SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0002
         (607 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_Q2HZG0 Cluster: Yellow; n=2; Bombyx mori|Rep: Yellow - ...   182   4e-45
UniRef50_A6P3A9 Cluster: Yellow; n=1; Papilio xuthus|Rep: Yellow...   134   2e-30
UniRef50_P09957 Cluster: Protein yellow precursor; n=68; Endopte...    91   2e-17
UniRef50_Q17AD1 Cluster: Dopachrome-conversion enzyme (DCE) isoe...    83   5e-15
UniRef50_Q9VJQ3 Cluster: CG4182-PA; n=5; Neoptera|Rep: CG4182-PA...    81   2e-14
UniRef50_Q7Q0L3 Cluster: ENSANGP00000014433; n=1; Anopheles gamb...    79   8e-14
UniRef50_Q2HZG4 Cluster: Yellow-c; n=2; Endopterygota|Rep: Yello...    75   1e-12
UniRef50_UPI00015B44CA Cluster: PREDICTED: similar to yellow-f-l...    73   4e-12
UniRef50_Q6DLY9 Cluster: Yellow-f-like protein; n=1; Apis mellif...    72   9e-12
UniRef50_A0EM58 Cluster: Yellow-h; n=1; Apis mellifera|Rep: Yell...    70   4e-11
UniRef50_Q9V4C0 Cluster: CG1629-PA; n=2; Drosophila melanogaster...    68   2e-10
UniRef50_UPI0000D56BC9 Cluster: PREDICTED: similar to CG1629-PA;...    66   5e-10
UniRef50_UPI00015B6109 Cluster: PREDICTED: similar to ENSANGP000...    64   3e-09
UniRef50_UPI00015B581D Cluster: PREDICTED: similar to yellow-b; ...    62   1e-08
UniRef50_UPI00003C0916 Cluster: PREDICTED: similar to yellow-h C...    61   2e-08
UniRef50_Q9VJI5 Cluster: CG17914-PA; n=5; Endopterygota|Rep: CG1...    60   4e-08
UniRef50_A0EM59 Cluster: Yellow e3-like protein; n=1; Apis melli...    58   2e-07
UniRef50_Q7Q8V5 Cluster: ENSANGP00000016302; n=1; Anopheles gamb...    56   5e-07
UniRef50_UPI00015B58E7 Cluster: PREDICTED: similar to ENSANGP000...    56   9e-07
UniRef50_UPI00015B4E4E Cluster: PREDICTED: similar to ENSANGP000...    55   1e-06
UniRef50_UPI0000DB7359 Cluster: PREDICTED: similar to yellow-b C...    54   2e-06
UniRef50_UPI0000D56E2A Cluster: PREDICTED: similar to CG17914-PA...    54   2e-06
UniRef50_Q2HZG2 Cluster: Yellow-b; n=1; Bombyx mori|Rep: Yellow-...    53   5e-06
UniRef50_UPI00015B6399 Cluster: PREDICTED: similar to yellow e3-...    52   8e-06
UniRef50_UPI0000D55BA7 Cluster: PREDICTED: similar to Yellow pro...    52   8e-06
UniRef50_Q7PHB5 Cluster: ENSANGP00000022789; n=2; Anopheles gamb...    52   1e-05
UniRef50_UPI00015B6108 Cluster: PREDICTED: similar to ENSANGP000...    52   1e-05
UniRef50_Q2HZG5 Cluster: Yellow-fa; n=2; Bombyx mori|Rep: Yellow...    50   3e-05
UniRef50_UPI00015B6395 Cluster: PREDICTED: similar to major roya...    49   1e-04
UniRef50_UPI0000D56D70 Cluster: PREDICTED: similar to CG8063-PA;...    48   1e-04
UniRef50_Q9VG08 Cluster: CG8063-PA; n=3; Drosophila melanogaster...    47   4e-04
UniRef50_Q7QB87 Cluster: ENSANGP00000011250; n=2; Culicidae|Rep:...    47   4e-04
UniRef50_O97432 Cluster: Major royal jelly protein 5 precursor; ...    46   5e-04
UniRef50_Q8MZM5 Cluster: Dopachrome conversion enzyme; n=10; Cul...    46   7e-04
UniRef50_Q17060 Cluster: Major royal jelly protein 3 precursor; ...    46   7e-04
UniRef50_UPI00015B639A Cluster: PREDICTED: hypothetical protein;...    46   0.001
UniRef50_Q9W1R1 Cluster: CG9889-PA; n=3; Sophophora|Rep: CG9889-...    45   0.002
UniRef50_A0NDC3 Cluster: ENSANGP00000031925; n=1; Anopheles gamb...    44   0.003
UniRef50_UPI0000D56BC7 Cluster: PREDICTED: similar to CG9891-PA;...    42   0.009
UniRef50_UPI0000D55BA5 Cluster: PREDICTED: similar to CG17914-PA...    42   0.009
UniRef50_Q9VFV2 Cluster: CG17044-PA; n=4; Sophophora|Rep: CG1704...    42   0.011
UniRef50_Q2HZG3 Cluster: Yellow-fb; n=1; Bombyx mori|Rep: Yellow...    39   0.080
UniRef50_Q17BS0 Cluster: Putative uncharacterized protein; n=1; ...    39   0.11 
UniRef50_Q0C7C7 Cluster: Dopachrome-conversion enzyme (DCE), put...    39   0.11 
UniRef50_Q9W029 Cluster: CG5717-PA; n=5; Endopterygota|Rep: CG57...    38   0.24 
UniRef50_Q0C7C6 Cluster: Dopachrome-conversion enzyme (DCE), put...    38   0.24 
UniRef50_Q9W028 Cluster: CG13804-PA; n=5; Endopterygota|Rep: CG1...    37   0.32 
UniRef50_UPI0000D56BC6 Cluster: PREDICTED: similar to CG9792-PA;...    36   0.56 
UniRef50_A4A2L2 Cluster: Probable mutator protein MutT; n=1; Bla...    36   0.56 
UniRef50_Q0UYG6 Cluster: Putative uncharacterized protein; n=1; ...    36   0.98 
UniRef50_UPI0000DB7640 Cluster: PREDICTED: similar to yellow-d C...    35   1.3  
UniRef50_A7BCC0 Cluster: Putative uncharacterized protein; n=1; ...    35   1.7  
UniRef50_Q4PFZ3 Cluster: Predicted protein; n=1; Ustilago maydis...    35   1.7  
UniRef50_UPI00003C0D78 Cluster: PREDICTED: similar to yellow-g C...    34   2.3  
UniRef50_UPI00003C0727 Cluster: PREDICTED: similar to ets varian...    34   2.3  
UniRef50_Q06211 Cluster: Methyl methanesulfonate-sensitivity pro...    34   2.3  
UniRef50_UPI00015B5AE5 Cluster: PREDICTED: similar to conserved ...    34   3.0  
UniRef50_UPI00015B46D1 Cluster: PREDICTED: similar to major roya...    34   3.0  
UniRef50_Q2HZG6 Cluster: Yellow-d; n=1; Bombyx mori|Rep: Yellow-...    34   3.0  
UniRef50_Q7Q698 Cluster: ENSANGP00000010735; n=2; Culicidae|Rep:...    33   4.0  
UniRef50_A5FL60 Cluster: Polysaccharide biosynthesis protein; n=...    33   6.9  
UniRef50_Q0JQX4 Cluster: Os01g0133700 protein; n=9; Oryza sativa...    33   6.9  
UniRef50_A0BLZ9 Cluster: Chromosome undetermined scaffold_115, w...    33   6.9  
UniRef50_Q9VFV1 Cluster: CG9792-PA; n=2; Sophophora|Rep: CG9792-...    32   9.2  
UniRef50_Q54G75 Cluster: Putative uncharacterized protein; n=1; ...    32   9.2  
UniRef50_A2D8Q3 Cluster: Putative uncharacterized protein; n=1; ...    32   9.2  

>UniRef50_Q2HZG0 Cluster: Yellow; n=2; Bombyx mori|Rep: Yellow -
           Bombyx mori (Silk moth)
          Length = 514

 Score =  182 bits (444), Expect = 4e-45
 Identities = 88/111 (79%), Positives = 90/111 (81%)
 Frame = +1

Query: 1   MAAKFLVFCGLDSLASATIKLQEIFSWNVVDWNYPDQFSKQQALRTGALIPENALPVGIE 180
           MAAKFLVFCGL SLASATIKLQEIFSWNVVDWNYPDQFSKQQALRTGALIPENALPVGIE
Sbjct: 1   MAAKFLVFCGLVSLASATIKLQEIFSWNVVDWNYPDQFSKQQALRTGALIPENALPVGIE 60

Query: 181 RWRNKLFVSVPRWRSGIPATLNYIPWTLHMNHPRN*RPTRASKATN*ANCQ 333
           RWRNKLFVSVPRWRSGIPATLNYIP            P  + +     NCQ
Sbjct: 61  RWRNKLFVSVPRWRSGIPATLNYIPLDAPYEPSPKLTPYPSFEGNELGNCQ 111



 Score = 81.0 bits (191), Expect = 2e-14
 Identities = 55/115 (47%), Positives = 64/115 (55%)
 Frame = +3

Query: 168 RWYRKVEEQIVRQRS*VALRYSSYFELHSLDAPYEPSPKLTPYPSFEGNELGKLSKQD*L 347
           RW  K+   + R RS +    + Y  L   DAPYEPSPKLTPYPSFEGNELG        
Sbjct: 61  RWRNKLFVSVPRWRSGIPATLN-YIPL---DAPYEPSPKLTPYPSFEGNELGNCQTGLTT 116

Query: 348 LYTGVKADQCDRLWVFRRLALMDTTTLPNGVAPYTLKCFLTLNNLNSKLIRKNTL 512
           +Y  VKADQCDRLWV   +       + N V PYTL  F  LN    ++IRK  L
Sbjct: 117 VYR-VKADQCDRLWVL-DVGTYGYDNVTN-VCPYTLNVF-DLN--TDQIIRKYVL 165


>UniRef50_A6P3A9 Cluster: Yellow; n=1; Papilio xuthus|Rep: Yellow -
           Papilio xuthus
          Length = 509

 Score =  134 bits (324), Expect = 2e-30
 Identities = 58/80 (72%), Positives = 69/80 (86%)
 Frame = +1

Query: 16  LVFCGLDSLASATIKLQEIFSWNVVDWNYPDQFSKQQALRTGALIPENALPVGIERWRNK 195
           L + GL + ASA +KLQE+FSWN +DWNYP++F +Q+A+ +G LI ENALPVGIERWRNK
Sbjct: 5   LFYLGLVAYASAAVKLQEVFSWNAMDWNYPNEFLRQEAIISGNLIRENALPVGIERWRNK 64

Query: 196 LFVSVPRWRSGIPATLNYIP 255
           LFVSVPRWR GIPATLNYIP
Sbjct: 65  LFVSVPRWRPGIPATLNYIP 84



 Score = 65.3 bits (152), Expect = 1e-09
 Identities = 36/70 (51%), Positives = 42/70 (60%)
 Frame = +3

Query: 255 LDAPYEPSPKLTPYPSFEGNELGKLSKQD*LLYTGVKADQCDRLWVFRRLALMDTTTLPN 434
           LDAP+E SPKLTPYPSFE NE+G        +Y  VKAD+CDRLWV           + N
Sbjct: 85  LDAPHESSPKLTPYPSFEENEVGNCDTGLTTVYR-VKADRCDRLWVLDVGTYGYDPNVTN 143

Query: 435 GVAPYTLKCF 464
            V PYTL  +
Sbjct: 144 -VCPYTLNVY 152


>UniRef50_P09957 Cluster: Protein yellow precursor; n=68;
           Endopterygota|Rep: Protein yellow precursor - Drosophila
           melanogaster (Fruit fly)
          Length = 541

 Score = 90.6 bits (215), Expect = 2e-17
 Identities = 40/68 (58%), Positives = 52/68 (76%)
 Frame = +1

Query: 49  ATIKLQEIFSWNVVDWNYPDQFSKQQALRTGALIPENALPVGIERWRNKLFVSVPRWRSG 228
           A  KLQE +SW+ +D+ +P+   K QAL +G  IP+NALPVG+E + N+LFV+VPRWR G
Sbjct: 21  AAYKLQERYSWSQLDFAFPNTRLKDQALASGDYIPQNALPVGVEHFGNRLFVTVPRWRDG 80

Query: 229 IPATLNYI 252
           IPATL YI
Sbjct: 81  IPATLTYI 88



 Score = 41.1 bits (92), Expect = 0.020
 Identities = 24/73 (32%), Positives = 35/73 (47%), Gaps = 2/73 (2%)
 Frame = +3

Query: 252 SLDAPYEPSPKLTPYPSFEGNELGKLSKQD*LLYTGVKADQCDRLWVF--RRLALMDTTT 425
           ++D     SP+L PYP +  N  G  +      Y  +K D+C RLWV     + + +TTT
Sbjct: 89  NMDRSLTGSPELIPYPDWRSNTAGDCANSITTAYR-IKVDECGRLWVLDTGTVGIGNTTT 147

Query: 426 LPNGVAPYTLKCF 464
            P    PY +  F
Sbjct: 148 NP---CPYAVNVF 157


>UniRef50_Q17AD1 Cluster: Dopachrome-conversion enzyme (DCE)
           isoenzyme, putative; n=3; Culicidae|Rep:
           Dopachrome-conversion enzyme (DCE) isoenzyme, putative -
           Aedes aegypti (Yellowfever mosquito)
          Length = 485

 Score = 83.0 bits (196), Expect = 5e-15
 Identities = 31/73 (42%), Positives = 50/73 (68%)
 Frame = +1

Query: 37  SLASATIKLQEIFSWNVVDWNYPDQFSKQQALRTGALIPENALPVGIERWRNKLFVSVPR 216
           SL+        I+ W ++D+ YP   ++  A+RT   IPEN LP+G++R+RN++F++ PR
Sbjct: 75  SLSQGKNVFDVIYQWKIIDFLYPSLQARNDAIRTKQFIPENNLPLGVDRFRNRIFITTPR 134

Query: 217 WRSGIPATLNYIP 255
           W  G+PATL+Y+P
Sbjct: 135 WNPGVPATLSYLP 147


>UniRef50_Q9VJQ3 Cluster: CG4182-PA; n=5; Neoptera|Rep: CG4182-PA -
           Drosophila melanogaster (Fruit fly)
          Length = 438

 Score = 81.0 bits (191), Expect = 2e-14
 Identities = 33/68 (48%), Positives = 51/68 (75%)
 Frame = +1

Query: 49  ATIKLQEIFSWNVVDWNYPDQFSKQQALRTGALIPENALPVGIERWRNKLFVSVPRWRSG 228
           A+ KL+E FSW  + +++P   ++ +A   G  I EN LP+G+ERW+N++FV+VPRW++G
Sbjct: 23  ASAKLEEKFSWKQLAFDWPTPEAEAEAKSNGHYIVENNLPLGVERWQNRIFVTVPRWKAG 82

Query: 229 IPATLNYI 252
           + ATLNYI
Sbjct: 83  VAATLNYI 90



 Score = 33.9 bits (74), Expect(2) = 0.010
 Identities = 19/51 (37%), Positives = 30/51 (58%)
 Frame = +3

Query: 168 RWYRKVEEQIVRQRS*VALRYSSYFELHSLDAPYEPSPKLTPYPSFEGNEL 320
           RW  ++   + R ++ VA   + Y +++S     E SPKL PYPS+E N+L
Sbjct: 67  RWQNRIFVTVPRWKAGVAATLN-YIDINST----EKSPKLHPYPSWEANKL 112



 Score = 27.5 bits (58), Expect(2) = 0.010
 Identities = 17/58 (29%), Positives = 27/58 (46%)
 Frame = +3

Query: 360 VKADQCDRLWVFRRLALMDTTTLPNGVAPYTLKCFLTLNNLNSKLIRKNTLFTDPGKK 533
           ++ D CDRLWV     L D    P  + P ++   L  +     L+R+ T+  D  K+
Sbjct: 153 IQVDVCDRLWVL-DTGLADILGSPKQITPNSI---LVFDLKTDTLLRRFTIPADQTKE 206


>UniRef50_Q7Q0L3 Cluster: ENSANGP00000014433; n=1; Anopheles gambiae
           str. PEST|Rep: ENSANGP00000014433 - Anopheles gambiae
           str. PEST
          Length = 416

 Score = 79.0 bits (186), Expect = 8e-14
 Identities = 31/66 (46%), Positives = 48/66 (72%)
 Frame = +1

Query: 55  IKLQEIFSWNVVDWNYPDQFSKQQALRTGALIPENALPVGIERWRNKLFVSVPRWRSGIP 234
           +KL+E F W  V + +P + +K  AL +G  I  N LP+G+ERWR+KLF++VPRW++G+ 
Sbjct: 27  VKLKEKFKWREVSFAWPSEDAKVAALNSGKYIVHNNLPLGLERWRDKLFITVPRWKTGVA 86

Query: 235 ATLNYI 252
           A+L Y+
Sbjct: 87  ASLTYV 92



 Score = 34.7 bits (76), Expect = 1.7
 Identities = 20/44 (45%), Positives = 25/44 (56%), Gaps = 5/44 (11%)
 Frame = +3

Query: 276 SPKLTPYPSFEGNELGK----LSKQD*LLYT-GVKADQCDRLWV 392
           SP L PYP +  NEL      L     ++ T  V+AD+CDRLWV
Sbjct: 99  SPDLRPYPGWTENELPTGSNFLKNNATIISTFRVRADECDRLWV 142


>UniRef50_Q2HZG4 Cluster: Yellow-c; n=2; Endopterygota|Rep: Yellow-c
           - Bombyx mori (Silk moth)
          Length = 407

 Score = 74.9 bits (176), Expect = 1e-12
 Identities = 30/80 (37%), Positives = 55/80 (68%)
 Frame = +1

Query: 13  FLVFCGLDSLASATIKLQEIFSWNVVDWNYPDQFSKQQALRTGALIPENALPVGIERWRN 192
           F +   + S  +AT +L+  F+W  VD+ +     ++ A+++G  +P N LP+G+ RW+N
Sbjct: 6   FAIALVVASCEAATPQLR--FAWKEVDYEWNTPAERENAIKSGDFVPANNLPLGLGRWKN 63

Query: 193 KLFVSVPRWRSGIPATLNYI 252
           KLFV+VP+W++G+ ++LNY+
Sbjct: 64  KLFVTVPKWKNGVASSLNYV 83


>UniRef50_UPI00015B44CA Cluster: PREDICTED: similar to yellow-f-like
           protein; n=1; Nasonia vitripennis|Rep: PREDICTED:
           similar to yellow-f-like protein - Nasonia vitripennis
          Length = 400

 Score = 73.3 bits (172), Expect = 4e-12
 Identities = 25/61 (40%), Positives = 45/61 (73%)
 Frame = +1

Query: 70  IFSWNVVDWNYPDQFSKQQALRTGALIPENALPVGIERWRNKLFVSVPRWRSGIPATLNY 249
           ++SW+ +D+N+P++  +   + +G  I  + LPVG+  W++K+F++VPRW+ G+PA LNY
Sbjct: 21  LYSWDKLDYNFPNESMRMAYIASGDFIQADNLPVGVSVWKDKMFITVPRWKKGVPANLNY 80

Query: 250 I 252
           I
Sbjct: 81  I 81



 Score = 40.7 bits (91), Expect = 0.026
 Identities = 17/40 (42%), Positives = 23/40 (57%)
 Frame = +3

Query: 270 EPSPKLTPYPSFEGNELGKLSKQD*LLYTGVKADQCDRLW 389
           + SP LTPYPS+E N++   S    +     + D CDRLW
Sbjct: 88  DKSPPLTPYPSWEANDVHSTSNDVIISIFRTRVDACDRLW 127


>UniRef50_Q6DLY9 Cluster: Yellow-f-like protein; n=1; Apis
           mellifera|Rep: Yellow-f-like protein - Apis mellifera
           (Honeybee)
          Length = 411

 Score = 72.1 bits (169), Expect = 9e-12
 Identities = 23/64 (35%), Positives = 47/64 (73%)
 Frame = +1

Query: 58  KLQEIFSWNVVDWNYPDQFSKQQALRTGALIPENALPVGIERWRNKLFVSVPRWRSGIPA 237
           +++ I+SWNV+++N+P+   +   +  G  I EN +P G++ W +K+F+++PRW++G+P+
Sbjct: 17  EIKTIYSWNVIEYNFPNDNIRNTLISNGDYIEENNMPNGMQIWNDKVFITIPRWKNGVPS 76

Query: 238 TLNY 249
            LN+
Sbjct: 77  NLNF 80



 Score = 39.1 bits (87), Expect = 0.080
 Identities = 17/38 (44%), Positives = 24/38 (63%)
 Frame = +3

Query: 276 SPKLTPYPSFEGNELGKLSKQD*LLYTGVKADQCDRLW 389
           SPKL PYP++E N++ K+     +    V+ D CDRLW
Sbjct: 89  SPKLNPYPNWEMNDINKIDSI--INIIRVRVDACDRLW 124


>UniRef50_A0EM58 Cluster: Yellow-h; n=1; Apis mellifera|Rep:
           Yellow-h - Apis mellifera (Honeybee)
          Length = 552

 Score = 70.1 bits (164), Expect = 4e-11
 Identities = 24/65 (36%), Positives = 45/65 (69%)
 Frame = +1

Query: 61  LQEIFSWNVVDWNYPDQFSKQQALRTGALIPENALPVGIERWRNKLFVSVPRWRSGIPAT 240
           ++ +++W+ +D+ Y    ++  A+  G  I EN LP+G+E WR+K+F+++P+W+ GIP T
Sbjct: 154 MELVYAWSTIDYTYDSIEARDSAIFDGDFITENNLPLGLEVWRDKVFITLPKWKDGIPVT 213

Query: 241 LNYIP 255
           L  +P
Sbjct: 214 LTTVP 218



 Score = 35.5 bits (78), Expect = 0.98
 Identities = 15/39 (38%), Positives = 24/39 (61%)
 Frame = +3

Query: 276 SPKLTPYPSFEGNELGKLSKQD*LLYTGVKADQCDRLWV 392
           SPKL PYP++E + +G       +    ++ D+CDRLW+
Sbjct: 225 SPKLRPYPNWEWHTVGNCDGLTSVF--RIQVDECDRLWI 261


>UniRef50_Q9V4C0 Cluster: CG1629-PA; n=2; Drosophila
           melanogaster|Rep: CG1629-PA - Drosophila melanogaster
           (Fruit fly)
          Length = 463

 Score = 68.1 bits (159), Expect = 2e-10
 Identities = 25/67 (37%), Positives = 46/67 (68%)
 Frame = +1

Query: 58  KLQEIFSWNVVDWNYPDQFSKQQALRTGALIPENALPVGIERWRNKLFVSVPRWRSGIPA 237
           +L+ ++ W  +D+ Y     +QQ++  G  +P+N LP+GI+   N+LFV+ PRW++G+PA
Sbjct: 52  QLEIVYEWKYLDFLYSTFVQRQQSILNGDFVPKNNLPLGIDVHNNRLFVTTPRWKNGVPA 111

Query: 238 TLNYIPW 258
           +L  +P+
Sbjct: 112 SLGTLPF 118


>UniRef50_UPI0000D56BC9 Cluster: PREDICTED: similar to CG1629-PA;
           n=1; Tribolium castaneum|Rep: PREDICTED: similar to
           CG1629-PA - Tribolium castaneum
          Length = 468

 Score = 66.5 bits (155), Expect = 5e-10
 Identities = 26/70 (37%), Positives = 46/70 (65%)
 Frame = +1

Query: 73  FSWNVVDWNYPDQFSKQQALRTGALIPENALPVGIERWRNKLFVSVPRWRSGIPATLNYI 252
           + W ++D+ YP    +  A+ +   IPEN LP+G+E +++++FV++P+W+ G+PATL  I
Sbjct: 71  YKWKMLDYVYPSDEDRIAAIASEDFIPENNLPLGLEVYQDRIFVTMPKWKPGVPATLAVI 130

Query: 253 PWTLHMNHPR 282
           P T     P+
Sbjct: 131 PKTRRELSPK 140



 Score = 35.5 bits (78), Expect = 0.98
 Identities = 22/65 (33%), Positives = 31/65 (47%)
 Frame = +3

Query: 270 EPSPKLTPYPSFEGNELGKLSKQD*LLYTGVKADQCDRLWVFRRLALMDTTTLPNGVAPY 449
           E SPKL PYP+++ +  G  S +       V+ D C RLWV      +D T  P  + P 
Sbjct: 136 ELSPKLVPYPNWDYHRTG--SCEGITSVFRVQVDTCGRLWVLDS-GQVDITIQPRQICPV 192

Query: 450 TLKCF 464
            +  F
Sbjct: 193 QIFLF 197


>UniRef50_UPI00015B6109 Cluster: PREDICTED: similar to
           ENSANGP00000016302; n=1; Nasonia vitripennis|Rep:
           PREDICTED: similar to ENSANGP00000016302 - Nasonia
           vitripennis
          Length = 495

 Score = 63.7 bits (148), Expect = 3e-09
 Identities = 21/61 (34%), Positives = 44/61 (72%)
 Frame = +1

Query: 73  FSWNVVDWNYPDQFSKQQALRTGALIPENALPVGIERWRNKLFVSVPRWRSGIPATLNYI 252
           + WN V++ +P   +  QA+  G+ IPE+ +  G++ W+++++++VPR + G+P+TLN++
Sbjct: 49  YQWNYVNYTWPSSQAHDQAILDGSYIPEHNVISGVKVWKDRIYLTVPRLKKGVPSTLNFV 108

Query: 253 P 255
           P
Sbjct: 109 P 109


>UniRef50_UPI00015B581D Cluster: PREDICTED: similar to yellow-b;
           n=1; Nasonia vitripennis|Rep: PREDICTED: similar to
           yellow-b - Nasonia vitripennis
          Length = 444

 Score = 61.7 bits (143), Expect = 1e-08
 Identities = 26/63 (41%), Positives = 41/63 (65%)
 Frame = +1

Query: 73  FSWNVVDWNYPDQFSKQQALRTGALIPENALPVGIERWRNKLFVSVPRWRSGIPATLNYI 252
           F WN +++ +P + +   AL  G  IPEN +  GI+ + +KLF+++PRW+ G+PATL   
Sbjct: 55  FYWNYLNFTWPSEDAYNSALVDGLYIPENNIITGIKIYEDKLFLTLPRWKRGVPATLVST 114

Query: 253 PWT 261
           P T
Sbjct: 115 PLT 117


>UniRef50_UPI00003C0916 Cluster: PREDICTED: similar to yellow-h
           CG1629-PA; n=2; Apocrita|Rep: PREDICTED: similar to
           yellow-h CG1629-PA - Apis mellifera
          Length = 431

 Score = 60.9 bits (141), Expect = 2e-08
 Identities = 20/58 (34%), Positives = 37/58 (63%)
 Frame = +1

Query: 70  IFSWNVVDWNYPDQFSKQQALRTGALIPENALPVGIERWRNKLFVSVPRWRSGIPATL 243
           +F WN +D  +P + +K+ A+     +P N    GI+ W+ K+++++PRW+ G+P TL
Sbjct: 23  VFQWNTIDVMWPSEENKEYAISHNDYVPANNFIAGIKFWKGKMYLTIPRWKDGVPVTL 80


>UniRef50_Q9VJI5 Cluster: CG17914-PA; n=5; Endopterygota|Rep:
           CG17914-PA - Drosophila melanogaster (Fruit fly)
          Length = 453

 Score = 60.1 bits (139), Expect = 4e-08
 Identities = 25/70 (35%), Positives = 41/70 (58%)
 Frame = +1

Query: 43  ASATIKLQEIFSWNVVDWNYPDQFSKQQALRTGALIPENALPVGIERWRNKLFVSVPRWR 222
           A A   L+  + W  +D+ Y +   +  A+  G   P N +P G+E   ++LFV++PRWR
Sbjct: 16  ALANDNLRVAYEWREMDFKYANPDQRWSAIERGEFKPANVIPFGLEVAGHRLFVTLPRWR 75

Query: 223 SGIPATLNYI 252
            G+PA+L Y+
Sbjct: 76  DGVPASLAYL 85


>UniRef50_A0EM59 Cluster: Yellow e3-like protein; n=1; Apis
           mellifera|Rep: Yellow e3-like protein - Apis mellifera
           (Honeybee)
          Length = 424

 Score = 57.6 bits (133), Expect = 2e-07
 Identities = 23/74 (31%), Positives = 50/74 (67%), Gaps = 4/74 (5%)
 Frame = +1

Query: 43  ASATIKLQEIFSWNVVDWNYPDQFSKQQALRTGALIPENALPVGIERW----RNKLFVSV 210
           + A  KL+ I+SW  +++ +P+ ++K  A+++G+ IP  +LP+ ++ +    ++ +FV++
Sbjct: 18  SQAQEKLKNIYSWKALEFAFPNGYAKLAAIKSGSYIPGASLPIDVDVYNTEQQSTVFVAI 77

Query: 211 PRWRSGIPATLNYI 252
           PR + G+P TL Y+
Sbjct: 78  PRIQDGVPLTLGYV 91


>UniRef50_Q7Q8V5 Cluster: ENSANGP00000016302; n=1; Anopheles gambiae
           str. PEST|Rep: ENSANGP00000016302 - Anopheles gambiae
           str. PEST
          Length = 412

 Score = 56.4 bits (130), Expect = 5e-07
 Identities = 21/61 (34%), Positives = 41/61 (67%)
 Frame = +1

Query: 70  IFSWNVVDWNYPDQFSKQQALRTGALIPENALPVGIERWRNKLFVSVPRWRSGIPATLNY 249
           ++ WNV+D+ + ++  + QAL +G  IP+N +    + + N+L++++PR   G+PATL Y
Sbjct: 7   VYEWNVLDFAFTNEDERAQALYSGHYIPKNVIISDCKPFANRLYLTIPRMLPGVPATLGY 66

Query: 250 I 252
           +
Sbjct: 67  V 67


>UniRef50_UPI00015B58E7 Cluster: PREDICTED: similar to
           ENSANGP00000016302; n=1; Nasonia vitripennis|Rep:
           PREDICTED: similar to ENSANGP00000016302 - Nasonia
           vitripennis
          Length = 435

 Score = 55.6 bits (128), Expect = 9e-07
 Identities = 23/81 (28%), Positives = 47/81 (58%)
 Frame = +1

Query: 1   MAAKFLVFCGLDSLASATIKLQEIFSWNVVDWNYPDQFSKQQALRTGALIPENALPVGIE 180
           +    L+   L  LA A       F WN +++ +P++ +  +A +  + + +N +  GI+
Sbjct: 2   LRCSLLILGALAGLALAHEPFIVQFQWNYLNYTWPNKEAYLKADKDDSYLEKNNVVSGIK 61

Query: 181 RWRNKLFVSVPRWRSGIPATL 243
            W +K+++++PRW+SG+P TL
Sbjct: 62  LWEDKMYLTIPRWKSGVPVTL 82


>UniRef50_UPI00015B4E4E Cluster: PREDICTED: similar to
           ENSANGP00000012608; n=1; Nasonia vitripennis|Rep:
           PREDICTED: similar to ENSANGP00000012608 - Nasonia
           vitripennis
          Length = 456

 Score = 55.2 bits (127), Expect = 1e-06
 Identities = 28/79 (35%), Positives = 49/79 (62%)
 Frame = +1

Query: 16  LVFCGLDSLASATIKLQEIFSWNVVDWNYPDQFSKQQALRTGALIPENALPVGIERWRNK 195
           L+F    S A+A   L   + W  +D+++P++ +K+   +      E+ LP+G+E   ++
Sbjct: 6   LLFVATVSGAAAIDHLHVKYQWKQIDYDWPNEETKRLFPKYKQ---EDNLPLGLEVAGDR 62

Query: 196 LFVSVPRWRSGIPATLNYI 252
           LF++VPRWR G+ A+LNYI
Sbjct: 63  LFITVPRWRQGVVASLNYI 81



 Score = 39.9 bits (89), Expect = 0.046
 Identities = 27/76 (35%), Positives = 39/76 (51%)
 Frame = +3

Query: 276 SPKLTPYPSFEGNELGKLSKQD*LLYTGVKADQCDRLWVFRRLALMDTTTLPNGVAPYTL 455
           SP L PYPS+E ++    S  + +    V+AD+C+RLWV     L D    P   +  TL
Sbjct: 89  SPPLIPYPSWEAHQYSGGSPPEIVSTFRVRADRCNRLWVL-DTGLSDILGAPEQDSVPTL 147

Query: 456 KCFLTLNNLNSKLIRK 503
              L  +  N +L+RK
Sbjct: 148 ---LVYDLTNDQLLRK 160


>UniRef50_UPI0000DB7359 Cluster: PREDICTED: similar to yellow-b
           CG17914-PA; n=1; Apis mellifera|Rep: PREDICTED: similar
           to yellow-b CG17914-PA - Apis mellifera
          Length = 455

 Score = 54.4 bits (125), Expect = 2e-06
 Identities = 26/64 (40%), Positives = 39/64 (60%)
 Frame = +1

Query: 58  KLQEIFSWNVVDWNYPDQFSKQQALRTGALIPENALPVGIERWRNKLFVSVPRWRSGIPA 237
           KL+ IF W  +D+ +P   S +  L       E+ LP+G+E    ++FV+VPRWR G+ A
Sbjct: 32  KLRVIFQWKQLDYEWP---SNETKLLFPGYKQEDNLPLGLEITSTRIFVTVPRWRRGVVA 88

Query: 238 TLNY 249
           +LNY
Sbjct: 89  SLNY 92



 Score = 40.3 bits (90), Expect = 0.035
 Identities = 26/76 (34%), Positives = 37/76 (48%)
 Frame = +3

Query: 276 SPKLTPYPSFEGNELGKLSKQD*LLYTGVKADQCDRLWVFRRLALMDTTTLPNGVAPYTL 455
           SP L PYPSFE ++    S  + +    ++ D+C+RLWV       D    P   AP  L
Sbjct: 101 SPTLIPYPSFEAHQYEAGSVPEIISPFRIRVDRCERLWVL-DTGFTDILQNPEQEAPPAL 159

Query: 456 KCFLTLNNLNSKLIRK 503
              L  +  N +L+RK
Sbjct: 160 ---LIYDLKNDRLLRK 172


>UniRef50_UPI0000D56E2A Cluster: PREDICTED: similar to CG17914-PA;
           n=1; Tribolium castaneum|Rep: PREDICTED: similar to
           CG17914-PA - Tribolium castaneum
          Length = 473

 Score = 54.4 bits (125), Expect = 2e-06
 Identities = 26/76 (34%), Positives = 45/76 (59%)
 Frame = +1

Query: 16  LVFCGLDSLASATIKLQEIFSWNVVDWNYPDQFSKQQALRTGALIPENALPVGIERWRNK 195
           L FC   S+ + T K   I  W  +++ +PD+ + + A  TG  IPEN +  GI+ + + 
Sbjct: 9   LTFC--TSIHTQTSKFYVIRQWKYLNFTWPDEDALKTATATGDYIPENNIVSGIKYFEDY 66

Query: 196 LFVSVPRWRSGIPATL 243
            ++++PR + G+PATL
Sbjct: 67  YYLTLPRMKKGVPATL 82


>UniRef50_Q2HZG2 Cluster: Yellow-b; n=1; Bombyx mori|Rep: Yellow-b -
           Bombyx mori (Silk moth)
          Length = 457

 Score = 53.2 bits (122), Expect = 5e-06
 Identities = 22/62 (35%), Positives = 36/62 (58%)
 Frame = +1

Query: 70  IFSWNVVDWNYPDQFSKQQALRTGALIPENALPVGIERWRNKLFVSVPRWRSGIPATLNY 249
           ++ WN +D+ +     ++  L T   IP+N L  GI  +   LF+++PR  +G+PATL  
Sbjct: 44  VYEWNAIDFEWTSPEDREAYLNTSQYIPQNVLISGINFYGENLFLTMPRMLAGVPATLAT 103

Query: 250 IP 255
           IP
Sbjct: 104 IP 105


>UniRef50_UPI00015B6399 Cluster: PREDICTED: similar to yellow
           e3-like protein; n=1; Nasonia vitripennis|Rep:
           PREDICTED: similar to yellow e3-like protein - Nasonia
           vitripennis
          Length = 525

 Score = 52.4 bits (120), Expect = 8e-06
 Identities = 21/71 (29%), Positives = 43/71 (60%), Gaps = 4/71 (5%)
 Frame = +1

Query: 52  TIKLQEIFSWNVVDWNYPDQFSKQQALRTGALIPENALPVGIERW----RNKLFVSVPRW 219
           T KL+ +FSW  +D+ +    +++ A+RTG   P  ++P+ ++ +     + +F+++PR 
Sbjct: 27  TNKLRTVFSWKALDFAFGSDIAREAAIRTGRFKPGASIPIDVDVYYGNHSSMVFIAMPRL 86

Query: 220 RSGIPATLNYI 252
             GIP T+ Y+
Sbjct: 87  EQGIPVTVGYV 97



 Score = 33.1 bits (72), Expect = 5.2
 Identities = 23/86 (26%), Positives = 39/86 (45%), Gaps = 3/86 (3%)
 Frame = +3

Query: 276 SPKLTPYPSFEGNELGKLSKQD*LLYT-GVKADQCDRLWVFRRLALMDTTTLPNGVAPYT 452
           +P + PYP +E N LG     D +  T  V+ D C RLW+     + D       +  ++
Sbjct: 106 NPLIAPYPDWEWNRLGDC---DAITSTYRVQIDDCGRLWILDTGVIGDRRVCRPQLLSFS 162

Query: 453 LKC--FLTLNNLNSKLIRKNTLFTDP 524
           LK    L+ +       ++++LF  P
Sbjct: 163 LKTNKLLSRHRFPRDQFKEHSLFVTP 188


>UniRef50_UPI0000D55BA7 Cluster: PREDICTED: similar to Yellow
           protein precursor; n=2; Tribolium castaneum|Rep:
           PREDICTED: similar to Yellow protein precursor -
           Tribolium castaneum
          Length = 393

 Score = 52.4 bits (120), Expect = 8e-06
 Identities = 18/57 (31%), Positives = 38/57 (66%)
 Frame = +1

Query: 79  WNVVDWNYPDQFSKQQALRTGALIPENALPVGIERWRNKLFVSVPRWRSGIPATLNY 249
           W+ +++ +    + ++A+ +G  IPEN    GI+ +RN+ ++++P++R G+P TL Y
Sbjct: 32  WSYINFTWESSITYEEAIDSGDYIPENVAMTGIKFYRNRWYIALPKFRPGVPVTLAY 88


>UniRef50_Q7PHB5 Cluster: ENSANGP00000022789; n=2; Anopheles gambiae
           str. PEST|Rep: ENSANGP00000022789 - Anopheles gambiae
           str. PEST
          Length = 465

 Score = 52.0 bits (119), Expect = 1e-05
 Identities = 23/70 (32%), Positives = 42/70 (60%), Gaps = 5/70 (7%)
 Frame = +1

Query: 58  KLQEIFSWNVVDWNYPDQFSKQQALRTGALIPENALPVGIE-----RWRNKLFVSVPRWR 222
           +L+ +  W   D+ +P    +Q+AL +G  +PEN +P+ ++       R++LFV++PR+ 
Sbjct: 28  QLKGVLQWKAADFAFPTPQERQEALASGRYVPENCIPLDMDVDYSNPARSRLFVTIPRFV 87

Query: 223 SGIPATLNYI 252
            GIP TL  +
Sbjct: 88  EGIPYTLGRV 97


>UniRef50_UPI00015B6108 Cluster: PREDICTED: similar to
           ENSANGP00000016302; n=1; Nasonia vitripennis|Rep:
           PREDICTED: similar to ENSANGP00000016302 - Nasonia
           vitripennis
          Length = 450

 Score = 51.6 bits (118), Expect = 1e-05
 Identities = 22/58 (37%), Positives = 39/58 (67%)
 Frame = +1

Query: 79  WNVVDWNYPDQFSKQQALRTGALIPENALPVGIERWRNKLFVSVPRWRSGIPATLNYI 252
           W+ V++++P   + +QA+   + I EN +  GI+ WR++L+++VPR + GIP TL  I
Sbjct: 32  WDYVNYSWPSWEAYEQAVADKSYIRENNVVSGIKLWRDRLYLAVPRQKPGIPVTLTSI 89


>UniRef50_Q2HZG5 Cluster: Yellow-fa; n=2; Bombyx mori|Rep: Yellow-fa
           - Bombyx mori (Silk moth)
          Length = 459

 Score = 50.4 bits (115), Expect = 3e-05
 Identities = 26/67 (38%), Positives = 38/67 (56%), Gaps = 1/67 (1%)
 Frame = +1

Query: 76  SWNVVDWNYPDQFSKQQALRTGALIPE-NALPVGIERWRNKLFVSVPRWRSGIPATLNYI 252
           SWN+        F K     TG    + N +P+G+E+  ++LF++VPR R GIP+TLNY+
Sbjct: 83  SWNLFRPEIVRPFVKPVENETGRFFVQYNNVPMGVEKVGDRLFITVPRRRYGIPSTLNYV 142

Query: 253 PWTLHMN 273
             T   N
Sbjct: 143 DLTTDSN 149


>UniRef50_UPI00015B6395 Cluster: PREDICTED: similar to major royal
           jelly protein 9; n=2; Nasonia vitripennis|Rep:
           PREDICTED: similar to major royal jelly protein 9 -
           Nasonia vitripennis
          Length = 413

 Score = 48.8 bits (111), Expect = 1e-04
 Identities = 21/71 (29%), Positives = 44/71 (61%)
 Frame = +1

Query: 31  LDSLASATIKLQEIFSWNVVDWNYPDQFSKQQALRTGALIPENALPVGIERWRNKLFVSV 210
           L +++ ++ KL  ++ W  +D+ +     K++ +R+G    EN +P+ +++ R K+FV+V
Sbjct: 10  LGAVSVSSHKLDTVYEWKYIDYLWDSNAQKERYIRSGDYDYENIVPIDVDKARGKVFVTV 69

Query: 211 PRWRSGIPATL 243
            R   G+PA+L
Sbjct: 70  IR-NQGVPASL 79


>UniRef50_UPI0000D56D70 Cluster: PREDICTED: similar to CG8063-PA;
           n=1; Tribolium castaneum|Rep: PREDICTED: similar to
           CG8063-PA - Tribolium castaneum
          Length = 454

 Score = 48.4 bits (110), Expect = 1e-04
 Identities = 18/33 (54%), Positives = 27/33 (81%)
 Frame = +1

Query: 154 ENALPVGIERWRNKLFVSVPRWRSGIPATLNYI 252
           EN +P+G   WR+KLFV+VPR R G+P+T+N++
Sbjct: 91  ENNIPMGANLWRDKLFVTVPRRRVGVPSTVNFV 123


>UniRef50_Q9VG08 Cluster: CG8063-PA; n=3; Drosophila
           melanogaster|Rep: CG8063-PA - Drosophila melanogaster
           (Fruit fly)
          Length = 452

 Score = 46.8 bits (106), Expect = 4e-04
 Identities = 20/35 (57%), Positives = 27/35 (77%)
 Frame = +1

Query: 148 IPENALPVGIERWRNKLFVSVPRWRSGIPATLNYI 252
           IP N +P+G   +R +LFV++PR R GIP+TLNYI
Sbjct: 97  IPYNNVPMGATHFRGRLFVTMPRRRVGIPSTLNYI 131


>UniRef50_Q7QB87 Cluster: ENSANGP00000011250; n=2; Culicidae|Rep:
           ENSANGP00000011250 - Anopheles gambiae str. PEST
          Length = 392

 Score = 46.8 bits (106), Expect = 4e-04
 Identities = 21/66 (31%), Positives = 40/66 (60%)
 Frame = +1

Query: 58  KLQEIFSWNVVDWNYPDQFSKQQALRTGALIPENALPVGIERWRNKLFVSVPRWRSGIPA 237
           K++ +  WN++++N+P  +    A       PEN +  G+E   +++F++ PR  SG+PA
Sbjct: 24  KMEVVKQWNLLNFNFPWDYP---AASKEFYNPENVVATGLEVGYDRIFIATPRLFSGVPA 80

Query: 238 TLNYIP 255
           T++ IP
Sbjct: 81  TVSSIP 86


>UniRef50_O97432 Cluster: Major royal jelly protein 5 precursor;
           n=5; Apis|Rep: Major royal jelly protein 5 precursor -
           Apis mellifera (Honeybee)
          Length = 598

 Score = 46.4 bits (105), Expect = 5e-04
 Identities = 19/61 (31%), Positives = 36/61 (59%)
 Frame = +1

Query: 70  IFSWNVVDWNYPDQFSKQQALRTGALIPENALPVGIERWRNKLFVSVPRWRSGIPATLNY 249
           I  W  +D+++     +Q A+++G        P  +++WR   FV+VPR++ G+P++LN 
Sbjct: 38  IHEWKYLDYDFGSDERRQAAMQSGEYDHTKNYPFDVDQWRGMTFVTVPRYK-GVPSSLNV 96

Query: 250 I 252
           I
Sbjct: 97  I 97


>UniRef50_Q8MZM5 Cluster: Dopachrome conversion enzyme; n=10;
           Culicidae|Rep: Dopachrome conversion enzyme - Anopheles
           gambiae (African malaria mosquito)
          Length = 462

 Score = 46.0 bits (104), Expect = 7e-04
 Identities = 26/79 (32%), Positives = 42/79 (53%)
 Frame = +1

Query: 16  LVFCGLDSLASATIKLQEIFSWNVVDWNYPDQFSKQQALRTGALIPENALPVGIERWRNK 195
           L+  GL  L S  +   E+  W  V+++ P +  +    R    IP   +P+G    +N+
Sbjct: 10  LLLAGLAVLVSGQV--DEVLKWQRVEYDVPAEVLQ----RENGYIPIGNIPMGAVHHKNR 63

Query: 196 LFVSVPRWRSGIPATLNYI 252
           +FV+V R R GIP+TLN +
Sbjct: 64  VFVAVARRRWGIPSTLNVV 82


>UniRef50_Q17060 Cluster: Major royal jelly protein 3 precursor;
           n=32; Apis|Rep: Major royal jelly protein 3 precursor -
           Apis mellifera (Honeybee)
          Length = 544

 Score = 46.0 bits (104), Expect = 7e-04
 Identities = 17/64 (26%), Positives = 38/64 (59%)
 Frame = +1

Query: 61  LQEIFSWNVVDWNYPDQFSKQQALRTGALIPENALPVGIERWRNKLFVSVPRWRSGIPAT 240
           ++ I+ W  +D+++     +  A+++G        P  ++RWR+K FV++ R  +G+P++
Sbjct: 37  MKVIYEWKHIDFDFGSDERRDAAIKSGEFDHTKNYPFDVDRWRDKTFVTIER-NNGVPSS 95

Query: 241 LNYI 252
           LN +
Sbjct: 96  LNVV 99


>UniRef50_UPI00015B639A Cluster: PREDICTED: hypothetical protein;
           n=1; Nasonia vitripennis|Rep: PREDICTED: hypothetical
           protein - Nasonia vitripennis
          Length = 425

 Score = 45.6 bits (103), Expect = 0.001
 Identities = 19/65 (29%), Positives = 41/65 (63%)
 Frame = +1

Query: 61  LQEIFSWNVVDWNYPDQFSKQQALRTGALIPENALPVGIERWRNKLFVSVPRWRSGIPAT 240
           L+ +  W ++++ +P   S  +  +     PEN +P G+E   +++F+++PR R+G+PAT
Sbjct: 32  LETVAQWPLMNFAFPYDPSFLELFQ-----PENVVPTGLEIGWHRIFLAIPRLRAGVPAT 86

Query: 241 LNYIP 255
           + ++P
Sbjct: 87  ITFMP 91



 Score = 34.7 bits (76), Expect = 1.7
 Identities = 26/96 (27%), Positives = 46/96 (47%), Gaps = 8/96 (8%)
 Frame = +3

Query: 258 DAPYEPSPKLTPYPSFEGNELGK--LSKQD*LLYTGVKADQCDRLWVFR---RLALMD-T 419
           D P   +P L  YPS++ +  GK   +    +    V+AD+C+RLWV       ++ D T
Sbjct: 93  DVPVGSTPHLQAYPSWDWHSAGKGDFNCSKLISVYRVRADRCNRLWVLDSGINTSIDDFT 152

Query: 420 TTLPNGVAPYTLKC--FLTLNNLNSKLIRKNTLFTD 521
              P  +  + L+    + +     + +R N+LFT+
Sbjct: 153 VACPPKILIFDLQSDQLVRIITFPREAVRPNSLFTN 188


>UniRef50_Q9W1R1 Cluster: CG9889-PA; n=3; Sophophora|Rep: CG9889-PA
           - Drosophila melanogaster (Fruit fly)
          Length = 432

 Score = 44.8 bits (101), Expect = 0.002
 Identities = 21/78 (26%), Positives = 41/78 (52%), Gaps = 5/78 (6%)
 Frame = +1

Query: 61  LQEIFSWNVVDWNYPDQFSKQQALRTGALIPENALPVGIE-----RWRNKLFVSVPRWRS 225
           ++ +  W  +++ +P    ++ A   G L+PEN  P+ ++       + +LF ++PR+ +
Sbjct: 34  VETLTQWGQLEFGFPTAQDRENAQAAGNLVPENGTPIDVQPQYMANGQIRLFTTIPRFVT 93

Query: 226 GIPATLNYIPWTLHMNHP 279
           GIP TL  +  T   N P
Sbjct: 94  GIPYTLATVSATQGRNGP 111


>UniRef50_A0NDC3 Cluster: ENSANGP00000031925; n=1; Anopheles gambiae
           str. PEST|Rep: ENSANGP00000031925 - Anopheles gambiae
           str. PEST
          Length = 400

 Score = 44.0 bits (99), Expect = 0.003
 Identities = 19/50 (38%), Positives = 31/50 (62%)
 Frame = +1

Query: 103 PDQFSKQQALRTGALIPENALPVGIERWRNKLFVSVPRWRSGIPATLNYI 252
           PD  +        + +P + LP+G+   + ++FV+VPR R+GIP+TLN I
Sbjct: 61  PDDAAPGMESLNESFVPYHNLPMGVTHHKGRVFVTVPRRRTGIPSTLNVI 110


>UniRef50_UPI0000D56BC7 Cluster: PREDICTED: similar to CG9891-PA;
           n=1; Tribolium castaneum|Rep: PREDICTED: similar to
           CG9891-PA - Tribolium castaneum
          Length = 490

 Score = 42.3 bits (95), Expect = 0.009
 Identities = 18/83 (21%), Positives = 42/83 (50%), Gaps = 7/83 (8%)
 Frame = +1

Query: 25  CGLDSLASATIKLQEIFSWNVVDWNYPDQFSKQQALRTGALIPENALPVGIE-------R 183
           C +D+       L  ++ W+ ++++YP    +Q  +  G  IP    P+ ++        
Sbjct: 53  CAIDAAYPLKPDLAIVYQWSQLEFDYPSIEDRQADIDAGNFIPGKPAPIDVDVHYSYSPH 112

Query: 184 WRNKLFVSVPRWRSGIPATLNYI 252
            ++++FV++PR++ G+P  L  +
Sbjct: 113 KKSRVFVAIPRFQDGVPIALGVV 135



 Score = 35.5 bits (78), Expect = 0.98
 Identities = 19/68 (27%), Positives = 33/68 (48%), Gaps = 1/68 (1%)
 Frame = +3

Query: 258 DAPYEPSPKLTPYPSFEGNEL-GKLSKQD*LLYTGVKADQCDRLWVFRRLALMDTTTLPN 434
           D  +  S  +TPYPS++ ++   K ++   +    V  D+C RLWV     L +T   P 
Sbjct: 137 DKKFNSSNVITPYPSWDWHKTPSKCNENRIVSVYRVSIDECQRLWVLDTGRLKETQVCPP 196

Query: 435 GVAPYTLK 458
            +  + L+
Sbjct: 197 QILAFDLQ 204


>UniRef50_UPI0000D55BA5 Cluster: PREDICTED: similar to CG17914-PA;
           n=1; Tribolium castaneum|Rep: PREDICTED: similar to
           CG17914-PA - Tribolium castaneum
          Length = 409

 Score = 42.3 bits (95), Expect = 0.009
 Identities = 23/86 (26%), Positives = 44/86 (51%), Gaps = 6/86 (6%)
 Frame = +1

Query: 13  FLVFCGLDSLASATIK------LQEIFSWNVVDWNYPDQFSKQQALRTGALIPENALPVG 174
           F+ +C  D + +  IK       Q  + W+ V++ +P     ++A+     +PEN    G
Sbjct: 12  FVNYCLNDKVQNEPIKPIKNQTFQLEYQWHYVNYTWPTYDDYKKAVIKRKYVPENVAITG 71

Query: 175 IERWRNKLFVSVPRWRSGIPATLNYI 252
           I+  +  L++++P+ R G+P TL  I
Sbjct: 72  IKYHKGDLYLAMPQIRKGVPVTLGKI 97


>UniRef50_Q9VFV2 Cluster: CG17044-PA; n=4; Sophophora|Rep:
           CG17044-PA - Drosophila melanogaster (Fruit fly)
          Length = 426

 Score = 41.9 bits (94), Expect = 0.011
 Identities = 18/67 (26%), Positives = 36/67 (53%), Gaps = 6/67 (8%)
 Frame = +1

Query: 70  IFSWNVVDWNYPDQFSKQQALRTGALIPENALPVGIERW------RNKLFVSVPRWRSGI 231
           +F W  + + +P +  + Q LR G   P++ +P+ I+ +        + FV+ PR+  G+
Sbjct: 35  VFEWKNLQYGFPSEQERDQVLRNGRYNPDSPIPIDIDVYYPPNGGPPRHFVTSPRFGQGV 94

Query: 232 PATLNYI 252
           P +L Y+
Sbjct: 95  PFSLGYV 101


>UniRef50_Q2HZG3 Cluster: Yellow-fb; n=1; Bombyx mori|Rep: Yellow-fb
           - Bombyx mori (Silk moth)
          Length = 418

 Score = 39.1 bits (87), Expect = 0.080
 Identities = 19/35 (54%), Positives = 25/35 (71%)
 Frame = +1

Query: 148 IPENALPVGIERWRNKLFVSVPRWRSGIPATLNYI 252
           I  N +P GI+   + LF++VPR R GIP+TLNYI
Sbjct: 73  IQYNNVPTGIKFVGDLLFLTVPRRRLGIPSTLNYI 107


>UniRef50_Q17BS0 Cluster: Putative uncharacterized protein; n=1;
           Aedes aegypti|Rep: Putative uncharacterized protein -
           Aedes aegypti (Yellowfever mosquito)
          Length = 432

 Score = 38.7 bits (86), Expect = 0.11
 Identities = 20/50 (40%), Positives = 32/50 (64%), Gaps = 6/50 (12%)
 Frame = +1

Query: 121 QQALRTGALIPENALPVGIE------RWRNKLFVSVPRWRSGIPATLNYI 252
           ++AL +   IPEN +P+ ++        R+++FV+VPR+  GIPATL  I
Sbjct: 35  EEALASRRFIPENCIPLDMDVDYHSNALRSRVFVTVPRFIEGIPATLGII 84


>UniRef50_Q0C7C7 Cluster: Dopachrome-conversion enzyme (DCE),
           putative; n=2; Culicidae|Rep: Dopachrome-conversion
           enzyme (DCE), putative - Aedes aegypti (Yellowfever
           mosquito)
          Length = 426

 Score = 38.7 bits (86), Expect = 0.11
 Identities = 16/37 (43%), Positives = 24/37 (64%)
 Frame = +1

Query: 142 ALIPENALPVGIERWRNKLFVSVPRWRSGIPATLNYI 252
           + +  N +P+G      ++F++VPR R GIPATLN I
Sbjct: 60  SFVSYNNIPMGATHHNGRVFIAVPRRRPGIPATLNVI 96


>UniRef50_Q9W029 Cluster: CG5717-PA; n=5; Endopterygota|Rep:
           CG5717-PA - Drosophila melanogaster (Fruit fly)
          Length = 393

 Score = 37.5 bits (83), Expect = 0.24
 Identities = 14/52 (26%), Positives = 31/52 (59%)
 Frame = +1

Query: 97  NYPDQFSKQQALRTGALIPENALPVGIERWRNKLFVSVPRWRSGIPATLNYI 252
           ++P + +K   +++G  +P N +    +  R+  FV++PR++ G+P TL  +
Sbjct: 57  HWPCESTKNIYVQSGRYVPRNVIVTRAQLQRDSAFVALPRYKQGVPFTLGKV 108


>UniRef50_Q0C7C6 Cluster: Dopachrome-conversion enzyme (DCE),
           putative; n=2; Culicidae|Rep: Dopachrome-conversion
           enzyme (DCE), putative - Aedes aegypti (Yellowfever
           mosquito)
          Length = 424

 Score = 37.5 bits (83), Expect = 0.24
 Identities = 16/30 (53%), Positives = 22/30 (73%)
 Frame = +1

Query: 163 LPVGIERWRNKLFVSVPRWRSGIPATLNYI 252
           LP+G+   + +LFV+VPR R GIP+TL  I
Sbjct: 66  LPMGVSHHKGRLFVTVPRRRPGIPSTLAVI 95


>UniRef50_Q9W028 Cluster: CG13804-PA; n=5; Endopterygota|Rep:
           CG13804-PA - Drosophila melanogaster (Fruit fly)
          Length = 382

 Score = 37.1 bits (82), Expect = 0.32
 Identities = 15/55 (27%), Positives = 30/55 (54%)
 Frame = +1

Query: 79  WNVVDWNYPDQFSKQQALRTGALIPENALPVGIERWRNKLFVSVPRWRSGIPATL 243
           W    + +P   +K     +G  IP+N +    +   + +++++PR+R G+PATL
Sbjct: 41  WTGGQFEFPCASTKSLFKSSGKFIPKNVIATRAQLIGDTIYLALPRYRKGVPATL 95


>UniRef50_UPI0000D56BC6 Cluster: PREDICTED: similar to CG9792-PA;
           n=2; Endopterygota|Rep: PREDICTED: similar to CG9792-PA
           - Tribolium castaneum
          Length = 1057

 Score = 36.3 bits (80), Expect = 0.56
 Identities = 22/79 (27%), Positives = 40/79 (50%), Gaps = 11/79 (13%)
 Frame = +1

Query: 52  TIKLQEIFSWNVVDWNYP-----------DQFSKQQALRTGALIPENALPVGIERWRNKL 198
           +++L+ +  WN++D+ +P           D    +    T    PE  +  G+E   +++
Sbjct: 26  SLELEVVNQWNLLDFQFPFDHRLINNFRYDTIYIENKSGTVDFSPERNVFTGLEITNDRI 85

Query: 199 FVSVPRWRSGIPATLNYIP 255
           F++VPR  SG+ ATL  IP
Sbjct: 86  FLAVPRLWSGVSATLAVIP 104


>UniRef50_A4A2L2 Cluster: Probable mutator protein MutT; n=1;
           Blastopirellula marina DSM 3645|Rep: Probable mutator
           protein MutT - Blastopirellula marina DSM 3645
          Length = 217

 Score = 36.3 bits (80), Expect = 0.56
 Identities = 18/44 (40%), Positives = 23/44 (52%)
 Frame = +3

Query: 9   EVFSFLWARFTSISNDKAPRNILVERGRLELPGPVLEAAGSQDW 140
           EV   L+    ++ ND+    I V R  L+L GP LE  GSQ W
Sbjct: 155 EVAELLFMPIANLGNDQLRSTIRVNRRGLQLAGPALEIGGSQLW 198


>UniRef50_Q0UYG6 Cluster: Putative uncharacterized protein; n=1;
            Phaeosphaeria nodorum|Rep: Putative uncharacterized
            protein - Phaeosphaeria nodorum (Septoria nodorum)
          Length = 2144

 Score = 35.5 bits (78), Expect = 0.98
 Identities = 27/92 (29%), Positives = 45/92 (48%)
 Frame = -1

Query: 526  PGSVNKVFLRINFEFKLFKVKKHLSVYGATPFGNVVVSISAKRLNTQRRSHWSALTPVYR 347
            P S ++V L   F F    V ++  +      GN++ S+S KR+   +R   S  TP  +
Sbjct: 1490 PKSTHQVPLLHLFRFNRVVVDEYHYLNDDKKMGNILASVSVKRIAAVKRWVLSG-TPALK 1548

Query: 346  SQSCFDNLPNSLPSKLG*GVNFGDGSYGASRE 251
            + S  D + + L  +LG   +FGDG   +S +
Sbjct: 1549 NFSDVDQIASYLGIRLG-RYHFGDGIESSSSD 1579


>UniRef50_UPI0000DB7640 Cluster: PREDICTED: similar to yellow-d
           CG9889-PA; n=1; Apis mellifera|Rep: PREDICTED: similar
           to yellow-d CG9889-PA - Apis mellifera
          Length = 409

 Score = 35.1 bits (77), Expect = 1.3
 Identities = 16/64 (25%), Positives = 35/64 (54%)
 Frame = +1

Query: 61  LQEIFSWNVVDWNYPDQFSKQQALRTGALIPENALPVGIERWRNKLFVSVPRWRSGIPAT 240
           L+ +F W  +DW +P+     +    G    ++   V I+++  ++FV+ P+W  G+P +
Sbjct: 23  LEIVFQWKYLDWLWPNIHLTGRNQTLGNAFTQD---VDIDKY-GRVFVTSPQWLQGVPIS 78

Query: 241 LNYI 252
           L+ +
Sbjct: 79  LSLV 82


>UniRef50_A7BCC0 Cluster: Putative uncharacterized protein; n=1;
           Actinomyces odontolyticus ATCC 17982|Rep: Putative
           uncharacterized protein - Actinomyces odontolyticus ATCC
           17982
          Length = 314

 Score = 34.7 bits (76), Expect = 1.7
 Identities = 13/32 (40%), Positives = 17/32 (53%)
 Frame = +1

Query: 139 GALIPENALPVGIERWRNKLFVSVPRWRSGIP 234
           G L+P N L + +  W N  F  +PRWR   P
Sbjct: 88  GGLVPPNVLAMPVHGWVNLHFSDLPRWRGAAP 119


>UniRef50_Q4PFZ3 Cluster: Predicted protein; n=1; Ustilago
           maydis|Rep: Predicted protein - Ustilago maydis (Smut
           fungus)
          Length = 699

 Score = 34.7 bits (76), Expect = 1.7
 Identities = 25/63 (39%), Positives = 32/63 (50%), Gaps = 3/63 (4%)
 Frame = -1

Query: 487 EFKLFKVKKHLSVYGATPFGNV-VVSISAKRLNTQRRSHWSALTPVYRSQSCFD--NLPN 317
           E K     + L +Y ATPFGNV  V+  A R  TQRRS    ++P  +  +C D   LP 
Sbjct: 549 ESKFENDPRTLELYYATPFGNVPAVTTPAVRF-TQRRSSVHVVSPTRQHVACCDLEELPQ 607

Query: 316 SLP 308
             P
Sbjct: 608 VAP 610


>UniRef50_UPI00003C0D78 Cluster: PREDICTED: similar to yellow-g
           CG5717-PA; n=1; Apis mellifera|Rep: PREDICTED: similar
           to yellow-g CG5717-PA - Apis mellifera
          Length = 375

 Score = 34.3 bits (75), Expect = 2.3
 Identities = 18/61 (29%), Positives = 32/61 (52%)
 Frame = +1

Query: 70  IFSWNVVDWNYPDQFSKQQALRTGALIPENALPVGIERWRNKLFVSVPRWRSGIPATLNY 249
           IFS   +DW  P Q +K     +G  I  N +    + + +K  +++PR++ G+P TL  
Sbjct: 32  IFSGLSLDW--PCQSTKNIYETSGRYIARNVIATRAQIFEDKAILALPRYKPGVPFTLGI 89

Query: 250 I 252
           +
Sbjct: 90  L 90


>UniRef50_UPI00003C0727 Cluster: PREDICTED: similar to ets variant
           gene 5; n=1; Apis mellifera|Rep: PREDICTED: similar to
           ets variant gene 5 - Apis mellifera
          Length = 621

 Score = 34.3 bits (75), Expect = 2.3
 Identities = 25/82 (30%), Positives = 40/82 (48%), Gaps = 4/82 (4%)
 Frame = +3

Query: 228 YSSYFELHSLDAPYEP-SPKLT--PYPSFEGNE-LGKLSKQD*LLYTGVKADQCDRLWVF 395
           + +Y  L S DAP E  S +L   PYP+ E +E +G+  +   +LY GV+  Q       
Sbjct: 532 FLNYGRLSSHDAPTESRSQELARIPYPAQETSEGIGRERETSSILYDGVQRSQLPAASTL 591

Query: 396 RRLALMDTTTLPNGVAPYTLKC 461
            +  L+D TT  + +   +  C
Sbjct: 592 SQPTLLDATTTSSKIEQTSYAC 613


>UniRef50_Q06211 Cluster: Methyl methanesulfonate-sensitivity protein
            1; n=2; Saccharomyces cerevisiae|Rep: Methyl
            methanesulfonate-sensitivity protein 1 - Saccharomyces
            cerevisiae (Baker's yeast)
          Length = 1407

 Score = 34.3 bits (75), Expect = 2.3
 Identities = 20/75 (26%), Positives = 40/75 (53%), Gaps = 1/75 (1%)
 Frame = +3

Query: 99   LPGPVLEAAGSQDWCSDTRERTARWYRKVEEQIVRQRS*VALRYSSYFELHSL-DAPYEP 275
            LP  V+    S DW SD+ + +  +   V++ ++      +L Y SYFE+H+L +  ++ 
Sbjct: 787  LPDCVIRTPFS-DWISDSLDFSDVYILSVQQALINGPYFCSLDYESYFEVHTLQNNCFKK 845

Query: 276  SPKLTPYPSFEGNEL 320
              + T   +F+G ++
Sbjct: 846  GSRCTSRVNFQGKDI 860


>UniRef50_UPI00015B5AE5 Cluster: PREDICTED: similar to conserved
           hypothetical protein; n=1; Nasonia vitripennis|Rep:
           PREDICTED: similar to conserved hypothetical protein -
           Nasonia vitripennis
          Length = 771

 Score = 33.9 bits (74), Expect = 3.0
 Identities = 19/64 (29%), Positives = 31/64 (48%)
 Frame = +1

Query: 61  LQEIFSWNVVDWNYPDQFSKQQALRTGALIPENALPVGIERWRNKLFVSVPRWRSGIPAT 240
           L   F W  +DW +P      +    G  + ++   V I+  R ++FV+ P+W  G P T
Sbjct: 382 LDVAFQWRFLDWVHPTVQLAGKNFTVGNPLSQD---VDIDN-RGRVFVTSPQWLEGTPIT 437

Query: 241 LNYI 252
           L+ I
Sbjct: 438 LSVI 441


>UniRef50_UPI00015B46D1 Cluster: PREDICTED: similar to major royal
           jelly protein 9; n=1; Nasonia vitripennis|Rep:
           PREDICTED: similar to major royal jelly protein 9 -
           Nasonia vitripennis
          Length = 417

 Score = 33.9 bits (74), Expect = 3.0
 Identities = 17/65 (26%), Positives = 36/65 (55%), Gaps = 1/65 (1%)
 Frame = +1

Query: 61  LQEIFSWNVVDWNYPDQFSKQQALRTGALIPENALPVGIERWRN-KLFVSVPRWRSGIPA 237
           LQ  + W  VD+ +  +  +++A+++GA       P  +++  + ++F++     SGIPA
Sbjct: 24  LQTAYEWKYVDYLWDSRVQRKEAIQSGAYDFSRVSPADVDKAPDGRVFITFTA-GSGIPA 82

Query: 238 TLNYI 252
           TL  +
Sbjct: 83  TLGVV 87


>UniRef50_Q2HZG6 Cluster: Yellow-d; n=1; Bombyx mori|Rep: Yellow-d -
           Bombyx mori (Silk moth)
          Length = 446

 Score = 33.9 bits (74), Expect = 3.0
 Identities = 14/69 (20%), Positives = 39/69 (56%), Gaps = 5/69 (7%)
 Frame = +1

Query: 61  LQEIFSWNVVDWNYPDQFSKQQALRTGALIPENALPVGIERW-----RNKLFVSVPRWRS 225
           L+ +  W  +++ +P++ ++  AL     +P +++P+ ++       ++++FV++PR+  
Sbjct: 28  LRVVRQWAELEFVFPNEEARSYALEKRFYVPGSSVPIDVDVQHRSGKKSRIFVTIPRFDE 87

Query: 226 GIPATLNYI 252
           G P T   +
Sbjct: 88  GRPVTFGTV 96


>UniRef50_Q7Q698 Cluster: ENSANGP00000010735; n=2; Culicidae|Rep:
           ENSANGP00000010735 - Anopheles gambiae str. PEST
          Length = 377

 Score = 33.5 bits (73), Expect = 4.0
 Identities = 13/34 (38%), Positives = 21/34 (61%)
 Frame = +1

Query: 151 PENALPVGIERWRNKLFVSVPRWRSGIPATLNYI 252
           P N +PV  +    ++ +++PR RSG+P TL  I
Sbjct: 59  PRNVMPVRCQYDNQRMLMALPRLRSGVPTTLGQI 92


>UniRef50_A5FL60 Cluster: Polysaccharide biosynthesis protein; n=1;
           Flavobacterium johnsoniae UW101|Rep: Polysaccharide
           biosynthesis protein - Flavobacterium johnsoniae UW101
          Length = 412

 Score = 32.7 bits (71), Expect = 6.9
 Identities = 19/64 (29%), Positives = 34/64 (53%), Gaps = 1/64 (1%)
 Frame = -1

Query: 541 EQIFFPGSVNKVFLRINFEFKLFKVKKHLSVYGATPFGNVVVSIS-AKRLNTQRRSHWSA 365
           + IF+  S+N     INF F L  +  ++ V+G T +G + +S+S    ++      W+A
Sbjct: 3   KNIFYSFSINF----INFLFPLILIPFYIHVFGITNYGLIAISLSLINYISVINDYSWNA 58

Query: 364 LTPV 353
           L P+
Sbjct: 59  LGPI 62


>UniRef50_Q0JQX4 Cluster: Os01g0133700 protein; n=9; Oryza
           sativa|Rep: Os01g0133700 protein - Oryza sativa subsp.
           japonica (Rice)
          Length = 419

 Score = 32.7 bits (71), Expect = 6.9
 Identities = 23/67 (34%), Positives = 27/67 (40%)
 Frame = +1

Query: 85  VVDWNYPDQFSKQQALRTGALIPENALPVGIERWRNKLFVSVPRWRSGIPATLNYIPWTL 264
           V D  Y   F    A R G LI E+ +P           VS+ RWR     TL Y  W  
Sbjct: 305 VSDERYFPAFRDSCAGRRGCLIDEHYIPT---------LVSLLRWRRNANRTLTYTEWRP 355

Query: 265 HMNHPRN 285
              HPR+
Sbjct: 356 RRPHPRS 362


>UniRef50_A0BLZ9 Cluster: Chromosome undetermined scaffold_115,
           whole genome shotgun sequence; n=1; Paramecium
           tetraurelia|Rep: Chromosome undetermined scaffold_115,
           whole genome shotgun sequence - Paramecium tetraurelia
          Length = 797

 Score = 32.7 bits (71), Expect = 6.9
 Identities = 17/34 (50%), Positives = 20/34 (58%)
 Frame = +1

Query: 94  WNYPDQFSKQQALRTGALIPENALPVGIERWRNK 195
           W +P QFSK    +TG LI +N   V I RWR K
Sbjct: 717 WLFPQQFSK----KTGILINKNCHLVNIIRWRRK 746


>UniRef50_Q9VFV1 Cluster: CG9792-PA; n=2; Sophophora|Rep: CG9792-PA
           - Drosophila melanogaster (Fruit fly)
          Length = 530

 Score = 32.3 bits (70), Expect = 9.2
 Identities = 16/64 (25%), Positives = 33/64 (51%)
 Frame = +1

Query: 61  LQEIFSWNVVDWNYPDQFSKQQALRTGALIPENALPVGIERWRNKLFVSVPRWRSGIPAT 240
           LQ    W ++ +N+  Q             P+N L  G+    +++FV+ P+  SG+P+T
Sbjct: 25  LQVAKQWKLLRYNFEPQAPVSDP---NFYNPQNVLITGLAVTDDRIFVATPKLFSGVPST 81

Query: 241 LNYI 252
           ++++
Sbjct: 82  VSWV 85


>UniRef50_Q54G75 Cluster: Putative uncharacterized protein; n=1;
           Dictyostelium discoideum AX4|Rep: Putative
           uncharacterized protein - Dictyostelium discoideum AX4
          Length = 1886

 Score = 32.3 bits (70), Expect = 9.2
 Identities = 20/69 (28%), Positives = 33/69 (47%)
 Frame = +3

Query: 240 FELHSLDAPYEPSPKLTPYPSFEGNELGKLSKQD*LLYTGVKADQCDRLWVFRRLALMDT 419
           FEL S    + PSP  +   S   N L  LS  +  + T  +++  D + +FR    + T
Sbjct: 196 FELVSQQKMHNPSPSSSSSSSSSSNTL--LSNSNEEINTAYQSNLSDVILLFRAFCKLST 253

Query: 420 TTLPNGVAP 446
             +P+G+ P
Sbjct: 254 KDIPDGLQP 262


>UniRef50_A2D8Q3 Cluster: Putative uncharacterized protein; n=1;
           Trichomonas vaginalis G3|Rep: Putative uncharacterized
           protein - Trichomonas vaginalis G3
          Length = 456

 Score = 32.3 bits (70), Expect = 9.2
 Identities = 20/65 (30%), Positives = 32/65 (49%), Gaps = 4/65 (6%)
 Frame = +1

Query: 28  GLDSLASATIKLQEIFSWNVVDWNYPDQFSKQQALRTGALIPEN-ALPVGIERWR---NK 195
           G++ +A   + + +    ++  W Y D+ SK +  RT   IP N  +P GI       NK
Sbjct: 264 GVNPIAQKELSIYQTIVLSLKTWEYADEISK-RITRTSKYIPRNEEVPTGISSLNAIPNK 322

Query: 196 LFVSV 210
           LF +V
Sbjct: 323 LFYAV 327


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 658,595,065
Number of Sequences: 1657284
Number of extensions: 13982788
Number of successful extensions: 37237
Number of sequences better than 10.0: 66
Number of HSP's better than 10.0 without gapping: 35994
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 37213
length of database: 575,637,011
effective HSP length: 97
effective length of database: 414,880,463
effective search space used: 43147568152
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).