BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0117 (798 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_A5DX32 Cluster: Putative uncharacterized protein; n=1; ... 33 6.3 UniRef50_A2R4J7 Cluster: Similarity to other proteins; n=11; Eur... 33 6.3 UniRef50_UPI0000499F84 Cluster: hypothetical protein 17.t00033; ... 33 8.3 UniRef50_Q17UB8 Cluster: Putative uncharacterized protein; n=1; ... 33 8.3 >UniRef50_A5DX32 Cluster: Putative uncharacterized protein; n=1; Lodderomyces elongisporus NRRL YB-4239|Rep: Putative uncharacterized protein - Lodderomyces elongisporus (Yeast) (Saccharomyces elongisporus) Length = 639 Score = 33.5 bits (73), Expect = 6.3 Identities = 16/40 (40%), Positives = 23/40 (57%) Frame = -3 Query: 268 RIYFKLLIHSSNQHINYHRKIAILYISTFTTYCLCIVKNK 149 RI + +I SN YH +I+ L +ST T C+C V N+ Sbjct: 88 RIPSQYIIPQSNVDQQYHTQISSLSLSTTTFCCICTVSNR 127 >UniRef50_A2R4J7 Cluster: Similarity to other proteins; n=11; Eurotiomycetidae|Rep: Similarity to other proteins - Aspergillus niger Length = 1372 Score = 33.5 bits (73), Expect = 6.3 Identities = 13/34 (38%), Positives = 22/34 (64%) Frame = +1 Query: 394 KPIEVTK*TPSPTLQHEVDIPPLKPELRTDSGQK 495 KP++V P+P +Q +V PP+K + + +GQK Sbjct: 702 KPVQVLIPAPTPEVQQKVQRPPIKKQAQRQTGQK 735 >UniRef50_UPI0000499F84 Cluster: hypothetical protein 17.t00033; n=1; Entamoeba histolytica HM-1:IMSS|Rep: hypothetical protein 17.t00033 - Entamoeba histolytica HM-1:IMSS Length = 283 Score = 33.1 bits (72), Expect = 8.3 Identities = 16/28 (57%), Positives = 20/28 (71%), Gaps = 1/28 (3%) Frame = +3 Query: 279 FNN*LTNK-KGINKYFIQYTLFILFITW 359 +NN L +K K INKYFI YT+F L + W Sbjct: 126 YNNYLKDKLKFINKYFINYTVFGLTLLW 153 >UniRef50_Q17UB8 Cluster: Putative uncharacterized protein; n=1; Phaseolus vulgaris endornavirus|Rep: Putative uncharacterized protein - Phaseolus vulgaris endornavirus Length = 314 Score = 33.1 bits (72), Expect = 8.3 Identities = 16/59 (27%), Positives = 27/59 (45%) Frame = -2 Query: 536 ISKPRTSKCHHTAYFCPESVLSSGFKGGISTSCCKVGDGVHFVTSIGFSIHQKGRKLVY 360 I+K KC Y+ +S ++ SC K+GDG + T+ F +H + +Y Sbjct: 80 ITKTENIKCEAVYYYATDS--TNPVVNVSKLSCIKIGDGWYLTTNEKFKVHNINKNSIY 136 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 680,914,464 Number of Sequences: 1657284 Number of extensions: 13456137 Number of successful extensions: 27221 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 26401 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 27216 length of database: 575,637,011 effective HSP length: 99 effective length of database: 411,565,895 effective search space used: 68319938570 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -