SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30038
         (661 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF227923-1|AAF36721.1|  351|Tribolium castaneum abdominal-B prot...    27   0.14 
DQ855500-1|ABH88187.1|  126|Tribolium castaneum chemosensory pro...    25   0.55 
AM292359-1|CAL23171.2|  436|Tribolium castaneum gustatory recept...    25   0.55 
DQ855502-1|ABH88189.1|  126|Tribolium castaneum chemosensory pro...    24   0.96 
DQ855495-1|ABH88182.1|  126|Tribolium castaneum chemosensory pro...    24   0.96 
AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ...    23   2.2  
AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ...    23   2.2  
DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro...    23   2.9  
AJ606487-1|CAE55183.1|  203|Tribolium castaneum Giant protein pr...    23   2.9  
AF017415-2|AAB70263.1|  284|Tribolium castaneum abdominal-A prot...    23   2.9  
AF017415-1|AAB70262.1|  343|Tribolium castaneum abdominal-AII pr...    23   2.9  
EU019713-1|ABU25225.1|  528|Tribolium castaneum chitin deacetyla...    22   3.9  
EU019712-1|ABU25224.1|  535|Tribolium castaneum chitin deacetyla...    22   3.9  
DQ414247-1|ABD63009.2|  414|Tribolium castaneum paired protein.        22   3.9  
AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ...    22   3.9  
AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ...    22   3.9  
AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ...    22   3.9  
AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ...    22   3.9  
DQ855503-1|ABH88190.1|  124|Tribolium castaneum chemosensory pro...    22   5.1  
AY362543-1|AAQ63455.1|  677|Tribolium castaneum chitin synthase ...    22   5.1  
AM292380-1|CAL23192.2|  489|Tribolium castaneum gustatory recept...    21   9.0  
AM292346-1|CAL23158.2|  314|Tribolium castaneum gustatory recept...    21   9.0  

>AF227923-1|AAF36721.1|  351|Tribolium castaneum abdominal-B
           protein.
          Length = 351

 Score = 27.1 bits (57), Expect = 0.14
 Identities = 14/39 (35%), Positives = 18/39 (46%), Gaps = 1/39 (2%)
 Frame = -2

Query: 198 HADHHTL-MAGPSDDRGEYGARSIISCETGLAHTGAIVY 85
           H DH  +    P+DDRG   A + +  ET   H  A  Y
Sbjct: 160 HVDHQPVPYLTPADDRGRVAAAAAMVAETASFHHDAAGY 198


>DQ855500-1|ABH88187.1|  126|Tribolium castaneum chemosensory
           protein 14 protein.
          Length = 126

 Score = 25.0 bits (52), Expect = 0.55
 Identities = 7/18 (38%), Positives = 13/18 (72%)
 Frame = -1

Query: 163 RRSRGIRREEHHLLRNRP 110
           +   G+R+  HHL++N+P
Sbjct: 78  KHKEGVRKVLHHLIKNKP 95


>AM292359-1|CAL23171.2|  436|Tribolium castaneum gustatory receptor
           candidate 38 protein.
          Length = 436

 Score = 25.0 bits (52), Expect = 0.55
 Identities = 11/32 (34%), Positives = 19/32 (59%)
 Frame = +3

Query: 279 IVTNWDDMEKIWHHTFYNELRVAPEEHPVLLT 374
           +VT+W + E+I++     +L V     PV+LT
Sbjct: 158 VVTDWVNFERIYYKLTKKKLSVFFGNKPVILT 189


>DQ855502-1|ABH88189.1|  126|Tribolium castaneum chemosensory
           protein 16 protein.
          Length = 126

 Score = 24.2 bits (50), Expect = 0.96
 Identities = 7/18 (38%), Positives = 12/18 (66%)
 Frame = -1

Query: 163 RRSRGIRREEHHLLRNRP 110
           +   G+R+  HHL+ N+P
Sbjct: 78  KHKEGVRKVIHHLIENKP 95


>DQ855495-1|ABH88182.1|  126|Tribolium castaneum chemosensory
           protein 9 protein.
          Length = 126

 Score = 24.2 bits (50), Expect = 0.96
 Identities = 7/18 (38%), Positives = 12/18 (66%)
 Frame = -1

Query: 163 RRSRGIRREEHHLLRNRP 110
           +   G+R+  HHL+ N+P
Sbjct: 78  KHKEGVRKVIHHLIENKP 95


>AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase
            protein.
          Length = 1464

 Score = 23.0 bits (47), Expect = 2.2
 Identities = 11/50 (22%), Positives = 23/50 (46%)
 Frame = +3

Query: 210  LVRRRRGTEQKRYPDLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEH 359
            L R+    E+ +YPDL+ P    + T  +  +    +   +    AP+++
Sbjct: 1112 LNRKIESLEKMQYPDLRSPAVSNVTTFMEGSKATVKNNVEDNYMEAPQDN 1161



