SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30049
         (727 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY887136-1|AAW78361.1|  580|Tribolium castaneum vasa RNA helicas...    46   4e-07
AY884062-1|AAX84203.1|  712|Tribolium castaneum laccase 2B protein.    26   0.27 
AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ...    26   0.27 
AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ...    26   0.27 
AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ...    26   0.27 
AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ...    26   0.27 
AY316682-1|AAQ83696.1|  456|Tribolium castaneum Sp-like zinc fin...    25   0.83 
EU019711-1|ABU25223.1|  534|Tribolium castaneum chitin deacetyla...    24   1.4  
DQ855503-1|ABH88190.1|  124|Tribolium castaneum chemosensory pro...    23   2.5  
AY884061-1|AAX84202.1|  717|Tribolium castaneum laccase 2A protein.    23   2.5  
DQ855498-1|ABH88185.1|  127|Tribolium castaneum chemosensory pro...    23   3.3  
AY008296-1|AAG22858.1|  556|Tribolium castaneum Dorsal protein.        23   3.3  
AM292330-1|CAL23142.2|  408|Tribolium castaneum gustatory recept...    23   3.3  
AJ973445-1|CAJ01492.1|  127|Tribolium castaneum hypothetical pro...    23   3.3  
DQ414248-1|ABD63010.2|  311|Tribolium castaneum sloppy-paired pr...    22   4.4  
EF592538-1|ABQ95984.1|  582|Tribolium castaneum beta-N-acetylglu...    22   5.8  
AM292354-1|CAL23166.1|  321|Tribolium castaneum gustatory recept...    22   5.8  
AM292337-1|CAL23149.2|  452|Tribolium castaneum gustatory recept...    22   5.8  
DQ855502-1|ABH88189.1|  126|Tribolium castaneum chemosensory pro...    21   7.7  
DQ855500-1|ABH88187.1|  126|Tribolium castaneum chemosensory pro...    21   7.7  
DQ855495-1|ABH88182.1|  126|Tribolium castaneum chemosensory pro...    21   7.7  
DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro...    21   7.7  

>AY887136-1|AAW78361.1|  580|Tribolium castaneum vasa RNA helicase
           protein.
          Length = 580

 Score = 45.6 bits (103), Expect = 4e-07
 Identities = 20/52 (38%), Positives = 34/52 (65%)
 Frame = +3

Query: 102 VETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           + +F+   L+  LL  +   G+ KP+AIQ+ AI   + GRD+++ AQ+G+GK
Sbjct: 157 ITSFETSGLRPHLLENVKKSGYTKPTAIQKYAIPVILSGRDLMSCAQTGSGK 208



 Score = 26.6 bits (56), Expect = 0.20
 Identities = 13/29 (44%), Positives = 17/29 (58%)
 Frame = +1

Query: 478 ALQGRVYDMIIVVRFHANTIKLFVLDEAD 564
           A  GR+ D +       N++K FVLDEAD
Sbjct: 291 ATPGRLKDFVNRGNVSFNSLKYFVLDEAD 319



 Score = 23.0 bits (47), Expect = 2.5
 Identities = 13/36 (36%), Positives = 18/36 (50%)
 Frame = +2

Query: 320 LILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTN 427
           +I++PTRELA QI         +   K     GGT+
Sbjct: 239 VIMSPTRELAIQIADQGKKFAYNSTVKVAVIYGGTS 274


>AY884062-1|AAX84203.1|  712|Tribolium castaneum laccase 2B protein.
          Length = 712

 Score = 26.2 bits (55), Expect = 0.27
 Identities = 14/40 (35%), Positives = 20/40 (50%), Gaps = 2/40 (5%)
 Frame = -3

Query: 131 FEVHVIEGFDNLIPVGVQVSQGPFPEVHR--NYLDPSMAH 18
           F  H++ G + +I VG Q+   PF    R  N+L P   H
Sbjct: 673 FLFHIVIGMNLIIHVGTQLIYRPFSHFPRCGNHLPPISLH 712



 Score = 23.0 bits (47), Expect = 2.5
 Identities = 7/19 (36%), Positives = 11/19 (57%)
 Frame = +1

Query: 325 PGSHKRAGPTNSEGGDSSW 381
           PG+ K+ GP +     +SW
Sbjct: 28  PGAKKKVGPIDQSAAAASW 46


>AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase
            variant 2 protein.
          Length = 1558

 Score = 26.2 bits (55), Expect = 0.27
 Identities = 17/59 (28%), Positives = 27/59 (45%), Gaps = 4/59 (6%)
 Frame = +1

Query: 214  KDAMLSLKPSQELENCYFLYIDSTTNRYKH----S*MSSFDPGSHKRAGPTNSEGGDSS 378
            K +++++  S E+ N    +I+ T +   H      MS+   G H   G    EGGD S
Sbjct: 1131 KASLINIADSLEMLNKRLDHIEKTIDPSGHISRRRSMSASSRGDHHHLGAVTEEGGDES 1189


>AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase
            variant 1 protein.
          Length = 1558

