SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30047
         (794 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AM292344-1|CAL23156.1|  291|Tribolium castaneum gustatory recept...    25   0.70 
AM292380-1|CAL23192.2|  489|Tribolium castaneum gustatory recept...    23   2.1  
DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome ad...    23   2.8  
AF442747-1|AAL40947.1|  669|Tribolium castaneum ABC transmembran...    23   2.8  
AF422804-1|AAL56571.1|  669|Tribolium castaneum ABC transmembran...    23   2.8  
EF125544-1|ABL73928.1|  279|Tribolium castaneum obstractor B pro...    22   4.9  
AY884064-1|AAX84205.1|  683|Tribolium castaneum pro-phenol oxida...    22   4.9  
EF222294-1|ABN79654.1|  451|Tribolium castaneum ecdysis triggeri...    22   6.5  
AM292368-1|CAL23180.2|  387|Tribolium castaneum gustatory recept...    22   6.5  
AM292347-1|CAL23159.2|  387|Tribolium castaneum gustatory recept...    22   6.5  
AM292327-1|CAL23139.2|  387|Tribolium castaneum gustatory recept...    22   6.5  

>AM292344-1|CAL23156.1|  291|Tribolium castaneum gustatory receptor
           candidate 23 protein.
          Length = 291

 Score = 25.0 bits (52), Expect = 0.70
 Identities = 10/28 (35%), Positives = 15/28 (53%)
 Frame = -1

Query: 206 FLSHSLIAAKSCALVLTSSFNSSRIFFH 123
           FL H+LI  K+C +     F  + +F H
Sbjct: 136 FLEHNLIRLKNCVIYFNRIFGWNILFGH 163


>AM292380-1|CAL23192.2|  489|Tribolium castaneum gustatory receptor
           candidate 59 protein.
          Length = 489

 Score = 23.4 bits (48), Expect = 2.1
 Identities = 13/30 (43%), Positives = 16/30 (53%)
 Frame = +1

Query: 19  HLNRITKQLVPNWIVTYCKSEMASTATLIQ 108
           H N  T + +  WIV Y  S+M S   LIQ
Sbjct: 155 HCNNTTWRCLYRWIVLYTLSKM-SQVMLIQ 183


>DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome
           adhesion molecule splicevariant 3.12.3.1 protein.
          Length = 1639

 Score = 23.0 bits (47), Expect = 2.8
 Identities = 12/36 (33%), Positives = 20/36 (55%)
 Frame = -1

Query: 263 ASEKVIRHASSHSSGRWGCFLSHSLIAAKSCALVLT 156
           A   +IR A    SG++ C +++S +  +S   VLT
Sbjct: 289 AGTLIIREAKVEDSGKYLCVVNNS-VGGESVETVLT 323


>AF442747-1|AAL40947.1|  669|Tribolium castaneum ABC transmembrane
           transporter protein.
          Length = 669

 Score = 23.0 bits (47), Expect = 2.8
 Identities = 10/33 (30%), Positives = 15/33 (45%)
 Frame = -2

Query: 679 ISFQFHWISFLYTNERISSALLVKSWRRWLGIR 581
           I   F W+SFL      + AL++  W     I+
Sbjct: 581 IPIYFKWLSFLSWFRYGNGALMINQWENVTNIQ 613


>AF422804-1|AAL56571.1|  669|Tribolium castaneum ABC transmembrane
           transporter white protein.
          Length = 669

 Score = 23.0 bits (47), Expect = 2.8
 Identities = 10/33 (30%), Positives = 15/33 (45%)
 Frame = -2

Query: 679 ISFQFHWISFLYTNERISSALLVKSWRRWLGIR 581
           I   F W+SFL      + AL++  W     I+
Sbjct: 581 IPIYFKWLSFLSWFRYGNGALMINQWENVTNIQ 613


>EF125544-1|ABL73928.1|  279|Tribolium castaneum obstractor B
           protein.
          Length = 279

 Score = 22.2 bits (45), Expect = 4.9
 Identities = 10/21 (47%), Positives = 11/21 (52%)
 Frame = -3

Query: 738 FYQC*NTTIPRRGRCVDKRVF 676
           FY C N   PRR  C   +VF
Sbjct: 195 FYVCINGDTPRRSGCKLGQVF 215


>AY884064-1|AAX84205.1|  683|Tribolium castaneum pro-phenol oxidase
           subunit 2 protein.
          Length = 683

 Score = 22.2 bits (45), Expect = 4.9
 Identities = 11/30 (36%), Positives = 18/30 (60%)
 Frame = +1

Query: 109 PSGELWKKIREELNEDVNTRAQDLAAIKEW 198
           PS    +K+R+ LN +V+   QD+  +K W
Sbjct: 283 PSRVANQKLRD-LNREVDQIKQDVEDLKRW 311


>EF222294-1|ABN79654.1|  451|Tribolium castaneum ecdysis triggering
           hormone receptorisoform B protein.
          Length = 451

 Score = 21.8 bits (44), Expect = 6.5
 Identities = 8/24 (33%), Positives = 15/24 (62%)
 Frame = -2

Query: 502 ASLKTSLSWFVSRFLSSALAMVTR 431
           ASL   L+WF++   +S +  +T+
Sbjct: 187 ASLICLLAWFIAALFTSPILAITQ 210


>AM292368-1|CAL23180.2|  387|Tribolium castaneum gustatory receptor
           candidate 47 protein.
          Length = 387

 Score = 21.8 bits (44), Expect = 6.5
 Identities = 9/19 (47%), Positives = 13/19 (68%)
 Frame = -1

Query: 311 EVHIKFLFTFLKGEATASE 255
           E+HIK +  +L+G A A E
Sbjct: 13  ELHIKQISKWLRGSARAQE 31


>AM292347-1|CAL23159.2|  387|Tribolium castaneum gustatory receptor
           candidate 26 protein.
          Length = 387

 Score = 21.8 bits (44), Expect = 6.5
 Identities = 9/19 (47%), Positives = 13/19 (68%)
 Frame = -1

Query: 311 EVHIKFLFTFLKGEATASE 255
           E+HIK +  +L+G A A E
Sbjct: 13  ELHIKQISKWLRGSARAQE 31


>AM292327-1|CAL23139.2|  387|Tribolium castaneum gustatory receptor
           candidate 6 protein.
          Length = 387

 Score = 21.8 bits (44), Expect = 6.5
 Identities = 9/19 (47%), Positives = 13/19 (68%)
 Frame = -1

Query: 311 EVHIKFLFTFLKGEATASE 255
           E+HIK +  +L+G A A E
Sbjct: 13  ELHIKQISKWLRGSARAQE 31


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 196,458
Number of Sequences: 336
Number of extensions: 4392
Number of successful extensions: 19
Number of sequences better than 10.0: 11
Number of HSP's better than 10.0 without gapping: 19
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 19
length of database: 122,585
effective HSP length: 56
effective length of database: 103,769
effective search space used: 21583952
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).