BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30073 (348 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. 23 0.68 AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. 23 0.68 EF125547-1|ABL73931.1| 255|Tribolium castaneum obstractor D pro... 21 3.6 EF125544-1|ABL73928.1| 279|Tribolium castaneum obstractor B pro... 21 3.6 AY695257-1|AAW21974.1| 224|Tribolium castaneum intermediate neu... 21 4.8 X91618-1|CAA62821.1| 524|Tribolium castaneum hunchback protein. 20 6.3 EF222296-1|ABN79656.2| 403|Tribolium castaneum arginine vasopre... 20 6.3 AM292323-1|CAL23135.2| 587|Tribolium castaneum gustatory recept... 20 8.3 >AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. Length = 790 Score = 23.4 bits (48), Expect = 0.68 Identities = 10/23 (43%), Positives = 12/23 (52%) Frame = -1 Query: 237 PHPRLQRSPCRLLRNPSRGQPGP 169 PHP L P L +P+ PGP Sbjct: 232 PHPGLSPHPPHLSSHPAIVTPGP 254 Score = 21.0 bits (42), Expect = 3.6 Identities = 16/58 (27%), Positives = 26/58 (44%), Gaps = 11/58 (18%) Frame = -1 Query: 264 ISLVSTLRLPHPRLQRSPCRLLRNPSRGQPGPHGLRRTL-----------PPPYPHRR 124 +S +S+L P + SP + +PS P+ L+ L PPP+PH + Sbjct: 687 LSGLSSLTSPGGMVLPSPSTSVASPSVSVASPYMLQSPLTPHEAFDVKLPPPPHPHHQ 744 >AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. Length = 682 Score = 23.4 bits (48), Expect = 0.68 Identities = 10/23 (43%), Positives = 12/23 (52%) Frame = -1 Query: 237 PHPRLQRSPCRLLRNPSRGQPGP 169 PHP L P L +P+ PGP Sbjct: 124 PHPGLSPHPPHLSSHPAIVTPGP 146 Score = 21.0 bits (42), Expect = 3.6 Identities = 16/58 (27%), Positives = 26/58 (44%), Gaps = 11/58 (18%) Frame = -1 Query: 264 ISLVSTLRLPHPRLQRSPCRLLRNPSRGQPGPHGLRRTL-----------PPPYPHRR 124 +S +S+L P + SP + +PS P+ L+ L PPP+PH + Sbjct: 579 LSGLSSLTSPGGMVLPSPSTSVASPSVSVASPYMLQSPLTPHEAFDVKLPPPPHPHHQ 636 >EF125547-1|ABL73931.1| 255|Tribolium castaneum obstractor D protein. Length = 255 Score = 21.0 bits (42), Expect = 3.6 Identities = 15/39 (38%), Positives = 19/39 (48%), Gaps = 5/39 (12%) Frame = -1 Query: 234 HPRLQRSPCRLL--RNPSRGQPGPH---GLRRTLPPPYP 133 +PRLQR P L+ R R P + T+PPP P Sbjct: 180 YPRLQRCPAMLVFDRRSLRCVVPPTEDCDVPSTIPPPPP 218 >EF125544-1|ABL73928.1| 279|Tribolium castaneum obstractor B protein. Length = 279 Score = 21.0 bits (42), Expect = 3.6 Identities = 12/33 (36%), Positives = 15/33 (45%), Gaps = 1/33 (3%) Frame = -1 Query: 228 RLQRSPCRLLRNPSRGQPGPHGLRRTLP-PPYP 133 RL + L NP +P P + R P PP P Sbjct: 238 RLTDEQLKELENPPTPKPRPTKVSRRKPRPPRP 270 >AY695257-1|AAW21974.1| 224|Tribolium castaneum intermediate neuroblasts defectiveprotein protein. Length = 224 Score = 20.6 bits (41), Expect = 4.8 Identities = 9/25 (36%), Positives = 12/25 (48%) Frame = +1 Query: 154 SPKPVRTWLPSRRITKKSAWTPLKA 228 S K V+ W +RR+ K P A Sbjct: 157 SEKQVKIWFQNRRVKYKKEDLPAAA 181 >X91618-1|CAA62821.1| 524|Tribolium castaneum hunchback protein. Length = 524 Score = 20.2 bits (40), Expect = 6.3 Identities = 8/18 (44%), Positives = 9/18 (50%) Frame = +1 Query: 193 ITKKSAWTPLKARVREPK 246 ITK W K +RE K Sbjct: 212 ITKLEQWNHSKVHIREDK 229 >EF222296-1|ABN79656.2| 403|Tribolium castaneum arginine vasopressin receptor protein. Length = 403 Score = 20.2 bits (40), Expect = 6.3 Identities = 7/14 (50%), Positives = 9/14 (64%) Frame = +3 Query: 84 FDLMYAKRAFVHWY 125 F + KRA+V WY Sbjct: 194 FQEPWGKRAYVTWY 207 >AM292323-1|CAL23135.2| 587|Tribolium castaneum gustatory receptor candidate 2 protein. Length = 587 Score = 19.8 bits (39), Expect = 8.3 Identities = 8/18 (44%), Positives = 10/18 (55%) Frame = -2 Query: 239 SLTLAFSGVHADFFVILL 186 +L F G D F+ILL Sbjct: 528 NLQTTFGGTFGDTFIILL 545 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 62,786 Number of Sequences: 336 Number of extensions: 1237 Number of successful extensions: 15 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 15 length of database: 122,585 effective HSP length: 50 effective length of database: 105,785 effective search space used: 6876025 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 38 (20.3 bits)
- SilkBase 1999-2023 -