 Score = 26.2 bits (55), Expect = 0.27
 Identities = 17/59 (28%), Positives = 27/59 (45%), Gaps = 4/59 (6%)
 Frame = +1

Query: 214  KDAMLSLKPSQELENCYFLYIDSTTNRYKH----S*MSSFDPGSHKRAGPTNSEGGDSS 378
            K +++++  S E+ N    +I+ T +   H      MS+   G H   G    EGGD S
Sbjct: 1131 KASLINIADSLEMLNKRLDHIEKTIDPSGHISRRRSMSASSRGDHHHLGAVTEEGGDES 1189


>AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase CHS1B
            protein.
          Length = 1558

 Score = 26.2 bits (55), Expect = 0.27
 Identities = 17/59 (28%), Positives = 27/59 (45%), Gaps = 4/59 (6%)
 Frame = +1

Query: 214  KDAMLSLKPSQELENCYFLYIDSTTNRYKH----S*MSSFDPGSHKRAGPTNSEGGDSS 378
            K +++++  S E+ N    +I+ T +   H      MS+   G H   G    EGGD S
Sbjct: 1131 KASLINIADSLEMLNKRLDHIEKTIDPSGHISRRRSMSASSRGDHHHLGAVTEEGGDES 1189


>AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A
            protein.
          Length = 1558

 Score = 26.2 bits (55), Expect = 0.27
 Identities = 17/59 (28%), Positives = 27/59 (45%), Gaps = 4/59 (6%)
 Frame = +1

Query: 214  KDAMLSLKPSQELENCYFLYIDSTTNRYKH----S*MSSFDPGSHKRAGPTNSEGGDSS 378
            K +++++  S E+ N    +I+ T +   H      MS+   G H   G    EGGD S
Sbjct: 1131 KASLINIADSLEMLNKRLDHIEKTIDPSGHISRRRSMSASSRGDHHHLGAVTEEGGDES 1189


>AY316682-1|AAQ83696.1|  456|Tribolium castaneum Sp-like zinc finger
           protein protein.
          Length = 456

 Score = 24.6 bits (51), Expect = 0.83
 Identities = 15/65 (23%), Positives = 27/65 (41%)
 Frame = -1

Query: 502 YHIHDPGVPTTYMNTTLQLANIFTDIGATNASMAFSIQVITKSYHHLLNLLGQLSCGSQD 323
           + +H  G          Q+AN  TD  +   S+A S  +++   H L +    +  G+Q 
Sbjct: 190 WDVHSTGSWLDMSGGMHQMANYSTDYSSLTHSLAASNHLLSSGQHLLQDTYKSMLPGAQT 249

Query: 322 QSLTF 308
              +F
Sbjct: 250 VGASF 254


>EU019711-1|ABU25223.1|  534|Tribolium castaneum chitin deacetylase
           1 protein.
          Length = 534

 Score = 23.8 bits (49), Expect = 1.4
 Identities = 7/17 (41%), Positives = 10/17 (58%)
 Frame = -3

Query: 473 HVHEHHSPVGEYLHGHW 423
           H  E+ +P+G Y H  W
Sbjct: 412 HYEENRAPLGLYFHAAW 428


>DQ855503-1|ABH88190.1|  124|Tribolium castaneum chemosensory
           protein 17 protein.
          Length = 124

 Score = 23.0 bits (47), Expect = 2.5
 Identities = 7/17 (41%), Positives = 10/17 (58%)
 Frame = +1

Query: 415 WWHQCP*RYSPTGEWCS 465
           WW +   +Y P GE+ S
Sbjct: 96  WWQELQEKYDPKGEYKS 112


>AY884061-1|AAX84202.1|  717|Tribolium castaneum laccase 2A protein.
          Length = 717

 Score = 23.0 bits (47), Expect = 2.5
 Identities = 7/19 (36%), Positives = 11/19 (57%)
 Frame = +1

Query: 325 PGSHKRAGPTNSEGGDSSW 381
           PG+ K+ GP +     +SW
Sbjct: 28  PGAKKKVGPIDQSAAAASW 46


>DQ855498-1|ABH88185.1|  127|Tribolium castaneum chemosensory
           protein 12 protein.
          Length = 127

 Score = 22.6 bits (46), Expect = 3.3
 Identities = 6/13 (46%), Positives = 9/13 (69%)
 Frame = +1

Query: 415 WWHQCP*RYSPTG 453
           WW++   +Y PTG
Sbjct: 98  WWNELEAKYDPTG 110


>AY008296-1|AAG22858.1|  556|Tribolium castaneum Dorsal protein.
          Length = 556

 Score = 22.6 bits (46), Expect = 3.3
 Identities = 8/22 (36%), Positives = 13/22 (59%)
 Frame = -3

Query: 92  PVGVQVSQGPFPEVHRNYLDPS 27
           P G Q+ + P P V  +Y+ P+
Sbjct: 400 PYGGQMFEAPIPNVSPHYVTPT 421


>AM292330-1|CAL23142.2|  408|Tribolium castaneum gustatory receptor
           candidate 9 protein.
          Length = 408

 Score = 22.6 bits (46), Expect = 3.3
 Identities = 9/18 (50%), Positives = 10/18 (55%)
 Frame = +2

Query: 359 QKVVIALGDHLNAKCHAC 412
           +K  IAL D  N  CH C
Sbjct: 261 EKSWIALNDDYNRLCHLC 278


>AJ973445-1|CAJ01492.1|  127|Tribolium castaneum hypothetical
           protein protein.
          Length = 127

 Score = 22.6 bits (46), Expect = 3.3
 Identities = 6/13 (46%), Positives = 9/13 (69%)
 Frame = +1

Query: 415 WWHQCP*RYSPTG 453
           WW++   +Y PTG
Sbjct: 98  WWNELEAKYDPTG 110


>DQ414248-1|ABD63010.2|  311|Tribolium castaneum sloppy-paired
           protein.
          Length = 311

 Score = 22.2 bits (45), Expect = 4.4
 Identities = 10/34 (29%), Positives = 20/34 (58%)
 Frame = -3

Query: 113 EGFDNLIPVGVQVSQGPFPEVHRNYLDPSMAHFW 12
           +G+ N I   + +++  F +V R+Y DP   ++W
Sbjct: 125 QGWQNSIRHNLSLNKC-FVKVPRHYDDPGKGNYW 157


>EF592538-1|ABQ95984.1|  582|Tribolium castaneum
           beta-N-acetylglucosaminidase NAG3 protein.
          Length = 582

 Score = 21.8 bits (44), Expect = 5.8
 Identities = 7/17 (41%), Positives = 13/17 (76%)
 Frame = +3

Query: 72  GHLHTDWDQVVETFDDM 122
           GHL+ D D+V++  +D+
Sbjct: 336 GHLNPDNDEVLQVLEDI 352


>AM292354-1|CAL23166.1|  321|Tribolium castaneum gustatory receptor
           candidate 33 protein.
          Length = 321

 Score = 21.8 bits (44), Expect = 5.8
 Identities = 7/21 (33%), Positives = 12/21 (57%)
 Frame = -2

Query: 609 HQWIWSLENLWNNIFISFIKN 547
           + W    E+ W+   +SFI+N
Sbjct: 120 YYWRQQYEDFWHRYTLSFIEN 140


>AM292337-1|CAL23149.2|  452|Tribolium castaneum gustatory receptor
           candidate 16 protein.
          Length = 452

 Score = 21.8 bits (44), Expect = 5.8
 Identities = 11/40 (27%), Positives = 21/40 (52%)
 Frame = +1

Query: 457 WCSCTWWALQGRVYDMIIVVRFHANTIKLFVLDEADENVV 576
           W + T+  L G  Y ++ V  FH + ++  ++    +NVV
Sbjct: 258 WITVTFILLVGDSYIVMYVFFFHLSDVRYVMVVYLLKNVV 297


>DQ855502-1|ABH88189.1|  126|Tribolium castaneum chemosensory
           protein 16 protein.
          Length = 126

 Score = 21.4 bits (43), Expect = 7.7
 Identities = 5/16 (31%), Positives = 10/16 (62%)
 Frame = +1

Query: 412 HWWHQCP*RYSPTGEW 459
           +WW +   ++ P GE+
Sbjct: 96  NWWQELESKFDPQGEY 111


>DQ855500-1|ABH88187.1|  126|Tribolium castaneum chemosensory
           protein 14 protein.
          Length = 126

 Score = 21.4 bits (43), Expect = 7.7
 Identities = 5/16 (31%), Positives = 10/16 (62%)
 Frame = +1

Query: 412 HWWHQCP*RYSPTGEW 459
           +WW +   ++ P GE+
Sbjct: 96  NWWQELEAKFDPKGEY 111


>DQ855495-1|ABH88182.1|  126|Tribolium castaneum chemosensory
           protein 9 protein.
          Length = 126

 Score = 21.4 bits (43), Expect = 7.7
 Identities = 5/16 (31%), Positives = 10/16 (62%)
 Frame = +1

Query: 412 HWWHQCP*RYSPTGEW 459
           +WW +   ++ P GE+
Sbjct: 96  NWWQELESKFDPQGEY 111


>DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein.
          Length = 2700

 Score = 21.4 bits (43), Expect = 7.7
 Identities = 10/28 (35%), Positives = 12/28 (42%)
 Frame = +3

Query: 12   PKMGHRRIKVVTMDLREWTLGHLHTDWD 95
            P    R IK V   L +W    L  DW+
Sbjct: 1493 PAARARFIKHVLQFLEKWNFDGLDLDWE 1520


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 189,485
Number of Sequences: 336
Number of extensions: 4325
Number of successful extensions: 29
Number of sequences better than 10.0: 22
Number of HSP's better than 10.0 without gapping: 26
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 29
length of database: 122,585
effective HSP length: 55
effective length of database: 104,105
effective search space used: 19363530
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).