BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0101 (679 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q5MGF5 Cluster: Putative uncharacterized protein; n=2; ... 71 3e-11 UniRef50_Q1YKB3 Cluster: Putative uncharacterized protein; n=1; ... 34 2.8 UniRef50_Q0BU79 Cluster: Hypothetical cytosolic protein; n=1; Gr... 34 3.7 UniRef50_Q4P8V0 Cluster: Putative uncharacterized protein; n=3; ... 33 4.8 UniRef50_A6S886 Cluster: Putative uncharacterized protein; n=2; ... 33 6.4 >UniRef50_Q5MGF5 Cluster: Putative uncharacterized protein; n=2; Bombycoidea|Rep: Putative uncharacterized protein - Lonomia obliqua (Moth) Length = 74 Score = 70.5 bits (165), Expect = 3e-11 Identities = 34/58 (58%), Positives = 41/58 (70%) Frame = -1 Query: 313 IYGTGGLLTPLVAPVLXXXXXXXXXXXXXXXXXAYYGNLVAGSIVSQLTAAAMVAPTP 140 IYGTGGLLTP+VAP+L AYYGN+VAGS++SQLT+AAM+APTP Sbjct: 17 IYGTGGLLTPIVAPMLGFGSAGIAAGSTAAAAQAYYGNVVAGSVISQLTSAAMLAPTP 74 >UniRef50_Q1YKB3 Cluster: Putative uncharacterized protein; n=1; Aurantimonas sp. SI85-9A1|Rep: Putative uncharacterized protein - Aurantimonas sp. SI85-9A1 Length = 215 Score = 34.3 bits (75), Expect = 2.8 Identities = 23/74 (31%), Positives = 31/74 (41%), Gaps = 2/74 (2%) Frame = -3 Query: 359 GASSCISGKRGRRCCNIWHWGSVDSISGSRARFQLSGNS-GRKHSRCCTSILRKFSGR-Q 186 G S G GR+ + +G R+ + SGN G+ R C + GR Q Sbjct: 45 GEQSLAPGNSGRQITGKQKRSNNGQEAGQRSEPRHSGNERGKAEQRWCVDESNRRGGRSQ 104 Query: 185 HCVTVDCCCHGSPH 144 CV CHGSP+ Sbjct: 105 LCVAAAMRCHGSPN 118 >UniRef50_Q0BU79 Cluster: Hypothetical cytosolic protein; n=1; Granulibacter bethesdensis CGDNIH1|Rep: Hypothetical cytosolic protein - Granulobacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) Length = 90 Score = 33.9 bits (74), Expect = 3.7 Identities = 17/40 (42%), Positives = 22/40 (55%), Gaps = 2/40 (5%) Frame = -3 Query: 377 QKLKEHGA--SSCISGKRGRRCCNIWHWGSVDSISGSRAR 264 Q L+EHG S ++G+R RC N WH G D + R R Sbjct: 42 QALREHGTFQGSMLAGRRILRC-NPWHQGGYDPVPAGRCR 80 >UniRef50_Q4P8V0 Cluster: Putative uncharacterized protein; n=3; cellular organisms|Rep: Putative uncharacterized protein - Ustilago maydis (Smut fungus) Length = 1658 Score = 33.5 bits (73), Expect = 4.8 Identities = 23/81 (28%), Positives = 37/81 (45%), Gaps = 4/81 (4%) Frame = +1 Query: 439 DSSTVKPNETDTVNAEPVGDRESGQKYGLLSLTSSHRQPISSPAMYRPSLNAMSPLAF-- 612 D+ T + TDT +A+P+ D + S+ S ++ SS +M P+L ++ PL+ Sbjct: 1246 DAGTASTSSTDTASADPLQDAAAASDAS--SIRSGNKLSPSSSSMSLPTLASVDPLSAPR 1303 Query: 613 --SAFPNRGYTAFNKRPVQAL 669 P Y F R AL Sbjct: 1304 KKEEHPTPFYAGFGNRITDAL 1324 >UniRef50_A6S886 Cluster: Putative uncharacterized protein; n=2; Sclerotiniaceae|Rep: Putative uncharacterized protein - Botryotinia fuckeliana B05.10 Length = 441 Score = 33.1 bits (72), Expect = 6.4 Identities = 19/58 (32%), Positives = 32/58 (55%) Frame = +1 Query: 484 EPVGDRESGQKYGLLSLTSSHRQPISSPAMYRPSLNAMSPLAFSAFPNRGYTAFNKRP 657 E +G RES +K L ++ SH + SSP ++R S + + + A PN ++ +RP Sbjct: 4 EWLGSRES-RKRSLAEMSQSHTRISSSPELFRESTSNLGNSSRIAPPNAATSSLRERP 60 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 628,326,194 Number of Sequences: 1657284 Number of extensions: 11975046 Number of successful extensions: 28080 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 27160 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 28071 length of database: 575,637,011 effective HSP length: 98 effective length of database: 413,223,179 effective search space used: 52479343733 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -