UniRef50_UPI0000E254E7 Cluster: PREDICTED: similar to putative cell
           wall protein FLO11p, partial; n=1; Pan troglodytes|Rep:
           PREDICTED: similar to putative cell wall protein FLO11p,
           partial - Pan troglodytes
          Length = 295

 Score = 33.1 bits (72), Expect = 5.8
 Identities = 15/31 (48%), Positives = 18/31 (58%)
 Frame = -2

Query: 231 LHKSPSVPYRPSRPDGGAFPRSRGTRREEHH 139
           LH++PS P  PS PD  + PRS  T   E H
Sbjct: 45  LHRTPSHPRSPSTPDTESHPRSPSTPDTESH 75


>UniRef50_UPI000069FC4E Cluster: Uncharacterized protein KIAA2032.;
           n=2; Xenopus tropicalis|Rep: Uncharacterized protein
           KIAA2032. - Xenopus tropicalis
          Length = 920

 Score = 33.1 bits (72), Expect = 5.8
 Identities = 33/105 (31%), Positives = 44/105 (41%), Gaps = 3/105 (2%)
 Frame = +3

Query: 324 GIIPSTMSCVSPPRNTQSCLLRLPSTPRATERKMTQIMFETFNTPRHVRLAFKPVLLAVR 503
           GI   T     PP+ T S L   PSTP  +  K  Q    T  T    R A  P L +  
Sbjct: 322 GICMPTPLPAFPPQTTSSVLSPKPSTPTPSVIKSIQTPSSTPTTANSARSAQSPALFS-S 380

Query: 504 LP--SVPPGIRAGTSREPVFFHNPCPILP-KGIPHFSPTPISLAV 629
           LP  +VP    + T       ++  P +P  G+P FS T  + +V
Sbjct: 381 LPHTAVPTQQVSSTPSSSSVLNDNLPSVPLAGLP-FSATTSTASV 424


>UniRef50_Q0S0C2 Cluster: Putative uncharacterized protein; n=1;
           Rhodococcus sp. RHA1|Rep: Putative uncharacterized
           protein - Rhodococcus sp. (strain RHA1)
          Length = 862

 Score = 33.1 bits (72), Expect = 5.8
 Identities = 19/59 (32%), Positives = 33/59 (55%)
 Frame = -3

Query: 287 RVRWGI*GSGYSFALCLISYIRVLLSHTDHHALMAGPSHDRGEHGARSIISCETGLAHT 111
           RVR G+ G+  S AL ++ +I  + + +    +++GPSHD  +H A  I + + G   T
Sbjct: 27  RVRGGVRGAPISMALLVVIWILAIATSS----VISGPSHDLSQHVAIGIRAFQNGWVWT 81


>UniRef50_Q8SRZ3 Cluster: ACTIN-RELATED PROTEIN; n=1;
           Encephalitozoon cuniculi|Rep: ACTIN-RELATED PROTEIN -
           Encephalitozoon cuniculi
          Length = 555

 Score = 33.1 bits (72), Expect = 5.8
 Identities = 13/32 (40%), Positives = 24/32 (75%)
 Frame = +3

Query: 90  LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPR 185
           +V+DNG+  CKAG+ G ++P+ VF +++ R +
Sbjct: 23  IVIDNGTYECKAGYCG-ESPQMVFKNVLYRQK 53


>UniRef50_Q2UQI4 Cluster: Predicted protein; n=1; Aspergillus
            oryzae|Rep: Predicted protein - Aspergillus oryzae
          Length = 1793

 Score = 33.1 bits (72), Expect = 5.8
 Identities = 22/63 (34%), Positives = 27/63 (42%), Gaps = 1/63 (1%)
 Frame = +3

Query: 390  LPSTPRATERKMTQIMFETFNTPRHVRLAFKPVLLAVRLPSVP-PGIRAGTSREPVFFHN 566
            + S P     K+TQ   E      H R +FKPV      PS P P  R   S  P+ F +
Sbjct: 1262 IQSKPATEFEKLTQKFEEAHGDVEHRRDSFKPVPPPKAAPSTPTPEFRQSRS-SPIHFSS 1320

Query: 567  PCP 575
            P P
Sbjct: 1321 PSP 1323


>UniRef50_Q0UJ41 Cluster: Putative uncharacterized protein; n=1;
           Phaeosphaeria nodorum|Rep: Putative uncharacterized
           protein - Phaeosphaeria nodorum (Septoria nodorum)
          Length = 645

 Score = 33.1 bits (72), Expect = 5.8
 Identities = 17/47 (36%), Positives = 27/47 (57%), Gaps = 1/47 (2%)
 Frame = +3

Query: 321 FGIIPSTMSCVSPPRNTQSCLLRLPS-TPRATERKMTQIMFETFNTP 458
           + ++    + ++PP +T   L+  P+ TPR  E K+TQ  FE F TP
Sbjct: 115 YALLTHVYNTLNPPFHTAILLIAQPAWTPREHE-KLTQFFFEKFKTP 160


>UniRef50_Q8NK72 Cluster: DNA repair and recombination protein
           rhm52; n=2; Magnaporthe grisea|Rep: DNA repair and
           recombination protein rhm52 - Magnaporthe grisea (Rice
           blast fungus) (Pyricularia grisea)
          Length = 565

 Score = 33.1 bits (72), Expect = 5.8
 Identities = 22/70 (31%), Positives = 29/70 (41%)
 Frame = +3

Query: 375 SCLLRLPSTPRATERKMTQIMFETFNTPRHVRLAFKPVLLAVRLPSVPPGIRAGTSREPV 554
           +C+       + T+ K+    F+  N  RH   A K V+   RLP V P      S  P 
Sbjct: 160 NCVYDKAYLAKVTKLKVEPTKFDELNLHRHADFAKKDVVAEPRLPPVKPEPSNTASAAP- 218

Query: 555 FFHNPCPILP 584
             H P P LP
Sbjct: 219 --HPPLPPLP 226


>UniRef50_A5E5Q2 Cluster: Putative uncharacterized protein; n=1;
           Lodderomyces elongisporus NRRL YB-4239|Rep: Putative
           uncharacterized protein - Lodderomyces elongisporus
           (Yeast) (Saccharomyces elongisporus)
          Length = 541

 Score = 32.7 bits (71), Expect = 7.6
 Identities = 15/43 (34%), Positives = 26/43 (60%)
 Frame = +3

Query: 75  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMV 203
           +E+ A+++D G+   + G+AGDD P+ +  S  G+   QG  V
Sbjct: 13  DEINAIILDIGTHTTRIGYAGDDFPKIITTSNYGK-TSQGTKV 54


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 782,491,439
Number of Sequences: 1657284
Number of extensions: 19413677
Number of successful extensions: 63042
Number of sequences better than 10.0: 179
Number of HSP's better than 10.0 without gapping: 58327
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 62968
length of database: 575,637,011
effective HSP length: 97
effective length of database: 414,880,463
effective search space used: 47296372782
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).