 Score = 21.8 bits (44), Expect = 5.1
 Identities = 14/48 (29%), Positives = 23/48 (47%), Gaps = 3/48 (6%)
 Frame = -1

Query: 565 CVSLVD-GYGVGDTVAG--VQHIPVVRPDAYSESTAWMATYMAGVLNV 431
           C  L+  GY V  + A     H P    + Y++   WM + MA +L++
Sbjct: 817 CTLLLQRGYRVEYSAASDAFTHCPEGFNEFYNQRRRWMPSTMANILDL 864


>AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2
            protein.
          Length = 1464

 Score = 23.0 bits (47), Expect = 2.2
 Identities = 11/50 (22%), Positives = 23/50 (46%)
 Frame = +3

Query: 210  LVRRRRGTEQKRYPDLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEH 359
            L R+    E+ +YPDL+ P    + T  +  +    +   +    AP+++
Sbjct: 1112 LNRKIESLEKMQYPDLRSPAVSNVTTFMEGSKATVKNNVEDNYMEAPQDN 1161



 Score = 21.8 bits (44), Expect = 5.1
 Identities = 14/48 (29%), Positives = 23/48 (47%), Gaps = 3/48 (6%)
 Frame = -1

Query: 565 CVSLVD-GYGVGDTVAG--VQHIPVVRPDAYSESTAWMATYMAGVLNV 431
           C  L+  GY V  + A     H P    + Y++   WM + MA +L++
Sbjct: 817 CTLLLQRGYRVEYSAASDAFTHCPEGFNEFYNQRRRWMPSTMANILDL 864


>DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein.
          Length = 2700

 Score = 22.6 bits (46), Expect = 2.9
 Identities = 12/41 (29%), Positives = 14/41 (34%)
 Frame = +3

Query: 477  SLYASGRTTGMCWTPATVSPTPYPSTRDTHSLTPSCVWTWP 599
            S + S  TT   WT  T   T       T + T      WP
Sbjct: 1040 STWWSSTTTSPWWTTTTTRRTTTTRPTTTSTTTRPTTTNWP 1080


>AJ606487-1|CAE55183.1|  203|Tribolium castaneum Giant protein
           protein.
          Length = 203

 Score = 22.6 bits (46), Expect = 2.9
 Identities = 14/47 (29%), Positives = 22/47 (46%)
 Frame = +3

Query: 465 QAVLSLYASGRTTGMCWTPATVSPTPYPSTRDTHSLTPSCVWTWPVA 605
           +A  ++  +G    +C      SP PYP  R      PSC ++ PV+
Sbjct: 3   KAEFAMETAGEVLDLCVRKRPHSPEPYP-PRCPPIYEPSCQYS-PVS 47


>AF017415-2|AAB70263.1|  284|Tribolium castaneum abdominal-A
           protein.
          Length = 284

 Score = 22.6 bits (46), Expect = 2.9
 Identities = 9/23 (39%), Positives = 11/23 (47%)
 Frame = +3

Query: 150 PLDRRKAPPSGCDGRHGTERLVR 218
           P DR    P+GC  R G +   R
Sbjct: 144 PFDRVVCGPNGCPRRRGRQTYTR 166


>AF017415-1|AAB70262.1|  343|Tribolium castaneum abdominal-AII
           protein.
          Length = 343

 Score = 22.6 bits (46), Expect = 2.9
 Identities = 9/23 (39%), Positives = 11/23 (47%)
 Frame = +3

Query: 150 PLDRRKAPPSGCDGRHGTERLVR 218
           P DR    P+GC  R G +   R
Sbjct: 203 PFDRVVCGPNGCPRRRGRQTYTR 225


>EU019713-1|ABU25225.1|  528|Tribolium castaneum chitin deacetylase
           2B protein.
          Length = 528

 Score = 22.2 bits (45), Expect = 3.9
 Identities = 9/24 (37%), Positives = 15/24 (62%), Gaps = 1/24 (4%)
 Frame = -1

Query: 124 LRNRP-CTYRSHCLLPTRQLPRRT 56
           ++ +P C+  + C L TR+LP  T
Sbjct: 477 IKGQPYCSLPNSCALTTRELPGET 500


>EU019712-1|ABU25224.1|  535|Tribolium castaneum chitin deacetylase
           2A protein.
          Length = 535

 Score = 22.2 bits (45), Expect = 3.9
 Identities = 9/24 (37%), Positives = 15/24 (62%), Gaps = 1/24 (4%)
 Frame = -1

Query: 124 LRNRP-CTYRSHCLLPTRQLPRRT 56
           ++ +P C+  + C L TR+LP  T
Sbjct: 484 IKGQPYCSLPNSCALTTRELPGET 507


>DQ414247-1|ABD63009.2|  414|Tribolium castaneum paired protein.
          Length = 414

 Score = 22.2 bits (45), Expect = 3.9
 Identities = 11/30 (36%), Positives = 15/30 (50%)
 Frame = +3

Query: 516 TPATVSPTPYPSTRDTHSLTPSCVWTWPVA 605
           TP +V    YPS    HS +P+   T  +A
Sbjct: 314 TPTSVMTELYPSPVPGHSTSPNLPLTHNIA 343


>AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase
           variant 2 protein.
          Length = 1558

 Score = 22.2 bits (45), Expect = 3.9
 Identities = 10/38 (26%), Positives = 19/38 (50%)
 Frame = -3

Query: 317 MPNLLHVIPVSDDSVFDGVFEVRIPLLLCASSPTYESF 204
           +P++  +IP  DD+  D      I +LL     +Y ++
Sbjct: 355 LPDISEIIPTGDDTTMDSNDMTAIYVLLINIFASYFAY 392


>AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase
           variant 1 protein.
          Length = 1558

 Score = 22.2 bits (45), Expect = 3.9
 Identities = 10/38 (26%), Positives = 19/38 (50%)
 Frame = -3

Query: 317 MPNLLHVIPVSDDSVFDGVFEVRIPLLLCASSPTYESF 204
           +P++  +IP  DD+  D      I +LL     +Y ++
Sbjct: 355 LPDISEIIPTGDDTTMDSNDMTAIYVLLINIFASYFAY 392


>AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase
           CHS1B protein.
          Length = 1558

 Score = 22.2 bits (45), Expect = 3.9
 Identities = 10/38 (26%), Positives = 19/38 (50%)
 Frame = -3

Query: 317 MPNLLHVIPVSDDSVFDGVFEVRIPLLLCASSPTYESF 204
           +P++  +IP  DD+  D      I +LL     +Y ++
Sbjct: 355 LPDISEIIPTGDDTTMDSNDMTAIYVLLINIFASYFAY 392


>AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase
           CHS1A protein.
          Length = 1558

 Score = 22.2 bits (45), Expect = 3.9
 Identities = 10/38 (26%), Positives = 19/38 (50%)
 Frame = -3

Query: 317 MPNLLHVIPVSDDSVFDGVFEVRIPLLLCASSPTYESF 204
           +P++  +IP  DD+  D      I +LL     +Y ++
Sbjct: 355 LPDISEIIPTGDDTTMDSNDMTAIYVLLINIFASYFAY 392


>DQ855503-1|ABH88190.1|  124|Tribolium castaneum chemosensory
           protein 17 protein.
          Length = 124

 Score = 21.8 bits (44), Expect = 5.1
 Identities = 6/18 (33%), Positives = 12/18 (66%)
 Frame = -1

Query: 163 RRSRGIRREEHHLLRNRP 110
           +   G+R+   HL++N+P
Sbjct: 77  KHKEGVRKVIRHLIKNKP 94


>AY362543-1|AAQ63455.1|  677|Tribolium castaneum chitin synthase
           protein.
          Length = 677

 Score = 21.8 bits (44), Expect = 5.1
 Identities = 14/48 (29%), Positives = 23/48 (47%), Gaps = 3/48 (6%)
 Frame = -1

Query: 565 CVSLVD-GYGVGDTVAG--VQHIPVVRPDAYSESTAWMATYMAGVLNV 431
           C  L+  GY V  + A     H P    + Y++   WM + MA +L++
Sbjct: 584 CTLLLQRGYRVEYSAASDAFTHCPEGFNEFYNQRRRWMPSTMANILDL 631


>AM292380-1|CAL23192.2|  489|Tribolium castaneum gustatory receptor
           candidate 59 protein.
          Length = 489

 Score = 21.0 bits (42), Expect = 9.0
 Identities = 8/24 (33%), Positives = 15/24 (62%)
 Frame = -1

Query: 310 IFSMSSQLVTIPCSMGYLRSGYLF 239
           +  ++SQ V I CS+ +   GY++
Sbjct: 243 LMKIASQFVGIFCSLYFCIFGYIY 266


>AM292346-1|CAL23158.2|  314|Tribolium castaneum gustatory receptor
           candidate 25 protein.
          Length = 314

 Score = 21.0 bits (42), Expect = 9.0
 Identities = 8/24 (33%), Positives = 15/24 (62%)
 Frame = -1

Query: 310 IFSMSSQLVTIPCSMGYLRSGYLF 239
           +  ++SQ V I CS+ +   GY++
Sbjct: 68  LMKIASQFVGIFCSLYFCIFGYIY 91


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 168,266
Number of Sequences: 336
Number of extensions: 4049
Number of successful extensions: 26
Number of sequences better than 10.0: 22
Number of HSP's better than 10.0 without gapping: 24
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 26
length of database: 122,585
effective HSP length: 55
effective length of database: 104,105
effective search space used: 17073220
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).